Public recordExceptional
Software health reportschema 0.34.0 · metrics 2.10.0 · 2026-09-05 23:31 UTC
Azure / typespec-azure
About TypeSpec Azure Libraries
Azure/typespec-azure holds a health index of 97 out of 100, placing it in the Exceptional band. It scores highest on Vitality (100/100) and lowest on Community & Adoption (73/100). It was last updated today. 3 contributors account for most of its recent work.
97
overall / 100Software health index
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
97
Exceptional93-100The record's top tier (≈ top 5%); essentially all checked criteria met
Excellent80-92Strong across the board; minor gaps
Good65-79Healthy; gaps are limited and manageable
Moderate50-64Acceptable with notable gaps; review recommended
Weak35-49Material weaknesses across several areas
At Risk20-34Significant weaknesses; adoption warrants caution
Critical1-19Severe problems (abandoned, single-maintainer, no hygiene)
Score profile
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 85 is calibrated to 97 on the published index scale (record calibration 2026-08-02).
Ownership
Microsoft AzureOrganization · verified domain
15,277 followers2,735 public repossince Mar 2014
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
Package ecosystems
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | @azure-tools/typespec-go | 0.17.3 | 14,132 | 112 | 8 days ago | gogolangtypespec |
| npm | @azure-tools/typespec-ts | 0.56.0 | 10,417 | 802 | 25 days ago | — |
| npm | @azure-tools/typespec-java | 0.46.3 | 4,943 | 225 | 1 day ago | typespec |
| npm | @azure-tools/typespec-python | 0.63.5 | 3,571 | 201 | 22 days ago | typespec |
| npm | @azure-tools/azure-http-specs | 0.1.0-alpha.44 | 8,114 | 237 | 25 days ago | — |
| npm | @azure-tools/typespec-autorest | 0.71.0 | 92,897 | 371 | 25 days ago | typespecautorest |
| npm | @azure-tools/typespec-metadata | 0.3.0 | 9,991 | 13 | 25 days ago | typespecemittermetadataapiview |
| npm | @azure-tools/typespec-azure-core | 0.71.0 | 94,931 | 361 | 25 days ago | typespec |
Metrics by category
Vitality
Is the project alive — is code being written and are releases shipping?
100
Development activity
100Exceptional
How it's scored
| 36/36 | Push recency — last push 0 days ago |
| 36/36 | Commit cadence — 52/52 weeks with commits |
| 18/18 | Commit volume — 1,002 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 26 issue activity found in the last 90 days -- score normalized to 10 |
Inputs used
| commits_last_year | 1,002 |
| human_commit_share | 0.89 |
| days_since_last_push | 0 |
| active_weeks_last_year | 52 |
Release discipline
100Exceptional
How it's scored
| 27/27 | Ships releases — 100 releases published |
| 36/36 | Release recency — latest release 1 days ago |
| 27/27 | Release cadence — a release every ~2.4 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
Inputs used
| releases_count | 100 |
| latest_release_tag | @azure-tools/typespec-java@0.46.3 |
| releases_from_tags | no |
| days_since_latest_release | 1 |
| mean_days_between_releases | 2.4 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.
Community & Adoption
Does the project have users, downloads, attention, and a welcoming setup for contributors?
73
Popularity & adoption
52Moderate
How it's scored
| 23/60 | Stars — 27 stars |
| 16.2/25 | Forks — 90 forks |
| 12.4/15 | Watchers — 168 watchers |
Inputs used
| forks | 90 |
| stars | 27 |
| watchers | 168 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community health
85Excellent
How it's scored
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 18/18 | CONTRIBUTING guide |
| 13.5/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
Inputs used
| has_readme | yes |
| has_license | yes |
| readme_badges | 6 |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | yes |
| readme_badge_services | shields.io |
| has_pull_request_template | no |
Ecosystem adoption (downloads)
90Excellent
How it's scored
| 71.7/80 | Monthly downloads — 238,996 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
Inputs used
| packages | @azure-tools/typespec-go, @azure-tools/typespec-ts, @azure-tools/typespec-java, @azure-tools/typespec-python, @azure-tools/azure-http-specs, @azure-tools/typespec-autorest, @azure-tools/typespec-metadata, @azure-tools/typespec-azure-core |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 238,996 |
| unverified_packages_excluded | — |
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.
Sustainability & Governance
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
86
How it's scored
| 36/54 | Bus factor — 3 contributor(s) cover half of all commits |
| 16.8/22.5 | Commit distribution — top contributor authored 25% of commits |
| 13.5/13.5 | Contributor breadth — 68 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 10 contributing companies or organizations |
Inputs used
| bus_factor | 3 |
| contributors_sampled | 68 |
| top_contributor_share | 0.253 |
How it's scored
| 34.2/42 | Issue resolution — 81% of issues closed |
| 25.1/30 | PR acceptance — 2,759/3,303 decided PRs merged |
| 0/13 | Newcomer PR acceptance — 0/1 first-time contributors' PRs merged in 30d |
| 15/15 | OpenSSF Scorecard: Code-Review — all changesets reviewed |
Inputs used
| merged_prs | 2,759 |
| open_issues | 382 |
| closed_issues | 1,669 |
| prs_merged_7d | 42 |
| prs_decided_7d | 46 |
| prs_merged_30d | 43 |
| prs_decided_30d | 47 |
| issue_closed_ratio | 0.814 |
| closed_unmerged_prs | 544 |
| first_time_authors_30d | 1 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 1 |
Ownership & stewardship
100Exceptional
How it's scored
| 30/30 | Ownership backing — organization-owned |
| 20/20 | Verified domain |
| 25/25 | Owner reach — 15,277 followers of Azure |
| 25/25 | Track record — 2,735 public repos, account ~12 yr old |
Inputs used
| followers | 15,277 |
| owner_type | Organization |
| is_verified | yes |
| owner_login | Azure |
| public_repos | 2,735 |
| account_age_days | 4,569 |
Package maintenance
100Exceptional
How it's scored
| 25/25 | Published & resolvable — 8 package(s) on npm |
| 35/35 | Publish recency — latest publish 1 days ago |
| 20/20 | Version history — 802 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
Inputs used
| packages | @azure-tools/typespec-go, @azure-tools/typespec-ts, @azure-tools/typespec-java, @azure-tools/typespec-python, @azure-tools/azure-http-specs, @azure-tools/typespec-autorest, @azure-tools/typespec-metadata, @azure-tools/typespec-azure-core |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 1 |
Engineering Quality
Are baseline engineering and documentation practices in place?
86
Engineering practices
90Excellent
How it's scored
| 24/24 | CI workflows — 30 workflow(s) |
| 24/24 | Tests present |
| 16/16 | Linter config — tox.ini |
| 0/9.6 | Pre-commit hooks |
| 6.4/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 30 out of 30 merged PRs checked by a CI test -- score normalized to 10 |
Inputs used
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | yes |
| has_linter_config | yes |
| has_precommit_config | no |
Documentation
80Excellent
How it's scored
| 30/30 | README |
| 25/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://azure.github.io/typespec-azure/ |
| 10/10 | Repository description |
| 0/10 | Topics |
| 0/10 | Wiki |
Inputs used
| topics | — |
| has_wiki | no |
| homepage | https://azure.github.io/typespec-azure/ |
| docs_site | https://azure.github.io/typespec-azure/ |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Security
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
76
Security posture
70Good
How it's scored
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 3/7.5 | Branch-Protection — branch protection is not maximal on development and all release branches |
| 2.5/2.5 | CI-Tests — 30 out of 30 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 7.5/7.5 | Code-Review — all changesets reviewed |
| 2.5/2.5 | Contributors — project has 10 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 26 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — no data |
| 4/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 8 |
| 5/5 | SAST — SAST tool is run on all commits |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 62 existing vulnerabilities detected |
Inputs used
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 7 |
Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.
Dependency advisories
100Exceptional
How it's scored
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 25/25 | Indirect dependencies free of known advisories — no indirect dependency carries a known advisory |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
Inputs used
| source | osv |
| advisories | 0 |
| affected_packages | 0 |
| assessed_packages | 1 |
| unassessed_packages | 0 |
| affected_by_severity | none |
| direct_affected_packages | 0 |
Excluded from scoring (no data or not applicable): No advisories left outstanding. Remaining weights renormalized. Matched the npm:@azure-tools/typespec-go@0.17.3 runtime dependency closure — what installing the published package pulls in — 1 packages. Reachability is not analyzed.
AI Readiness
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
95
Agent context & guidance
85Excellent
How it's scored
| 45/45 | Agent instructions — .github/copilot-instructions.md, .github/instructions/typespec-ts.instructions.md |
| 0/15 | Machine-readable docs (llms.txt) |
| 40/40 | Legible commit history — 89 of 89 human commits state their intent (structured subject or explanatory body) |
Inputs used
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 1 |
| agent_instruction_files | .github/copilot-instructions.md, .github/instructions/typespec-ts.instructions.md |
| agent_instruction_max_bytes | 7,335 |
Verify loop (build / test / typecheck)
98Exceptional
How it's scored
| 18/18 | One-command bootstrap — mise.toml |
| 22/22 | Automated tests |
| 11/11 | Lint / format config — tox.ini |
| 11/11 | Static type checking — eng/scripts/doc-updater/tsconfig.json, eng/tsconfig.json, packages/azure-http-specs/tsconfig.json, packages/benchmark/tsconfig.json, packages/samples/tsconfig.json, packages/spector-runner/tsconfig.json, packages/typespec-autorest-canonical/tsconfig.json, packages/typespec-autorest/tsconfig.json, packages/typespec-azure-core/tsconfig.json, packages/typespec-azure-playground-website/tsconfig.json, packages/typespec-azure-portal-core/tsconfig.json, packages/typespec-azure-resource-manager/tsconfig.json, packages/typespec-azure-rulesets/tsconfig.json, packages/typespec-client-generator-core/tsconfig.json, packages/typespec-go/tsconfig.json, packages/typespec-java/tsconfig.json, packages/typespec-metadata/tsconfig.json, packages/typespec-python/eng/scripts/ci/config/mypy.ini, packages/typespec-python/eng/scripts/ci/config/pyrightconfig.json, packages/typespec-python/tsconfig.json, packages/typespec-ts/test/tsconfig.json, packages/typespec-ts/tsconfig.json, tsconfig.json, website/tsconfig.json |
| 10/10 | Reproducible environment — devcontainer, Dockerfile, lockfile |
| 10/10 | Demonstrated agent practice — 40 of the last 100 commits agent-authored or agent-credited |
| 8/8 | Automated maintenance — 11 of the last 100 commits are automated dependency updates |
| 8/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 8 |
Inputs used
| has_nix | no |
| has_tests | yes |
| lockfiles | go.sum, pnpm-lock.yaml |
| has_dockerfile | yes |
| typed_language | yes |
| bootstrap_files | mise.toml |
| has_devcontainer | yes |
| has_linter_config | yes |
| typecheck_configs | eng/scripts/doc-updater/tsconfig.json, eng/tsconfig.json, packages/azure-http-specs/tsconfig.json, packages/benchmark/tsconfig.json, packages/samples/tsconfig.json, packages/spector-runner/tsconfig.json, packages/typespec-autorest-canonical/tsconfig.json, packages/typespec-autorest/tsconfig.json, packages/typespec-azure-core/tsconfig.json, packages/typespec-azure-playground-website/tsconfig.json, packages/typespec-azure-portal-core/tsconfig.json, packages/typespec-azure-resource-manager/tsconfig.json, packages/typespec-azure-rulesets/tsconfig.json, packages/typespec-client-generator-core/tsconfig.json, packages/typespec-go/tsconfig.json, packages/typespec-java/tsconfig.json, packages/typespec-metadata/tsconfig.json, packages/typespec-python/eng/scripts/ci/config/mypy.ini, packages/typespec-python/eng/scripts/ci/config/pyrightconfig.json, packages/typespec-python/tsconfig.json, packages/typespec-ts/test/tsconfig.json, packages/typespec-ts/tsconfig.json, tsconfig.json, website/tsconfig.json |
| agent_commit_share | 0.4 |
| toolchain_manifests | packages/typespec-go/test/local/containingmod/go.mod, packages/typespec-java/docs/samples/specification/management/generated/pom.xml, packages/typespec-java/emitter-tests/customization/pom.xml, packages/typespec-java/emitter-tests/pom.xml |
| dependency_bot_commit_share | 0.11 |
Code legibility for models
100Exceptional
How it's scored
| 45/45 | Type-checkable code — TypeScript (statically typed) |
| 54.6/55 | Manageable file sizes — 13/1,953 source files over 60KB |
Inputs used
| primary_language | TypeScript |
| largest_source_bytes | 153,204 |
| source_files_sampled | 1,953 |
| oversized_source_files | 13 |
Machine-readable interfaces
100Exceptional
How it's scored
| 40/40 | API schema (OpenAPI/GraphQL/proto) — packages/samples/test/output/azure/core/data-plane/api-path-parameter/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/azure-core-scalars/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/custom-error-type/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/trait-versioning/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/trait-versioning/@azure-tools/typespec-autorest/2023-02-07/openapi.json, packages/samples/test/output/azure/core/data-plane/widget-manager/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/misc/overloads/@azure-tools/typespec-autorest/openapi.json, packages/samples/test/output/azure/core/misc/x-ms-examples/flat/@azure-tools/typespec-autorest/openapi.json, packages/samples/test/output/azure/core/misc/x-ms-examples/nested/@azure-tools/typespec-autorest/openapi.json, packages/samples/test/output/azure/resource-manager/arm-library/@azure-tools/typespec-autorest/2021-09-21-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/legacy-operations/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/managed-identity/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/non-standard-properties/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/nsp/@azure-tools/typespec-autorest/2025-11-19-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/optional-body/@azure-tools/typespec-autorest/2025-01-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/polymorphic-resource/@azure-tools/typespec-autorest/2025-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/private-endpoints/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/private-links/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/rename-operations/@azure-tools/typespec-autorest/2025-01-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/static-routes/@azure-tools/typespec-autorest/2025-06-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/operations/nobody-action/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/operations/operation-provider/@azure-tools/typespec-autorest/2022-11-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/operations/operation-status/@azure-tools/typespec-autorest/2022-11-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/billing-data/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/common-properties/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/encryption/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/managed-identity/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/private-links/@azure-tools/typespec-autorest/2023-08-01/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/private-links/@azure-tools/typespec-autorest/2023-11-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/agent/@azure-tools/typespec-autorest/2026-04-01/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/extension/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/location/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/nsp/@azure-tools/typespec-autorest/2025-11-19-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/private-endpoints/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/private-links/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/proxy/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/relationship/@azure-tools/typespec-autorest/2024-06-01/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/singleton/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/specific-extension/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/tenant/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/tracked/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/virtual-resource/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json |
| 20/20 | MCP server |
| 40/40 | Runnable examples — example, examples, sample, samples |
Inputs used
| example_dirs | example, examples, sample, samples |
| has_mcp_signal | yes |
| api_schema_files | packages/samples/test/output/azure/core/data-plane/api-path-parameter/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/azure-core-scalars/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/custom-error-type/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/trait-versioning/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/data-plane/trait-versioning/@azure-tools/typespec-autorest/2023-02-07/openapi.json, packages/samples/test/output/azure/core/data-plane/widget-manager/@azure-tools/typespec-autorest/2022-08-31/openapi.json, packages/samples/test/output/azure/core/misc/overloads/@azure-tools/typespec-autorest/openapi.json, packages/samples/test/output/azure/core/misc/x-ms-examples/flat/@azure-tools/typespec-autorest/openapi.json, packages/samples/test/output/azure/core/misc/x-ms-examples/nested/@azure-tools/typespec-autorest/openapi.json, packages/samples/test/output/azure/resource-manager/arm-library/@azure-tools/typespec-autorest/2021-09-21-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/legacy-operations/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/managed-identity/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/non-standard-properties/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/nsp/@azure-tools/typespec-autorest/2025-11-19-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/optional-body/@azure-tools/typespec-autorest/2025-01-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/polymorphic-resource/@azure-tools/typespec-autorest/2025-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/private-endpoints/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/private-links/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/rename-operations/@azure-tools/typespec-autorest/2025-01-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/legacy/static-routes/@azure-tools/typespec-autorest/2025-06-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/operations/nobody-action/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/operations/operation-provider/@azure-tools/typespec-autorest/2022-11-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/operations/operation-status/@azure-tools/typespec-autorest/2022-11-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/billing-data/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/common-properties/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/encryption/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/managed-identity/@azure-tools/typespec-autorest/2023-03-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/private-links/@azure-tools/typespec-autorest/2023-08-01/openapi.json, packages/samples/test/output/azure/resource-manager/resource-common-properties/private-links/@azure-tools/typespec-autorest/2023-11-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/agent/@azure-tools/typespec-autorest/2026-04-01/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/extension/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/location/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/nsp/@azure-tools/typespec-autorest/2025-11-19-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/private-endpoints/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/private-links/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/proxy/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/relationship/@azure-tools/typespec-autorest/2024-06-01/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/singleton/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/specific-extension/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/tenant/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/tracked/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json, packages/samples/test/output/azure/resource-manager/resource-types/virtual-resource/@azure-tools/typespec-autorest/2021-10-01-preview/openapi.json |
| interfaces_expected_of | — |
Key facts
27GitHub stars
68contributors
1,002commits, last 12 months
0days since last push
100releases
3bus factor
382open issues
npmpackage ecosystems
Data collection warnings
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
More detail
Star and fork history 0 ★ / 90 ⇿
0Stars
90Forks
96Releases
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Major 0Minor 0Patch 0
Each point covers 3 days.
OpenSSF Scorecard 7.0 / 10
7.0aggregate
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 4 | Branch-Protection | branch protection is not maximal on development and all release branches |
| 10 | CI-Tests | 30 out of 30 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 10 | Code-Review | all changesets reviewed |
| 10 | Contributors | project has 10 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 26 issue activity found in the last 90 days -- score normalized to 10 |
| n/a | Packaging | packaging workflow not detected |
| 8 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 8 |
| 10 | SAST | SAST tool is run on all commits |
| 10 | Security-Policy | security policy file detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 62 existing vulnerabilities detected |
Direct dependencies 65
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| npm | picocolors | catalog: | package.json |
| npm | @astrojs/check | catalog: | website/package.json |
| npm | @astrojs/react | catalog: | website/package.json |
| npm | @astrojs/starlight | catalog: | website/package.json |
| npm | @docsearch/css | catalog: | website/package.json |
| npm | @docsearch/js | catalog: | website/package.json |
| npm | @fluentui/react-components | catalog: | website/package.json |
| npm | @typespec/playground | workspace:^ | website/package.json |
| npm | astro | catalog: | website/package.json |
| npm | chart.js | catalog: | website/package.json |
| npm | es-module-shims | catalog: | website/package.json |
| npm | react | catalog: | website/package.json |
| npm | react-chartjs-2 | catalog: | website/package.json |
| npm | react-dom | catalog: | website/package.json |
| npm | sharp | catalog: | website/package.json |
| npm | typescript | catalog: | website/package.json |
| npm | autorest | ^3.4.2 | eng/scripts/package.json |
| npm | js-yaml | ^4.1.0 | eng/scripts/package.json |
| npm | @typespec/spec-api | workspace:^ | packages/azure-http-specs/package.json |
| npm | @typespec/spector | workspace:^ | packages/azure-http-specs/package.json |
| npm | yaml | catalog: | packages/spector-runner/package.json |
| npm | yaml | catalog: | packages/typespec-autorest/package.json |
| npm | @azure-tools/typespec-autorest | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @azure-tools/typespec-azure-core | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @azure-tools/typespec-azure-resource-manager | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @azure-tools/typespec-azure-rulesets | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @azure-tools/typespec-client-generator-core | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @azure-tools/typespec-ts | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @fluentui/react-components | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | @fluentui/react-icons | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/compiler | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/events | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/http | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/json-schema | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/openapi | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/openapi3 | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/protobuf | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/rest | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/sse | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/streams | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/versioning | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @typespec/xml | workspace:^ | packages/typespec-azure-playground-website/package.json |
| npm | @vitejs/plugin-react | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | es-module-shims | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | react | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | react-dom | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | vite | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | yaml | catalog: | packages/typespec-azure-playground-website/package.json |
| npm | change-case | catalog: | packages/typespec-azure-resource-manager/package.json |
| npm | pluralize | catalog: | packages/typespec-azure-resource-manager/package.json |
| npm | change-case | catalog: | packages/typespec-client-generator-core/package.json |
| npm | pluralize | catalog: | packages/typespec-client-generator-core/package.json |
| npm | yaml | catalog: | packages/typespec-client-generator-core/package.json |
| npm | semver | catalog: | packages/typespec-go/package.json |
| npm | @autorest/codemodel | catalog: | packages/typespec-java/package.json |
| npm | @azure-tools/codegen | catalog: | packages/typespec-java/package.json |
| npm | yaml | catalog: | packages/typespec-java/package.json |
| npm | yaml | catalog: | packages/typespec-metadata/package.json |
| npm | @typespec/http-client-python | catalog: | packages/typespec-python/package.json |
| npm | semver | catalog: | packages/typespec-python/package.json |
| npm | fast-xml-parser | catalog: | packages/typespec-ts/package.json |
| npm | pluralize | catalog: | packages/typespec-ts/package.json |
| npm | prettier | catalog: | packages/typespec-ts/package.json |
| npm | ts-morph | catalog: | packages/typespec-ts/package.json |
| npm | tslib | catalog: | packages/typespec-ts/package.json |
All dependencies 1,945
Full resolved dependency set from the GitHub dependency graph: 89 direct and 1,856 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | @astrojs/check | 0.9.10 | direct |
| npm | @astrojs/check | catalog: | direct |
| npm | @astrojs/react | 6.0.4 | direct |
| npm | @astrojs/react | catalog: | direct |
| npm | @astrojs/starlight | 0.41.9 | direct |
| npm | @astrojs/starlight | catalog: | direct |
| npm | @autorest/codemodel | 4.20.1 | direct |
| npm | @autorest/codemodel | catalog: | direct |
| npm | @azure-tools/codegen | 2.10.1 | direct |
| npm | @azure-tools/codegen | catalog: | direct |
| npm | @azure-tools/typespec-autorest | latest | direct |
| npm | @azure-tools/typespec-azure-core | latest | direct |
| npm | @azure-tools/typespec-azure-resource-manager | latest | direct |
| npm | @azure-tools/typespec-azure-rulesets | latest | direct |
| npm | @azure-tools/typespec-client-generator-core | latest | direct |
| npm | @azure-tools/typespec-ts | latest | direct |
| npm | @docsearch/css | 4.7.0 | direct |
| npm | @docsearch/css | catalog: | direct |
| npm | @docsearch/js | 4.7.0 | direct |
| npm | @docsearch/js | catalog: | direct |
| npm | @fluentui/react-components | 9.74.3 | direct |
| npm | @fluentui/react-components | catalog: | direct |
| npm | @fluentui/react-icons | 2.0.333 | direct |
| npm | @fluentui/react-icons | catalog: | direct |
| npm | @typespec/compiler | latest | direct |
| npm | @typespec/events | latest | direct |
| npm | @typespec/http | latest | direct |
| npm | @typespec/http-client-python | 0.37.0 | direct |
| npm | @typespec/http-client-python | catalog: | direct |
| npm | @typespec/openapi | latest | direct |
| npm | @typespec/rest | latest | direct |
| npm | @typespec/sse | latest | direct |
| npm | @typespec/streams | latest | direct |
| npm | @typespec/versioning | latest | direct |
| npm | @typespec/xml | latest | direct |
| npm | @vitejs/plugin-react | 5.2.0 | direct |
| npm | @vitejs/plugin-react | 6.1.0 | direct |
| npm | @vitejs/plugin-react | catalog: | direct |
| npm | astro | 7.2.8 | direct |
| npm | astro | catalog: | direct |
| npm | autorest | 3.8.0 | direct |
| npm | autorest | ^3.4.2 | direct |
| npm | autorest | catalog: | direct |
| npm | change-case | 5.4.4 | direct |
| npm | change-case | catalog: | direct |
| npm | chart.js | 4.5.1 | direct |
| npm | chart.js | catalog: | direct |
| npm | es-module-shims | 2.8.4 | direct |
| npm | es-module-shims | catalog: | direct |
| npm | fast-xml-parser | 5.11.1 | direct |
| npm | fast-xml-parser | catalog: | direct |
| npm | js-yaml | 3.15.2 | direct |
| npm | js-yaml | 4.1.1 | direct |
| npm | js-yaml | 4.3.2 | direct |
| npm | js-yaml | ^4.1.0 | direct |
| npm | picocolors | 1.1.1 | direct |
| npm | picocolors | catalog: | direct |
| npm | pluralize | 2.0.0 | direct |
| npm | pluralize | 8.0.0 | direct |
| npm | pluralize | catalog: | direct |
| npm | prettier | 3.9.6 | direct |
| npm | prettier | catalog: | direct |
| npm | react | 19.2.8 | direct |
| npm | react | catalog: | direct |
| npm | react-chartjs-2 | 5.3.1 | direct |
| npm | react-chartjs-2 | catalog: | direct |
| npm | react-dom | 19.2.8 | direct |
| npm | react-dom | catalog: | direct |
| npm | semver | 5.7.2 | direct |
| npm | semver | 6.3.1 | direct |
| npm | semver | 7.6.3 | direct |
| npm | semver | 7.7.4 | direct |
| npm | semver | 7.8.5 | direct |
| npm | semver | catalog: | direct |
| npm | sharp | 0.35.4 | direct |
| npm | sharp | catalog: | direct |
| npm | ts-morph | 28.0.0 | direct |
| npm | ts-morph | catalog: | direct |
| npm | tslib | 2.8.1 | direct |
| npm | tslib | catalog: | direct |
| npm | typescript | 5.9.3 | direct |
| npm | typescript | 6.0.3 | direct |
| npm | typescript | catalog: | direct |
| npm | typescript | ~5.7.0 | direct |
| npm | vite | 8.2.2 | direct |
| npm | vite | catalog: | direct |
| npm | yaml | 2.8.3 | direct |
| npm | yaml | 2.9.0 | direct |
| npm | yaml | catalog: | direct |
| Go | github.com/azure/azure-sdk-for-go/sdk/azcore | v1.22.0 | indirect |
| Go | github.com/azure/azure-sdk-for-go/sdk/internal | v1.12.0 | indirect |
| Go | github.com/davecgh/go-spew | v1.1.1 | indirect |
| Go | github.com/pmezard/go-difflib | v1.0.0 | indirect |
| Go | github.com/stretchr/testify | v1.11.1 | indirect |
| Go | golang.org/x/net | v0.55.0 | indirect |
| Go | golang.org/x/text | v0.37.0 | indirect |
| Go | gopkg.in/yaml.v3 | v3.0.1 | indirect |
| Maven | com.azure.tools:azure-autorest-customization | 1.0.0-beta.11 | indirect |
| Maven | com.azure:azure-core | 1.14.1 | indirect |
| Maven | com.azure:azure-core | 1.57.1 | indirect |
| Maven | com.azure:azure-core-management | 1.19.3 | indirect |
| Maven | com.azure:azure-core-management | 1.2.0 | indirect |
| Maven | com.azure:azure-core-test | 1.27.0-beta.14 | indirect |
| Maven | com.azure:azure-identity | 1.18.2 | indirect |
| Maven | com.azure:azure-json | 1.5.1 | indirect |
| Maven | com.azure:azure-xml | 1.2.1 | indirect |
| Maven | com.fasterxml.jackson.dataformat:jackson-dataformat-xml | 2.18.7 | indirect |
| Maven | io.projectreactor:reactor-test | 3.7.11 | indirect |
| Maven | net.bytebuddy:byte-buddy | 1.17.7 | indirect |
| Maven | net.bytebuddy:byte-buddy-agent | 1.17.7 | indirect |
| Maven | org.apache.maven.plugins:maven-compiler-plugin | 3.8.1 | indirect |
| Maven | org.apache.maven.plugins:maven-javadoc-plugin | 3.11.3 | indirect |
| Maven | org.junit.jupiter:junit-jupiter-api | 5.13.4 | indirect |
| Maven | org.mockito:mockito-core | 4.11.0 | indirect |
| Maven | org.slf4j:slf4j-simple | 1.7.36 | indirect |
| npm | @adobe/css-tools | 4.5.0 | indirect |
| npm | @alloy-js/babel-plugin | 0.2.1 | indirect |
| npm | @alloy-js/babel-plugin-jsx-dom-expressions | 0.40.0 | indirect |
| npm | @alloy-js/babel-preset | 0.3.0 | indirect |
| npm | @alloy-js/cli | 0.24.0 | indirect |
| npm | @alloy-js/core | 0.24.1 | indirect |
| npm | @alloy-js/csharp | 0.24.0 | indirect |
| npm | @alloy-js/markdown | 0.24.0 | indirect |
| npm | @alloy-js/msbuild | 0.24.0 | indirect |
| npm | @alloy-js/python | 0.5.0 | indirect |
| npm | @alloy-js/rollup-plugin | 0.1.2 | indirect |
| npm | @alloy-js/typescript | 0.24.0 | indirect |
| npm | @asamuzakjp/css-color | 3.2.0 | indirect |
| npm | @astrojs/compiler | 2.13.1 | indirect |
| npm | @astrojs/compiler-binding | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-darwin-arm64 | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-darwin-x64 | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-linux-arm64-gnu | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-linux-arm64-musl | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-linux-x64-gnu | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-linux-x64-musl | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-wasm32-wasi | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-win32-arm64-msvc | 0.4.0 | indirect |
| npm | @astrojs/compiler-binding-win32-x64-msvc | 0.4.0 | indirect |
| npm | @astrojs/compiler-rs | 0.4.0 | indirect |
| npm | @astrojs/internal-helpers | 0.10.4 | indirect |
| npm | @astrojs/language-server | 2.16.15 | indirect |
| npm | @astrojs/markdown-remark | 7.2.4 | indirect |
| npm | @astrojs/markdown-satteri | 0.3.8 | indirect |
| npm | @astrojs/mdx | 7.0.8 | indirect |
| npm | @astrojs/prism | 4.0.2 | indirect |
| npm | @astrojs/sitemap | 3.7.3 | indirect |
| npm | @astrojs/telemetry | 3.3.3 | indirect |
| npm | @astrojs/yaml2ts | 0.2.4 | indirect |
| npm | @azu/format-text | 1.0.2 | indirect |
| npm | @azu/style-format | 1.0.1 | indirect |
| npm | @azure-rest/core-client | 2.8.0 | indirect |
| npm | @azure-rest/core-client | catalog: | indirect |
| npm | @azure-tools/async-io | 3.0.254 | indirect |
| npm | @azure-tools/tasks | 3.0.255 | indirect |
| npm | @azure-tools/typespec-go | latest | indirect |
| npm | @azure-tools/typespec-java | latest | indirect |
| npm | @azure-tools/typespec-providerhub | latest | indirect |
| npm | @azure-tools/typespec-python | ^0.61.0 | indirect |
| npm | @azure-typespec/http-client-csharp | latest | indirect |
| npm | @azure/abort-controller | 2.2.0 | indirect |
| npm | @azure/abort-controller | catalog: | indirect |
| npm | @azure/core-auth | 1.11.0 | indirect |
| npm | @azure/core-auth | catalog: | indirect |
| npm | @azure/core-client | 1.11.0 | indirect |
| npm | @azure/core-http-compat | 2.5.0 | indirect |
| npm | @azure/core-lro | 2.7.2 | indirect |
| npm | @azure/core-lro | 3.4.0 | indirect |
| npm | @azure/core-lro | ^1.0.0 | indirect |
| npm | @azure/core-lro | catalog: | indirect |
| npm | @azure/core-paging | 1.7.0 | indirect |
| npm | @azure/core-paging | catalog: | indirect |
| npm | @azure/core-process | 1.0.0 | indirect |
| npm | @azure/core-rest-pipeline | 1.25.0 | indirect |
| npm | @azure/core-rest-pipeline | catalog: | indirect |
| npm | @azure/core-tracing | 1.4.0 | indirect |
| npm | @azure/core-util | 1.14.0 | indirect |
| npm | @azure/core-util | catalog: | indirect |
| npm | @azure/core-xml | 1.6.0 | indirect |
| npm | @azure/identity | 4.13.2 | indirect |
| npm | @azure/logger | 1.4.0 | indirect |
| npm | @azure/logger | catalog: | indirect |
| npm | @azure/msal-browser | 5.19.0 | indirect |
| npm | @azure/msal-common | 16.13.0 | indirect |
| npm | @azure/msal-node | 5.6.0 | indirect |
| npm | @azure/storage-blob | 12.33.0 | indirect |
| npm | @azure/storage-common | 12.5.0 | indirect |
| npm | @babel/code-frame | 7.12.11 | indirect |
| npm | @babel/code-frame | 7.29.7 | indirect |
| npm | @babel/compat-data | 7.29.7 | indirect |
| npm | @babel/core | 7.29.7 | indirect |
| npm | @babel/generator | 7.29.8 | indirect |
| npm | @babel/helper-annotate-as-pure | 7.29.7 | indirect |
| npm | @babel/helper-compilation-targets | 7.29.7 | indirect |
| npm | @babel/helper-create-class-features-plugin | 7.29.7 | indirect |
| npm | @babel/helper-globals | 7.29.7 | indirect |
| npm | @babel/helper-member-expression-to-functions | 7.29.7 | indirect |
| npm | @babel/helper-module-imports | 7.27.1 | indirect |
| npm | @babel/helper-module-imports | 7.29.7 | indirect |
| npm | @babel/helper-module-transforms | 7.29.7 | indirect |
| npm | @babel/helper-optimise-call-expression | 7.29.7 | indirect |
| npm | @babel/helper-plugin-utils | 7.29.7 | indirect |
| npm | @babel/helper-replace-supers | 7.29.7 | indirect |
| npm | @babel/helper-skip-transparent-expression-wrappers | 7.29.7 | indirect |
| npm | @babel/helper-string-parser | 7.29.7 | indirect |
| npm | @babel/helper-validator-identifier | 7.29.7 | indirect |
| npm | @babel/helper-validator-option | 7.29.7 | indirect |
| npm | @babel/helpers | 7.29.7 | indirect |
| npm | @babel/highlight | 7.25.9 | indirect |
| npm | @babel/parser | 7.29.8 | indirect |
| npm | @babel/plugin-syntax-jsx | 7.29.7 | indirect |
| npm | @babel/plugin-syntax-typescript | 7.29.7 | indirect |
| npm | @babel/plugin-transform-modules-commonjs | 7.29.7 | indirect |
| npm | @babel/plugin-transform-react-jsx-self | 7.29.7 | indirect |
| npm | @babel/plugin-transform-react-jsx-source | 7.29.7 | indirect |
| npm | @babel/plugin-transform-typescript | 7.29.7 | indirect |
| npm | @babel/preset-typescript | 7.29.7 | indirect |
| npm | @babel/runtime | 7.29.7 | indirect |
| npm | @babel/template | 7.29.7 | indirect |
| npm | @babel/traverse | 7.29.8 | indirect |
| npm | @babel/types | 7.29.8 | indirect |
| npm | @bcoe/v8-coverage | 1.0.2 | indirect |
| npm | @bruits/satteri-darwin-arm64 | 0.10.5 | indirect |
| npm | @bruits/satteri-darwin-arm64 | 0.9.5 | indirect |
| npm | @bruits/satteri-darwin-x64 | 0.10.5 | indirect |
| npm | @bruits/satteri-darwin-x64 | 0.9.5 | indirect |
| npm | @bruits/satteri-linux-arm64-gnu | 0.10.5 | indirect |
| npm | @bruits/satteri-linux-arm64-gnu | 0.9.5 | indirect |
| npm | @bruits/satteri-linux-arm64-musl | 0.10.5 | indirect |
| npm | @bruits/satteri-linux-arm64-musl | 0.9.5 | indirect |
| npm | @bruits/satteri-linux-x64-gnu | 0.10.5 | indirect |
| npm | @bruits/satteri-linux-x64-gnu | 0.9.5 | indirect |
| npm | @bruits/satteri-linux-x64-musl | 0.10.5 | indirect |
| npm | @bruits/satteri-linux-x64-musl | 0.9.5 | indirect |
| npm | @bruits/satteri-wasm32-wasi | 0.10.5 | indirect |
| npm | @bruits/satteri-wasm32-wasi | 0.9.5 | indirect |
| npm | @bruits/satteri-win32-arm64-msvc | 0.10.5 | indirect |
| npm | @bruits/satteri-win32-arm64-msvc | 0.9.5 | indirect |
| npm | @bruits/satteri-win32-x64-msvc | 0.10.5 | indirect |
| npm | @bruits/satteri-win32-x64-msvc | 0.9.5 | indirect |
| npm | @capsizecss/unpack | 4.0.1 | indirect |
| npm | @chronus/chronus | 1.5.0 | indirect |
| npm | @chronus/github | 1.2.0 | indirect |
| npm | @chronus/github-pr-commenter | 1.1.1 | indirect |
| npm | @clack/core | 1.4.3 | indirect |
| npm | @clack/prompts | 1.7.0 | indirect |
| npm | @colors/colors | 1.5.0 | indirect |
| npm | @cspell/cspell-bundled-dicts | 10.1.1 | indirect |
| npm | @cspell/cspell-json-reporter | 10.1.1 | indirect |
| npm | @cspell/cspell-performance-monitor | 10.1.1 | indirect |
| npm | @cspell/cspell-pipe | 10.1.1 | indirect |
| npm | @cspell/cspell-resolver | 10.1.1 | indirect |
| npm | @cspell/cspell-service-bus | 10.1.1 | indirect |
| npm | @cspell/cspell-types | 10.1.1 | indirect |
| npm | @cspell/cspell-worker | 10.1.1 | indirect |
| npm | @cspell/dict-ada | 4.1.1 | indirect |
| npm | @cspell/dict-al | 1.1.1 | indirect |
| npm | @cspell/dict-aws | 4.0.17 | indirect |
| npm | @cspell/dict-bash | 4.2.3 | indirect |
| npm | @cspell/dict-companies | 3.2.12 | indirect |
| npm | @cspell/dict-cpp | 7.1.0 | indirect |
| npm | @cspell/dict-cryptocurrencies | 5.0.5 | indirect |
| npm | @cspell/dict-csharp | 4.0.8 | indirect |
| npm | @cspell/dict-css | 4.1.2 | indirect |
| npm | @cspell/dict-dart | 2.3.2 | indirect |
| npm | @cspell/dict-data-science | 2.0.16 | indirect |
| npm | @cspell/dict-django | 4.1.6 | indirect |
| npm | @cspell/dict-docker | 1.1.17 | indirect |
| npm | @cspell/dict-dotnet | 5.0.13 | indirect |
| npm | @cspell/dict-elixir | 4.0.8 | indirect |
| npm | @cspell/dict-en-common-misspellings | 2.2.0 | indirect |
| npm | @cspell/dict-en-gb-mit | 3.1.26 | indirect |
| npm | @cspell/dict-en_us | 4.4.37 | indirect |
| npm | @cspell/dict-filetypes | 3.0.18 | indirect |
| npm | @cspell/dict-flutter | 1.1.1 | indirect |
| npm | @cspell/dict-fonts | 4.0.6 | indirect |
| npm | @cspell/dict-fsharp | 1.1.1 | indirect |
| npm | @cspell/dict-fullstack | 3.2.9 | indirect |
| npm | @cspell/dict-gaming-terms | 1.1.2 | indirect |
| npm | @cspell/dict-git | 3.1.0 | indirect |
| npm | @cspell/dict-golang | 6.0.27 | indirect |
| npm | @cspell/dict-google | 1.0.9 | indirect |
| npm | @cspell/dict-haskell | 4.0.6 | indirect |
| npm | @cspell/dict-html | 4.0.16 | indirect |
| npm | @cspell/dict-html-symbol-entities | 4.0.5 | indirect |
| npm | @cspell/dict-java | 5.0.12 | indirect |
| npm | @cspell/dict-julia | 1.1.1 | indirect |
| npm | @cspell/dict-k8s | 1.0.13 | indirect |
| npm | @cspell/dict-kotlin | 1.1.1 | indirect |
| npm | @cspell/dict-latex | 5.1.0 | indirect |
| npm | @cspell/dict-lorem-ipsum | 4.0.5 | indirect |
| npm | @cspell/dict-lua | 4.0.8 | indirect |
| npm | @cspell/dict-makefile | 1.0.5 | indirect |
| npm | @cspell/dict-markdown | 2.0.18 | indirect |
| npm | @cspell/dict-monkeyc | 1.1.0 | indirect |
| npm | @cspell/dict-node | 5.0.9 | indirect |
| npm | @cspell/dict-npm | 5.2.47 | indirect |
| npm | @cspell/dict-php | 4.1.1 | indirect |
| npm | @cspell/dict-powershell | 5.0.15 | indirect |
| npm | @cspell/dict-public-licenses | 2.0.16 | indirect |
| npm | @cspell/dict-python | 4.4.1 | indirect |
| npm | @cspell/dict-r | 2.1.1 | indirect |
| npm | @cspell/dict-ruby | 5.1.2 | indirect |
| npm | @cspell/dict-rust | 4.1.2 | indirect |
| npm | @cspell/dict-scala | 5.0.9 | indirect |
| npm | @cspell/dict-shell | 1.2.0 | indirect |
| npm | @cspell/dict-software-terms | 5.4.1 | indirect |
| npm | @cspell/dict-sql | 2.2.1 | indirect |
| npm | @cspell/dict-svelte | 1.0.7 | indirect |
| npm | @cspell/dict-swift | 2.0.6 | indirect |
| npm | @cspell/dict-terraform | 1.1.4 | indirect |
| npm | @cspell/dict-typescript | 3.2.3 | indirect |
| npm | @cspell/dict-vue | 3.0.5 | indirect |
| npm | @cspell/dict-zig | 1.0.0 | indirect |
| npm | @cspell/dynamic-import | 10.1.1 | indirect |
| npm | @cspell/filetypes | 10.1.1 | indirect |
| npm | @cspell/rpc | 10.1.1 | indirect |
| npm | @cspell/strong-weak-map | 10.1.1 | indirect |
| npm | @cspell/url | 10.1.1 | indirect |
| npm | @csstools/color-helpers | 5.1.0 | indirect |
| npm | @csstools/css-calc | 2.1.4 | indirect |
| npm | @csstools/css-color-parser | 3.1.0 | indirect |
| npm | @csstools/css-parser-algorithms | 3.0.5 | indirect |
| npm | @csstools/css-tokenizer | 3.0.4 | indirect |
| npm | @ctrl/tinycolor | 4.2.0 | indirect |
| npm | @emmetio/abbreviation | 2.3.3 | indirect |
| npm | @emmetio/css-abbreviation | 2.1.8 | indirect |
| npm | @emmetio/css-parser | 0.4.1 | indirect |
| npm | @emmetio/html-matcher | 1.3.0 | indirect |
| npm | @emmetio/scanner | 1.0.4 | indirect |
| npm | @emmetio/stream-reader | 2.2.0 | indirect |
| npm | @emmetio/stream-reader-utils | 0.1.0 | indirect |
| npm | @emnapi/core | 1.11.0 | indirect |
| npm | @emnapi/core | 1.11.1 | indirect |
| npm | @emnapi/core | 1.9.2 | indirect |
| npm | @emnapi/runtime | 1.11.0 | indirect |
| npm | @emnapi/runtime | 1.11.1 | indirect |
| npm | @emnapi/runtime | 1.11.3 | indirect |
| npm | @emnapi/runtime | 1.9.2 | indirect |
| npm | @emnapi/wasi-threads | 1.2.1 | indirect |
| npm | @emnapi/wasi-threads | 1.2.2 | indirect |
| npm | @emotion/hash | 0.9.2 | indirect |
| npm | @epic-web/invariant | 1.0.0 | indirect |
| npm | @esbuild/aix-ppc64 | 0.28.2 | indirect |
| npm | @esbuild/android-arm | 0.28.2 | indirect |
| npm | @esbuild/android-arm64 | 0.28.2 | indirect |
| npm | @esbuild/android-x64 | 0.28.2 | indirect |
| npm | @esbuild/darwin-arm64 | 0.28.2 | indirect |
| npm | @esbuild/darwin-x64 | 0.28.2 | indirect |
| npm | @esbuild/freebsd-arm64 | 0.28.2 | indirect |
| npm | @esbuild/freebsd-x64 | 0.28.2 | indirect |
| npm | @esbuild/linux-arm | 0.28.2 | indirect |
| npm | @esbuild/linux-arm64 | 0.28.2 | indirect |
| npm | @esbuild/linux-ia32 | 0.28.2 | indirect |
| npm | @esbuild/linux-loong64 | 0.28.2 | indirect |
| npm | @esbuild/linux-mips64el | 0.28.2 | indirect |
| npm | @esbuild/linux-ppc64 | 0.28.2 | indirect |
| npm | @esbuild/linux-riscv64 | 0.28.2 | indirect |
| npm | @esbuild/linux-s390x | 0.28.2 | indirect |
| npm | @esbuild/linux-x64 | 0.28.2 | indirect |
| npm | @esbuild/netbsd-arm64 | 0.28.2 | indirect |
| npm | @esbuild/netbsd-x64 | 0.28.2 | indirect |
| npm | @esbuild/openbsd-arm64 | 0.28.2 | indirect |
| npm | @esbuild/openbsd-x64 | 0.28.2 | indirect |
| npm | @esbuild/openharmony-arm64 | 0.28.2 | indirect |
| npm | @esbuild/sunos-x64 | 0.28.2 | indirect |
| npm | @esbuild/win32-arm64 | 0.28.2 | indirect |
| npm | @esbuild/win32-ia32 | 0.28.2 | indirect |
| npm | @esbuild/win32-x64 | 0.28.2 | indirect |
| npm | @esfx/async-canceltoken | 1.0.0 | indirect |
| npm | @esfx/cancelable | 1.0.0 | indirect |
| npm | @esfx/canceltoken | 1.0.0 | indirect |
| npm | @esfx/disposable | 1.0.0 | indirect |
| npm | @expressive-code/core | 0.44.1 | indirect |
| npm | @expressive-code/plugin-frames | 0.44.1 | indirect |
| npm | @expressive-code/plugin-shiki | 0.44.1 | indirect |
| npm | @expressive-code/plugin-text-markers | 0.44.1 | indirect |
| npm | @floating-ui/core | 1.8.0 | indirect |
| npm | @floating-ui/devtools | 0.2.3 | indirect |
| npm | @floating-ui/dom | 1.8.0 | indirect |
| npm | @floating-ui/utils | 0.2.12 | indirect |
| npm | @fluentui/keyboard-keys | 9.0.9 | indirect |
| npm | @fluentui/priority-overflow | 9.4.3 | indirect |
| npm | @fluentui/react-accordion | 9.12.3 | indirect |
| npm | @fluentui/react-alert | 9.0.0-beta.142 | indirect |
| npm | @fluentui/react-aria | 9.17.14 | indirect |
| npm | @fluentui/react-avatar | 9.11.6 | indirect |
| npm | @fluentui/react-badge | 9.5.5 | indirect |
| npm | @fluentui/react-breadcrumb | 9.4.5 | indirect |
| npm | @fluentui/react-button | 9.11.0 | indirect |
| npm | @fluentui/react-card | 9.7.2 | indirect |
| npm | @fluentui/react-carousel | 9.9.12 | indirect |
| npm | @fluentui/react-checkbox | 9.6.4 | indirect |
| npm | @fluentui/react-color-picker | 9.3.0 | indirect |
| npm | @fluentui/react-combobox | 9.17.5 | indirect |
| npm | @fluentui/react-context-selector | 9.2.19 | indirect |
| npm | @fluentui/react-dialog | 9.18.4 | indirect |
| npm | @fluentui/react-divider | 9.7.4 | indirect |
| npm | @fluentui/react-drawer | 9.13.3 | indirect |
| npm | @fluentui/react-field | 9.5.4 | indirect |
| npm | @fluentui/react-image | 9.4.4 | indirect |
| npm | @fluentui/react-infobutton | 9.0.0-beta.117 | indirect |
| npm | @fluentui/react-infolabel | 9.4.25 | indirect |
| npm | @fluentui/react-input | 9.8.6 | indirect |
| npm | @fluentui/react-jsx-runtime | 9.4.5 | indirect |
| npm | @fluentui/react-label | 9.4.4 | indirect |
| npm | @fluentui/react-link | 9.8.4 | indirect |
| npm | @fluentui/react-list | 9.6.16 | indirect |
| npm | @fluentui/react-menu | 9.25.4 | indirect |
| npm | @fluentui/react-message-bar | 9.7.6 | indirect |
| npm | @fluentui/react-motion | 9.16.3 | indirect |
| npm | @fluentui/react-motion-components-preview | 0.15.8 | indirect |
| npm | @fluentui/react-nav | 9.4.5 | indirect |
| npm | @fluentui/react-overflow | 9.9.3 | indirect |
| npm | @fluentui/react-persona | 9.7.8 | indirect |
| npm | @fluentui/react-popover | 9.14.7 | indirect |
| npm | @fluentui/react-portal | 9.8.15 | indirect |
| npm | @fluentui/react-positioning | 9.23.1 | indirect |
| npm | @fluentui/react-progress | 9.5.5 | indirect |
| npm | @fluentui/react-provider | 9.22.20 | indirect |
| npm | @fluentui/react-radio | 9.6.5 | indirect |
| npm | @fluentui/react-rating | 9.4.5 | indirect |
| npm | @fluentui/react-search | 9.4.6 | indirect |
| npm | @fluentui/react-select | 9.5.5 | indirect |
| npm | @fluentui/react-shared-contexts | 9.26.3 | indirect |
| npm | @fluentui/react-skeleton | 9.7.5 | indirect |
| npm | @fluentui/react-slider | 9.6.5 | indirect |
| npm | @fluentui/react-spinbutton | 9.6.5 | indirect |
| npm | @fluentui/react-spinner | 9.8.5 | indirect |
| npm | @fluentui/react-swatch-picker | 9.6.1 | indirect |
| npm | @fluentui/react-switch | 9.7.5 | indirect |
| npm | @fluentui/react-table | 9.19.20 | indirect |
| npm | @fluentui/react-tabs | 9.12.4 | indirect |
| npm | @fluentui/react-tabster | 9.26.17 | indirect |
| npm | @fluentui/react-tag-picker | 9.10.3 | indirect |
| npm | @fluentui/react-tags | 9.9.5 | indirect |
| npm | @fluentui/react-teaching-popover | 9.7.5 | indirect |
| npm | @fluentui/react-text | 9.6.19 | indirect |
| npm | @fluentui/react-textarea | 9.7.6 | indirect |
| npm | @fluentui/react-theme | 9.2.2 | indirect |
| npm | @fluentui/react-toast | 9.8.3 | indirect |
| npm | @fluentui/react-toolbar | 9.8.4 | indirect |
| npm | @fluentui/react-tooltip | 9.10.5 | indirect |
| npm | @fluentui/react-tree | 9.16.6 | indirect |
| npm | @fluentui/react-utilities | 9.26.6 | indirect |
| npm | @fluentui/react-virtualizer | 9.0.0-alpha.114 | indirect |
| npm | @fluentui/tokens | 1.0.0-alpha.24 | indirect |
| npm | @gerrit0/mini-shiki | 3.23.0 | indirect |
| npm | @griffel/core | 1.21.3 | indirect |
| npm | @griffel/react | 1.7.7 | indirect |
| npm | @griffel/style-types | 1.4.2 | indirect |
| npm | @img/colour | 1.1.0 | indirect |
| npm | @img/sharp-darwin-arm64 | 0.35.4 | indirect |
| npm | @img/sharp-darwin-x64 | 0.35.4 | indirect |
| npm | @img/sharp-freebsd-wasm32 | 0.35.4 | indirect |
| npm | @img/sharp-libvips-darwin-arm64 | 1.3.3 | indirect |
| npm | @img/sharp-libvips-darwin-x64 | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linux-arm | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linux-arm64 | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linux-ppc64 | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linux-riscv64 | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linux-s390x | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linux-x64 | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linuxmusl-arm64 | 1.3.3 | indirect |
| npm | @img/sharp-libvips-linuxmusl-x64 | 1.3.3 | indirect |
| npm | @img/sharp-linux-arm | 0.35.4 | indirect |
| npm | @img/sharp-linux-arm64 | 0.35.4 | indirect |
| npm | @img/sharp-linux-ppc64 | 0.35.4 | indirect |
| npm | @img/sharp-linux-riscv64 | 0.35.4 | indirect |
| npm | @img/sharp-linux-s390x | 0.35.4 | indirect |
| npm | @img/sharp-linux-x64 | 0.35.4 | indirect |
| npm | @img/sharp-linuxmusl-arm64 | 0.35.4 | indirect |
| npm | @img/sharp-linuxmusl-x64 | 0.35.4 | indirect |
| npm | @img/sharp-wasm32 | 0.35.4 | indirect |
| npm | @img/sharp-webcontainers-wasm32 | 0.35.4 | indirect |
| npm | @img/sharp-win32-arm64 | 0.35.4 | indirect |
| npm | @img/sharp-win32-ia32 | 0.35.4 | indirect |
| npm | @img/sharp-win32-x64 | 0.35.4 | indirect |
| npm | @inquirer/ansi | 2.0.7 | indirect |
| npm | @inquirer/checkbox | 5.2.3 | indirect |
| npm | @inquirer/confirm | 6.3.0 | indirect |
| npm | @inquirer/core | 12.0.1 | indirect |
| npm | @inquirer/editor | 5.3.1 | indirect |
| npm | @inquirer/expand | 5.1.3 | indirect |
| npm | @inquirer/external-editor | 3.0.4 | indirect |
| npm | @inquirer/figures | 2.0.8 | indirect |
| npm | @inquirer/input | 5.1.4 | indirect |
| npm | @inquirer/number | 4.2.1 | indirect |
| npm | @inquirer/password | 5.2.0 | indirect |
| npm | @inquirer/prompts | 8.7.0 | indirect |
| npm | @inquirer/rawlist | 5.3.3 | indirect |
| npm | @inquirer/search | 4.3.1 | indirect |
| npm | @inquirer/select | 5.2.3 | indirect |
| npm | @inquirer/type | 4.1.0 | indirect |
| npm | @isaacs/fs-minipass | 4.0.1 | indirect |
| npm | @istanbuljs/schema | 0.1.6 | indirect |
| npm | @joshwooding/vite-plugin-react-docgen-typescript | 0.7.0 | indirect |
| npm | @jridgewell/gen-mapping | 0.3.13 | indirect |
| npm | @jridgewell/remapping | 2.3.5 | indirect |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirect |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirect |
| npm | @jridgewell/trace-mapping | 0.3.31 | indirect |
| npm | @jspm/core | 2.1.0 | indirect |
| npm | @koa/cors | 5.0.0 | indirect |
| npm | @koa/router | 15.7.0 | indirect |
| npm | @kurkle/color | 0.3.4 | indirect |
| npm | @kwsites/file-exists | 1.1.1 | indirect |
| npm | @kwsites/promise-deferred | 1.1.1 | indirect |
| npm | @mdx-js/mdx | 3.1.1 | indirect |
| npm | @microsoft/1ds-core-js | 4.4.3 | indirect |
| npm | @microsoft/1ds-post-js | 4.4.3 | indirect |
| npm | @microsoft/api-extractor | 7.58.13 | indirect |
| npm | @microsoft/api-extractor | catalog: | indirect |
| npm | @microsoft/api-extractor-model | 7.33.11 | indirect |
| npm | @microsoft/applicationinsights-channel-js | 3.4.3 | indirect |
| npm | @microsoft/applicationinsights-common | 3.4.3 | indirect |
| npm | @microsoft/applicationinsights-core-js | 3.4.3 | indirect |
| npm | @microsoft/applicationinsights-shims | 3.0.1 | indirect |
| npm | @microsoft/applicationinsights-web-basic | 3.4.3 | indirect |
| npm | @microsoft/dynamicproto-js | 2.0.5 | indirect |
| npm | @microsoft/tsdoc | 0.16.0 | indirect |
| npm | @microsoft/tsdoc-config | 0.18.1 | indirect |
| npm | @napi-rs/wasm-runtime | 1.2.3 | indirect |
| npm | @nevware21/ts-async | 0.5.5 | indirect |
| npm | @nevware21/ts-utils | 0.16.0 | indirect |
| npm | @nodable/entities | 3.0.0 | indirect |
| npm | @nodelib/fs.scandir | 2.1.5 | indirect |
| npm | @nodelib/fs.stat | 2.0.5 | indirect |
| npm | @nodelib/fs.walk | 1.2.8 | indirect |
| npm | @octokit/app | 16.1.4 | indirect |
| npm | @octokit/auth-app | 8.3.0 | indirect |
| npm | @octokit/auth-oauth-app | 9.0.4 | indirect |
| npm | @octokit/auth-oauth-device | 8.0.4 | indirect |
| npm | @octokit/auth-oauth-user | 6.0.3 | indirect |
| npm | @octokit/auth-token | 6.0.0 | indirect |
| npm | @octokit/auth-unauthenticated | 7.0.4 | indirect |
| npm | @octokit/core | 7.0.7 | indirect |
| npm | @octokit/endpoint | 11.0.4 | indirect |
| npm | @octokit/graphql | 9.0.4 | indirect |
| npm | @octokit/oauth-app | 8.0.4 | indirect |
| npm | @octokit/oauth-authorization-url | 8.0.0 | indirect |
| npm | @octokit/oauth-methods | 6.0.4 | indirect |
| npm | @octokit/openapi-types | 27.0.0 | indirect |
| npm | @octokit/openapi-types | 28.0.0 | indirect |
| npm | @octokit/openapi-webhooks-types | 12.1.0 | indirect |
| npm | @octokit/plugin-paginate-graphql | 6.0.0 | indirect |
| npm | @octokit/plugin-paginate-rest | 14.0.0 | indirect |
| npm | @octokit/plugin-paginate-rest | 15.0.0 | indirect |
| npm | @octokit/plugin-request-log | 6.0.0 | indirect |
| npm | @octokit/plugin-rest-endpoint-methods | 17.0.0 | indirect |
| npm | @octokit/plugin-rest-endpoint-methods | 18.0.0 | indirect |
| npm | @octokit/plugin-retry | 8.1.1 | indirect |
| npm | @octokit/plugin-throttling | 11.0.5 | indirect |
| npm | @octokit/request | 10.0.15 | indirect |
| npm | @octokit/request-error | 7.1.1 | indirect |
| npm | @octokit/rest | 22.0.1 | indirect |
| npm | @octokit/types | 16.0.0 | indirect |
| npm | @octokit/types | 17.0.0 | indirect |
| npm | @octokit/webhooks | 14.2.0 | indirect |
| npm | @octokit/webhooks-methods | 6.0.0 | indirect |
| npm | @oslojs/encoding | 1.1.0 | indirect |
| npm | @oxc-parser/binding-android-arm-eabi | 0.127.0 | indirect |
| npm | @oxc-parser/binding-android-arm64 | 0.127.0 | indirect |
| npm | @oxc-parser/binding-darwin-arm64 | 0.127.0 | indirect |
| npm | @oxc-parser/binding-darwin-x64 | 0.127.0 | indirect |
| npm | @oxc-parser/binding-freebsd-x64 | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-arm-gnueabihf | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-arm-musleabihf | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-arm64-gnu | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-arm64-musl | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-ppc64-gnu | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-riscv64-gnu | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-riscv64-musl | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-s390x-gnu | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-x64-gnu | 0.127.0 | indirect |
| npm | @oxc-parser/binding-linux-x64-musl | 0.127.0 | indirect |
| npm | @oxc-parser/binding-openharmony-arm64 | 0.127.0 | indirect |
| npm | @oxc-parser/binding-wasm32-wasi | 0.127.0 | indirect |
| npm | @oxc-parser/binding-win32-arm64-msvc | 0.127.0 | indirect |
| npm | @oxc-parser/binding-win32-ia32-msvc | 0.127.0 | indirect |
| npm | @oxc-parser/binding-win32-x64-msvc | 0.127.0 | indirect |
| npm | @oxc-project/types | 0.127.0 | indirect |
| npm | @oxc-project/types | 0.147.0 | indirect |
| npm | @oxc-resolver/binding-android-arm-eabi | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-android-arm64 | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-darwin-arm64 | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-darwin-x64 | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-freebsd-x64 | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-arm-gnueabihf | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-arm-musleabihf | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-arm64-gnu | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-arm64-musl | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-ppc64-gnu | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-riscv64-gnu | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-riscv64-musl | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-s390x-gnu | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-x64-gnu | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-linux-x64-musl | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-openharmony-arm64 | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-wasm32-wasi | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-win32-arm64-msvc | 11.21.2 | indirect |
| npm | @oxc-resolver/binding-win32-x64-msvc | 11.21.2 | indirect |
| npm | @oxlint-tsgolint/darwin-arm64 | 7.0.2001 | indirect |
| npm | @oxlint-tsgolint/darwin-x64 | 7.0.2001 | indirect |
| npm | @oxlint-tsgolint/linux-arm64 | 7.0.2001 | indirect |
| npm | @oxlint-tsgolint/linux-x64 | 7.0.2001 | indirect |
| npm | @oxlint-tsgolint/win32-arm64 | 7.0.2001 | indirect |
| npm | @oxlint-tsgolint/win32-x64 | 7.0.2001 | indirect |
| npm | @oxlint/binding-android-arm-eabi | 1.80.0 | indirect |
| npm | @oxlint/binding-android-arm64 | 1.80.0 | indirect |
| npm | @oxlint/binding-darwin-arm64 | 1.80.0 | indirect |
| npm | @oxlint/binding-darwin-x64 | 1.80.0 | indirect |
| npm | @oxlint/binding-freebsd-x64 | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-arm-gnueabihf | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-arm-musleabihf | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-arm64-gnu | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-arm64-musl | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-ppc64-gnu | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-riscv64-gnu | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-riscv64-musl | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-s390x-gnu | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-x64-gnu | 1.80.0 | indirect |
| npm | @oxlint/binding-linux-x64-musl | 1.80.0 | indirect |
| npm | @oxlint/binding-openharmony-arm64 | 1.80.0 | indirect |
| npm | @oxlint/binding-win32-arm64-msvc | 1.80.0 | indirect |
| npm | @oxlint/binding-win32-ia32-msvc | 1.80.0 | indirect |
| npm | @oxlint/binding-win32-x64-msvc | 1.80.0 | indirect |
| npm | @pagefind/darwin-arm64 | 1.5.2 | indirect |
| npm | @pagefind/darwin-x64 | 1.5.2 | indirect |
| npm | @pagefind/default-ui | 1.5.2 | indirect |
| npm | @pagefind/freebsd-x64 | 1.5.2 | indirect |
| npm | @pagefind/linux-arm64 | 1.5.2 | indirect |
| npm | @pagefind/linux-x64 | 1.5.2 | indirect |
| npm | @pagefind/windows-arm64 | 1.5.2 | indirect |
| npm | @pagefind/windows-x64 | 1.5.2 | indirect |
| npm | @pinterest/alloy-graphql | 1.1.1 | indirect |
| npm | @playwright/browser-chromium | 1.62.1 | indirect |
| npm | @playwright/test | 1.62.1 | indirect |
| npm | @playwright/test | catalog: | indirect |
| npm | @polka/url | 1.0.0-next.29 | indirect |
| npm | @reteps/dockerfmt | 0.5.4 | indirect |
| npm | @reteps/dockerfmt-darwin-arm64 | 0.5.4 | indirect |
| npm | @reteps/dockerfmt-darwin-x64 | 0.5.4 | indirect |
| npm | @reteps/dockerfmt-linux-arm64 | 0.5.4 | indirect |
| npm | @reteps/dockerfmt-linux-x64 | 0.5.4 | indirect |
| npm | @rolldown/binding-android-arm-eabi | 1.2.6 | indirect |
| npm | @rolldown/binding-android-arm64 | 1.2.6 | indirect |
| npm | @rolldown/binding-darwin-arm64 | 1.2.6 | indirect |
| npm | @rolldown/binding-darwin-x64 | 1.2.6 | indirect |
| npm | @rolldown/binding-freebsd-x64 | 1.2.6 | indirect |
| npm | @rolldown/binding-linux-arm-gnueabihf | 1.2.6 | indirect |
| npm | @rolldown/binding-linux-arm64-gnu | 1.2.6 | indirect |
| npm | @rolldown/binding-linux-arm64-musl | 1.2.6 | indirect |
| npm | @rolldown/binding-linux-ppc64-gnu | 1.2.6 | indirect |
| npm | @rolldown/binding-linux-s390x-gnu | 1.2.6 | indirect |
| npm | @rolldown/binding-linux-x64-gnu | 1.2.6 | indirect |
| npm | @rolldown/binding-linux-x64-musl | 1.2.6 | indirect |
| npm | @rolldown/binding-openharmony-arm64 | 1.2.6 | indirect |
| npm | @rolldown/binding-win32-arm64-msvc | 1.2.6 | indirect |
| npm | @rolldown/binding-win32-x64-msvc | 1.2.6 | indirect |
| npm | @rolldown/pluginutils | 1.0.0-rc.3 | indirect |
| npm | @rolldown/pluginutils | 1.0.1 | indirect |
| npm | @rollup/plugin-babel | 7.1.0 | indirect |
| npm | @rollup/pluginutils | 5.4.0 | indirect |
| npm | @rushstack/node-core-library | 5.24.0 | indirect |
| npm | @rushstack/problem-matcher | 0.2.1 | indirect |
| npm | @rushstack/rig-package | 0.7.3 | indirect |
| npm | @rushstack/terminal | 0.24.3 | indirect |
| npm | @rushstack/ts-command-line | 5.3.13 | indirect |
| npm | @scalar/helpers | 0.11.1 | indirect |
| npm | @scalar/json-magic | 0.13.2 | indirect |
| npm | @scalar/openapi-parser | 0.28.16 | indirect |
| npm | @scalar/openapi-types | 0.9.5 | indirect |
| npm | @scalar/openapi-upgrader | 0.2.15 | indirect |
| npm | @scarf/scarf | 1.4.0 | indirect |
| npm | @sec-ant/readable-stream | 0.4.1 | indirect |
| npm | @secretlint/config-creator | 10.2.2 | indirect |
| npm | @secretlint/config-loader | 10.2.2 | indirect |
| npm | @secretlint/core | 10.2.2 | indirect |
| npm | @secretlint/formatter | 10.2.2 | indirect |
| npm | @secretlint/node | 10.2.2 | indirect |
| npm | @secretlint/profiler | 10.2.2 | indirect |
| npm | @secretlint/resolver | 10.2.2 | indirect |
| npm | @secretlint/secretlint-formatter-sarif | 10.2.2 | indirect |
| npm | @secretlint/secretlint-rule-no-dotenv | 10.2.2 | indirect |
| npm | @secretlint/secretlint-rule-preset-recommend | 10.2.2 | indirect |
| npm | @secretlint/source-creator | 10.2.2 | indirect |
| npm | @secretlint/types | 10.2.2 | indirect |
| npm | @shikijs/core | 4.4.3 | indirect |
| npm | @shikijs/engine-javascript | 4.4.3 | indirect |
| npm | @shikijs/engine-oniguruma | 3.23.0 | indirect |
| npm | @shikijs/engine-oniguruma | 4.4.3 | indirect |
| npm | @shikijs/langs | 3.23.0 | indirect |
| npm | @shikijs/langs | 4.4.3 | indirect |
| npm | @shikijs/primitive | 4.4.3 | indirect |
| npm | @shikijs/themes | 3.23.0 | indirect |
| npm | @shikijs/themes | 4.4.3 | indirect |
| npm | @shikijs/types | 3.23.0 | indirect |
| npm | @shikijs/types | 4.4.3 | indirect |
| npm | @shikijs/vscode-textmate | 10.0.2 | indirect |
| npm | @simple-git/args-pathspec | 1.0.3 | indirect |
| npm | @simple-git/argv-parser | 1.1.1 | indirect |
| npm | @sindresorhus/merge-streams | 2.3.0 | indirect |
| npm | @sindresorhus/merge-streams | 4.0.0 | indirect |
| npm | @standard-schema/spec | 1.1.0 | indirect |
| npm | @storybook/builder-vite | 10.5.10 | indirect |
| npm | @storybook/csf-plugin | 10.5.10 | indirect |
| npm | @storybook/global | 5.0.0 | indirect |
| npm | @storybook/icons | 2.1.0 | indirect |
| npm | @storybook/react | 10.5.10 | indirect |
| npm | @storybook/react-dom-shim | 10.5.10 | indirect |
| npm | @storybook/react-vite | 10.5.10 | indirect |
| npm | @swc/helpers | 0.5.23 | indirect |
| npm | @testing-library/dom | 10.4.1 | indirect |
| npm | @testing-library/jest-dom | 6.9.1 | indirect |
| npm | @testing-library/jest-dom | 7.0.1 | indirect |
| npm | @testing-library/react | 16.3.2 | indirect |
| npm | @testing-library/user-event | 14.6.6 | indirect |
| npm | @textlint/ast-node-types | 15.8.0 | indirect |
| npm | @textlint/linter-formatter | 15.8.0 | indirect |
| npm | @textlint/module-interop | 15.8.0 | indirect |
| npm | @textlint/resolver | 15.8.0 | indirect |
| npm | @textlint/types | 15.8.0 | indirect |
| npm | @ts-morph/common | 0.29.0 | indirect |
| npm | @turbo/darwin-64 | 2.10.12 | indirect |
| npm | @turbo/darwin-arm64 | 2.10.12 | indirect |
| npm | @turbo/linux-64 | 2.10.12 | indirect |
| npm | @turbo/linux-arm64 | 2.10.12 | indirect |
| npm | @turbo/windows-64 | 2.10.12 | indirect |
| npm | @turbo/windows-arm64 | 2.10.12 | indirect |
| npm | @tybys/wasm-util | 0.10.3 | indirect |
| npm | @types/argparse | 1.0.38 | indirect |
| npm | @types/aria-query | 5.0.4 | indirect |
| npm | @types/aws-lambda | 8.10.162 | indirect |
| npm | @types/babel__code-frame | 7.27.0 | indirect |
| npm | @types/babel__core | 7.20.5 | indirect |
| npm | @types/babel__generator | 7.27.0 | indirect |
| npm | @types/babel__template | 7.4.4 | indirect |
| npm | @types/babel__traverse | 7.28.0 | indirect |
| npm | @types/body-parser | 1.19.6 | indirect |
| npm | @types/braces | 3.0.5 | indirect |
| npm | @types/chai | 5.2.3 | indirect |
| npm | @types/connect | 3.4.38 | indirect |
| npm | @types/cross-spawn | 6.0.6 | indirect |
| npm | @types/debounce | 1.2.4 | indirect |
| npm | @types/debug | 4.1.13 | indirect |
| npm | @types/deep-eql | 4.0.2 | indirect |
| npm | @types/doctrine | 0.0.9 | indirect |
| npm | @types/estree | 1.0.9 | indirect |
| npm | @types/estree-jsx | 1.0.5 | indirect |
| npm | @types/express | 5.0.6 | indirect |
| npm | @types/express-serve-static-core | 5.1.3 | indirect |
| npm | @types/hast | 3.0.5 | indirect |
| npm | @types/hast | catalog: | indirect |
| npm | @types/http-errors | 2.0.5 | indirect |
| npm | @types/istanbul-lib-coverage | 2.0.6 | indirect |
| npm | @types/js-yaml | 4.0.9 | indirect |
| npm | @types/js-yaml | ^4.0.9 | indirect |
| npm | @types/mdast | 4.0.4 | indirect |
| npm | @types/mdx | 2.0.14 | indirect |
| npm | @types/micromatch | 4.0.10 | indirect |
| npm | @types/morgan | 1.9.10 | indirect |
| npm | @types/ms | 2.1.0 | indirect |
| npm | @types/multer | 2.2.0 | indirect |
| npm | @types/mustache | 4.2.6 | indirect |
| npm | @types/nlcst | 2.0.3 | indirect |
| npm | @types/node | 24.13.3 | indirect |
| npm | @types/node | 26.4.0 | indirect |
| npm | @types/node | ^22.0.0 | indirect |
| npm | @types/node | catalog: | indirect |
| npm | @types/normalize-package-data | 2.4.4 | indirect |
| npm | @types/pluralize | 0.0.33 | indirect |
| npm | @types/pluralize | catalog: | indirect |
| npm | @types/qs | 6.15.1 | indirect |
| npm | @types/range-parser | 1.2.7 | indirect |
| npm | @types/react | 19.2.18 | indirect |
| npm | @types/react | catalog: | indirect |
| npm | @types/react-dom | 19.2.5 | indirect |
| npm | @types/react-dom | catalog: | indirect |
| npm | @types/remark-heading-id | 1.0.0 | indirect |
| npm | @types/remark-heading-id | catalog: | indirect |
| npm | @types/resolve | 1.20.6 | indirect |
| npm | @types/sarif | 2.1.7 | indirect |
| npm | @types/sax | 1.2.7 | indirect |
| npm | @types/semver | 7.8.0 | indirect |
| npm | @types/semver | catalog: | indirect |
| npm | @types/send | 1.2.1 | indirect |
| npm | @types/serve-static | 2.2.0 | indirect |
| npm | @types/swagger-ui | 5.32.0 | indirect |
| npm | @types/swagger-ui-dist | 3.30.6 | indirect |
| npm | @types/swagger-ui-express | 4.1.8 | indirect |
| npm | @types/trusted-types | 2.0.7 | indirect |
| npm | @types/unist | 2.0.11 | indirect |
| npm | @types/unist | 3.0.3 | indirect |
| npm | @types/vscode | 1.125.0 | indirect |
| npm | @types/whatwg-mimetype | 3.0.2 | indirect |
| npm | @types/which | 3.0.4 | indirect |
| npm | @types/ws | 8.18.1 | indirect |
| npm | @types/yargs | 17.0.35 | indirect |
| npm | @types/yargs | catalog: | indirect |
| npm | @types/yargs-parser | 21.0.3 | indirect |
| npm | @typespec/ts-http-runtime | 0.3.8 | indirect |
| npm | @typespec/ts-http-runtime | catalog: | indirect |
| npm | @ungap/structured-clone | 1.4.0 | indirect |
| npm | @vitest/coverage-v8 | 4.1.11 | indirect |
| npm | @vitest/coverage-v8 | catalog: | indirect |
| npm | @vitest/expect | 3.2.4 | indirect |
| npm | @vitest/expect | 4.1.11 | indirect |
| npm | @vitest/mocker | 4.1.11 | indirect |
| npm | @vitest/pretty-format | 3.2.4 | indirect |
| npm | @vitest/pretty-format | 4.1.11 | indirect |
| npm | @vitest/runner | 4.1.11 | indirect |
| npm | @vitest/snapshot | 4.1.11 | indirect |
| npm | @vitest/spy | 3.2.4 | indirect |
| npm | @vitest/spy | 4.1.11 | indirect |
| npm | @vitest/ui | 4.1.11 | indirect |
| npm | @vitest/ui | catalog: | indirect |
| npm | @vitest/utils | 3.2.4 | indirect |
| npm | @vitest/utils | 4.1.11 | indirect |
| npm | @volar/kit | 2.4.28 | indirect |
| npm | @volar/language-core | 2.4.28 | indirect |
| npm | @volar/language-server | 2.4.28 | indirect |
| npm | @volar/language-service | 2.4.28 | indirect |
| npm | @volar/source-map | 2.4.28 | indirect |
| npm | @volar/typescript | 2.4.28 | indirect |
| npm | @vscode/emmet-helper | 2.11.0 | indirect |
| npm | @vscode/extension-telemetry | 1.5.2 | indirect |
| npm | @vscode/l10n | 0.0.18 | indirect |
| npm | @vscode/test-electron | 3.1.0 | indirect |
| npm | @vscode/test-web | 0.0.81 | indirect |
| npm | @vscode/vsce | 3.9.2 | indirect |
| npm | @vscode/vsce-sign | 2.1.0 | indirect |
| npm | @vscode/vsce-sign-alpine-arm64 | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-alpine-x64 | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-darwin-arm64 | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-darwin-x64 | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-linux-arm | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-linux-arm64 | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-linux-x64 | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-win32-arm64 | 2.0.6 | indirect |
| npm | @vscode/vsce-sign-win32-x64 | 2.0.6 | indirect |
| npm | @vue/reactivity | 3.5.42 | indirect |
| npm | @vue/shared | 3.5.42 | indirect |
| npm | @webcontainer/env | 1.1.1 | indirect |
| npm | @xmldom/xmldom | 0.9.12 | indirect |
| npm | abort-controller | 3.0.0 | indirect |
| npm | accepts | 1.3.8 | indirect |
| npm | accepts | 2.0.0 | indirect |
| npm | acorn | 8.18.0 | indirect |
| npm | acorn-jsx | 5.3.2 | indirect |
| npm | agent-base | 7.1.4 | indirect |
| npm | agent-base | 9.0.0 | indirect |
| npm | ajv | 8.18.0 | indirect |
| npm | ajv | 8.20.0 | indirect |
| npm | ajv-draft-04 | 1.0.0 | indirect |
| npm | ajv-formats | 3.0.1 | indirect |
| npm | ajv-i18n | 4.2.0 | indirect |
| npm | am-i-vibing | 0.4.0 | indirect |
| npm | ansi-escapes | 7.3.0 | indirect |
| npm | ansi-regex | 5.0.1 | indirect |
| npm | ansi-regex | 6.3.0 | indirect |
| npm | ansi-styles | 3.2.1 | indirect |
| npm | ansi-styles | 4.3.0 | indirect |
| npm | ansi-styles | 5.2.0 | indirect |
| npm | ansi-styles | 6.2.3 | indirect |
| npm | anymatch | 3.1.3 | indirect |
| npm | anynum | 1.0.1 | indirect |
| npm | append-field | 1.0.0 | indirect |
| npm | arg | 5.0.2 | indirect |
| npm | argparse | 1.0.10 | indirect |
| npm | argparse | 2.0.1 | indirect |
| npm | aria-query | 5.3.0 | indirect |
| npm | aria-query | 5.3.2 | indirect |
| npm | array-back | 3.1.0 | indirect |
| npm | array-back | 4.0.2 | indirect |
| npm | array-iterate | 2.0.1 | indirect |
| npm | array-timsort | 1.0.3 | indirect |
| npm | assertion-error | 2.0.1 | indirect |
| npm | ast-types | 0.16.1 | indirect |
| npm | ast-v8-to-istanbul | 1.0.5 | indirect |
| npm | astral-regex | 2.0.0 | indirect |
| npm | astring | 1.9.0 | indirect |
| npm | astro-expressive-code | 0.44.1 | indirect |
| npm | astro-expressive-code | catalog: | indirect |
| npm | astro-rehype-relative-markdown-links | 0.19.2 | indirect |
| npm | astro-rehype-relative-markdown-links | catalog: | indirect |
| npm | asynckit | 0.4.0 | indirect |
| npm | axobject-query | 4.1.0 | indirect |
| npm | azure-devops-node-api | 12.5.0 | indirect |
| npm | b4a | 1.8.1 | indirect |
| npm | bail | 2.0.2 | indirect |
| npm | balanced-match | 4.0.4 | indirect |
| npm | bare-events | 2.9.2 | indirect |
| npm | bare-fs | 4.8.1 | indirect |
| npm | bare-path | 3.1.1 | indirect |
| npm | bare-stream | 2.13.4 | indirect |
| npm | bare-url | 2.5.2 | indirect |
| npm | base64-js | 1.5.1 | indirect |
| npm | baseline-browser-mapping | 2.11.19 | indirect |
| npm | basic-auth | 2.0.1 | indirect |
| npm | bcp-47 | 2.1.1 | indirect |
| npm | bcp-47-match | 2.0.3 | indirect |
| npm | before-after-hook | 4.0.0 | indirect |
| npm | binaryextensions | 6.11.0 | indirect |
| npm | bl | 4.1.0 | indirect |
| npm | body-parser | 2.3.0 | indirect |
| npm | boolbase | 1.0.0 | indirect |
| npm | bottleneck | 2.19.5 | indirect |
| npm | boundary | 2.0.0 | indirect |
| npm | brace-expansion | 5.0.9 | indirect |
| npm | braces | 3.0.3 | indirect |
| npm | browserify-zlib | 0.1.4 | indirect |
| npm | browserslist | 4.28.8 | indirect |
| npm | buffer | 5.7.1 | indirect |
| npm | buffer | 6.0.3 | indirect |
| npm | buffer-crc32 | 0.2.13 | indirect |
| npm | buffer-equal-constant-time | 1.0.1 | indirect |
| npm | buffer-from | 1.1.2 | indirect |
| npm | buffer-image-size | 0.6.4 | indirect |
| npm | bundle-name | 4.1.0 | indirect |
| npm | busboy | 1.6.0 | indirect |
| npm | bytes | 3.1.2 | indirect |
| npm | c8 | 12.0.0 | indirect |
| npm | c8 | catalog: | indirect |
| npm | call-bind-apply-helpers | 1.0.2 | indirect |
| npm | call-bound | 1.0.4 | indirect |
| npm | caniuse-lite | 1.0.30001810 | indirect |
| npm | catch-unknown | 2.0.0 | indirect |
| npm | ccount | 2.0.1 | indirect |
| npm | chai | 5.3.3 | indirect |
| npm | chai | 6.2.2 | indirect |
| npm | chalk | 2.4.2 | indirect |
| npm | chalk | 4.1.2 | indirect |
| npm | chalk | 5.6.2 | indirect |
| npm | chalk | 6.0.0 | indirect |
| npm | chalk-template | 1.1.2 | indirect |
| npm | character-entities | 2.0.2 | indirect |
| npm | character-entities-html4 | 2.1.0 | indirect |
| npm | character-entities-legacy | 3.0.0 | indirect |
| npm | character-reference-invalid | 2.0.1 | indirect |
| npm | chardet | 2.2.0 | indirect |
| npm | check-error | 2.1.3 | indirect |
| npm | cheerio | 1.2.0 | indirect |
| npm | cheerio-select | 2.1.0 | indirect |
| npm | chokidar | 4.0.3 | indirect |
| npm | chokidar | 5.0.0 | indirect |
| npm | chownr | 1.1.4 | indirect |
| npm | chownr | 3.0.0 | indirect |
| npm | ci-info | 4.4.0 | indirect |
| npm | cli-cursor | 5.0.0 | indirect |
| npm | cli-spinners | 2.9.2 | indirect |
| npm | cli-spinners | 3.4.0 | indirect |
| npm | cli-table3 | 0.6.5 | indirect |
| npm | cli-width | 4.1.0 | indirect |
| npm | cliui | 9.0.1 | indirect |
| npm | clsx | 2.1.1 | indirect |
| npm | cockatiel | 3.2.1 | indirect |
| npm | code-block-writer | 13.0.3 | indirect |
| npm | collapse-white-space | 2.1.0 | indirect |
| npm | color-convert | 1.9.3 | indirect |
| npm | color-convert | 2.0.1 | indirect |
| npm | color-name | 1.1.3 | indirect |
| npm | color-name | 1.1.4 | indirect |
| npm | combined-stream | 1.0.8 | indirect |
| npm | comma-separated-tokens | 2.0.3 | indirect |
| npm | command-line-args | 5.2.1 | indirect |
| npm | command-line-usage | 6.1.3 | indirect |
| npm | commander | 11.1.0 | indirect |
| npm | commander | 12.1.0 | indirect |
| npm | commander | 15.0.0 | indirect |
| npm | comment-json | 5.0.0 | indirect |
| npm | common-ancestor-path | 2.0.0 | indirect |
| npm | compare-versions | 6.1.1 | indirect |
| npm | concat-stream | 2.0.0 | indirect |
| npm | concurrently | 10.0.5 | indirect |
| npm | concurrently | catalog: | indirect |
| npm | confbox | 0.1.8 | indirect |
| npm | confbox | 0.2.4 | indirect |
| npm | content-disposition | 1.0.1 | indirect |
| npm | content-disposition | 1.1.0 | indirect |
| npm | content-type | 1.0.5 | indirect |
| npm | content-type | 2.1.0 | indirect |
| npm | content-type | 3.0.0 | indirect |
| npm | convert-source-map | 2.0.0 | indirect |
| npm | cookie | 0.7.2 | indirect |
| npm | cookie | 2.0.1 | indirect |
| npm | cookie-es | 1.2.3 | indirect |
| npm | cookie-signature | 1.2.2 | indirect |
| npm | cookies | 0.9.1 | indirect |
| npm | core-util-is | 1.0.3 | indirect |
| npm | cross-env | 10.1.0 | indirect |
| npm | cross-env | catalog: | indirect |
| npm | cross-spawn | 7.0.6 | indirect |
| npm | crossws | 0.3.5 | indirect |
| npm | cspell | 10.1.1 | indirect |
| npm | cspell-config-lib | 10.1.1 | indirect |
| npm | cspell-dictionary | 10.1.1 | indirect |
| npm | cspell-gitignore | 10.1.1 | indirect |
| npm | cspell-glob | 10.1.1 | indirect |
| npm | cspell-grammar | 10.1.1 | indirect |
| npm | cspell-io | 10.1.1 | indirect |
| npm | cspell-lib | 10.1.1 | indirect |
| npm | cspell-trie-lib | 10.1.1 | indirect |
| npm | css-select | 5.2.2 | indirect |
| npm | css-select | 6.0.0 | indirect |
| npm | css-selector-parser | 3.3.0 | indirect |
| npm | css-tree | 2.2.1 | indirect |
| npm | css-tree | 3.2.1 | indirect |
| npm | css-what | 6.2.2 | indirect |
| npm | css-what | 7.0.0 | indirect |
| npm | css.escape | 1.5.1 | indirect |
| npm | cssesc | 3.0.0 | indirect |
| npm | csso | 5.0.5 | indirect |
| npm | cssstyle | 4.6.0 | indirect |
| npm | csstype | 3.2.3 | indirect |
| npm | data-urls | 5.0.0 | indirect |
| npm | debounce | 3.0.0 | indirect |
| npm | debug | 2.6.9 | indirect |
| npm | debug | 3.2.7 | indirect |
| npm | debug | 4.4.3 | indirect |
| npm | decimal.js | 10.6.0 | indirect |
| npm | decode-named-character-reference | 1.3.0 | indirect |
| npm | decompress-response | 6.0.0 | indirect |
| npm | dedent-js | 1.0.1 | indirect |
| npm | deep-eql | 5.0.2 | indirect |
| npm | deep-equal | 1.0.1 | indirect |
| npm | deep-extend | 0.6.0 | indirect |
| npm | default-browser | 5.5.1 | indirect |
| npm | default-browser-id | 5.0.1 | indirect |
| npm | define-lazy-prop | 3.0.0 | indirect |
| npm | defu | 6.1.7 | indirect |
| npm | delayed-stream | 1.0.0 | indirect |
| npm | delegates | 1.0.0 | indirect |
| npm | depd | 1.1.2 | indirect |
| npm | depd | 2.0.0 | indirect |
| npm | dequal | 2.0.3 | indirect |
| npm | destr | 2.0.5 | indirect |
| npm | destroy | 1.2.0 | indirect |
| npm | detect-libc | 2.1.2 | indirect |
| npm | devalue | 5.9.2 | indirect |
| npm | devlop | 1.1.0 | indirect |
| npm | diff | 9.0.0 | indirect |
| npm | direction | 2.0.1 | indirect |
| npm | doctrine | 3.0.0 | indirect |
| npm | dom-accessibility-api | 0.5.16 | indirect |
| npm | dom-accessibility-api | 0.6.3 | indirect |
| npm | dom-serializer | 2.0.0 | indirect |
| npm | domelementtype | 2.3.0 | indirect |
| npm | domhandler | 5.0.3 | indirect |
| npm | dompurify | 3.4.14 | indirect |
| npm | domutils | 3.2.2 | indirect |
| npm | dotenv | 17.4.2 | indirect |
| npm | dotenv | catalog: | indirect |
| npm | dset | 3.1.4 | indirect |
| npm | dunder-proto | 1.0.1 | indirect |
| npm | duplexify | 3.7.1 | indirect |
| npm | ecdsa-sig-formatter | 1.0.11 | indirect |
| npm | ecmarkdown | 8.1.0 | indirect |
| npm | ecmarkup | 23.0.2 | indirect |
| npm | editions | 6.22.0 | indirect |
| npm | ee-first | 1.1.1 | indirect |
| npm | electron-to-chromium | 1.5.415 | indirect |
| npm | embla-carousel | 8.6.0 | indirect |
| npm | embla-carousel-autoplay | 8.6.0 | indirect |
| npm | embla-carousel-fade | 8.6.0 | indirect |
| npm | emmet | 2.4.11 | indirect |
| npm | emoji-regex | 10.6.0 | indirect |
| npm | emoji-regex | 8.0.0 | indirect |
| npm | empathic | 2.0.1 | indirect |
| npm | encodeurl | 2.0.0 | indirect |
| npm | encoding-sniffer | 0.2.1 | indirect |
| npm | end-of-stream | 1.4.5 | indirect |
| npm | entities | 4.5.0 | indirect |
| npm | entities | 6.0.1 | indirect |
| npm | entities | 7.0.1 | indirect |
| npm | env-paths | 4.0.0 | indirect |
| npm | environment | 1.1.0 | indirect |
| npm | es-define-property | 1.0.1 | indirect |
| npm | es-errors | 1.3.0 | indirect |
| npm | es-module-lexer | 2.3.2 | indirect |
| npm | es-object-atoms | 1.1.2 | indirect |
| npm | es-set-tostringtag | 2.1.0 | indirect |
| npm | esast-util-from-estree | 2.0.0 | indirect |
| npm | esast-util-from-js | 2.0.1 | indirect |
| npm | esbuild | 0.28.2 | indirect |
| npm | esbuild-plugins-node-modules-polyfill | 1.8.3 | indirect |
| npm | escalade | 3.2.0 | indirect |
| npm | escape-html | 1.0.3 | indirect |
| npm | escape-string-regexp | 1.0.5 | indirect |
| npm | escape-string-regexp | 5.0.0 | indirect |
| npm | eslint-formatter-codeframe | 7.32.2 | indirect |
| npm | esprima | 4.0.1 | indirect |
| npm | estree-util-attach-comments | 3.0.0 | indirect |
| npm | estree-util-build-jsx | 3.0.1 | indirect |
| npm | estree-util-is-identifier-name | 3.0.0 | indirect |
| npm | estree-util-scope | 1.0.1 | indirect |
| npm | estree-util-to-js | 2.0.0 | indirect |
| npm | estree-util-visit | 2.0.0 | indirect |
| npm | estree-walker | 2.0.2 | indirect |
| npm | estree-walker | 3.0.3 | indirect |
| npm | esutils | 2.0.3 | indirect |
| npm | etag | 1.8.1 | indirect |
| npm | event-target-shim | 5.0.1 | indirect |
| npm | eventemitter3 | 5.0.4 | indirect |
| npm | events | 3.3.0 | indirect |
| npm | events-universal | 1.0.1 | indirect |
| npm | execa | 9.6.1 | indirect |
| npm | execa | catalog: | indirect |
| npm | expand-template | 2.0.3 | indirect |
| npm | expect-type | 1.4.0 | indirect |
| npm | express | 5.2.1 | indirect |
| npm | expressive-code | 0.44.1 | indirect |
| npm | exsolve | 1.1.1 | indirect |
| npm | extend | 3.0.2 | indirect |
| npm | extend-shallow | 2.0.1 | indirect |
| npm | fast-deep-equal | 3.1.3 | indirect |
| npm | fast-equals | 6.0.2 | indirect |
| npm | fast-fifo | 1.3.2 | indirect |
| npm | fast-glob | 3.3.3 | indirect |
| npm | fast-json-stable-stringify | 2.1.0 | indirect |
| npm | fast-string-truncated-width | 3.0.3 | indirect |
| npm | fast-string-width | 3.0.2 | indirect |
| npm | fast-uri | 3.1.6 | indirect |
| npm | fast-wrap-ansi | 0.2.2 | indirect |
| npm | fast-xml-builder | 1.3.1 | indirect |
| npm | fastq | 1.20.1 | indirect |
| npm | fdir | 6.5.0 | indirect |
| npm | fflate | 0.8.3 | indirect |
| npm | figures | 6.1.0 | indirect |
| npm | fill-range | 7.1.1 | indirect |
| npm | finalhandler | 2.1.1 | indirect |
| npm | find-proc | 0.1.0 | indirect |
| npm | find-replace | 3.0.0 | indirect |
| npm | find-up | 5.0.0 | indirect |
| npm | flatted | 3.4.4 | indirect |
| npm | flattie | 1.1.1 | indirect |
| npm | fontace | 0.4.1 | indirect |
| npm | fontkitten | 1.0.3 | indirect |
| npm | foreground-child | 3.3.1 | indirect |
| npm | form-data | 4.0.6 | indirect |
| npm | forwarded | 0.2.0 | indirect |
| npm | fresh | 0.5.2 | indirect |
| npm | fresh | 2.0.0 | indirect |
| npm | fs-constants | 1.0.0 | indirect |
| npm | fs-extra | 11.3.6 | indirect |
| npm | fs-extra | 11.4.0 | indirect |
| npm | fsevents | 2.3.2 | indirect |
| npm | fsevents | 2.3.3 | indirect |
| npm | function-bind | 1.1.2 | indirect |
| npm | gensequence | 8.0.8 | indirect |
| npm | gensync | 1.0.0-beta.2 | indirect |
| npm | get-caller-file | 2.0.5 | indirect |
| npm | get-east-asian-width | 1.6.0 | indirect |
| npm | get-intrinsic | 1.3.0 | indirect |
| npm | get-proto | 1.0.1 | indirect |
| npm | get-stream | 9.0.1 | indirect |
| npm | get-tsconfig | 5.0.0-beta.4 | indirect |
| npm | github-from-package | 0.0.0 | indirect |
| npm | github-slugger | 2.0.0 | indirect |
| npm | glob | 13.0.6 | indirect |
| npm | glob-parent | 5.1.2 | indirect |
| npm | global-directory | 5.0.0 | indirect |
| npm | globby | 14.1.0 | indirect |
| npm | globby | 16.2.4 | indirect |
| npm | gopd | 1.2.0 | indirect |
| npm | graceful-fs | 4.2.11 | indirect |
| npm | grammarkdown | 3.3.2 | indirect |
| npm | graphql | 17.0.2 | indirect |
| npm | gray-matter | 4.0.3 | indirect |
| npm | gunzip-maybe | 1.4.2 | indirect |
| npm | h3 | 1.15.11 | indirect |
| npm | happy-dom | 20.11.10 | indirect |
| npm | has-flag | 3.0.0 | indirect |
| npm | has-flag | 4.0.0 | indirect |
| npm | has-symbols | 1.1.0 | indirect |
| npm | has-tostringtag | 1.0.2 | indirect |
| npm | hasown | 2.0.4 | indirect |
| npm | hast-util-embedded | 3.0.0 | indirect |
| npm | hast-util-format | 1.1.0 | indirect |
| npm | hast-util-from-html | 2.0.3 | indirect |
| npm | hast-util-from-parse5 | 8.0.3 | indirect |
| npm | hast-util-has-property | 3.0.0 | indirect |
| npm | hast-util-is-body-ok-link | 3.0.1 | indirect |
| npm | hast-util-is-element | 3.0.0 | indirect |
| npm | hast-util-minify-whitespace | 1.0.1 | indirect |
| npm | hast-util-parse-selector | 4.0.0 | indirect |
| npm | hast-util-phrasing | 3.0.1 | indirect |
| npm | hast-util-raw | 9.1.0 | indirect |
| npm | hast-util-select | 6.0.4 | indirect |
| npm | hast-util-to-estree | 3.1.3 | indirect |
| npm | hast-util-to-html | 9.0.5 | indirect |
| npm | hast-util-to-html | catalog: | indirect |
| npm | hast-util-to-jsx-runtime | 2.3.6 | indirect |
| npm | hast-util-to-parse5 | 8.0.1 | indirect |
| npm | hast-util-to-string | 3.0.1 | indirect |
| npm | hast-util-to-text | 4.0.2 | indirect |
| npm | hast-util-whitespace | 3.0.0 | indirect |
| npm | hastscript | 9.0.1 | indirect |
| npm | highlight.js | 11.0.1 | indirect |
| npm | hosted-git-info | 4.1.0 | indirect |
| npm | hosted-git-info | 7.0.2 | indirect |
| npm | html-encoding-sniffer | 4.0.0 | indirect |
| npm | html-entities | 2.6.0 | indirect |
| npm | html-escape | 1.0.2 | indirect |
| npm | html-escaper | 2.0.2 | indirect |
| npm | html-escaper | 3.0.3 | indirect |
| npm | html-url-attributes | 3.0.1 | indirect |
| npm | html-void-elements | 3.0.0 | indirect |
| npm | html-whitespace-sensitive-tag-names | 3.0.1 | indirect |
| npm | htmlparser2 | 10.1.0 | indirect |
| npm | http-assert | 1.5.0 | indirect |
| npm | http-cache-semantics | 4.2.0 | indirect |
| npm | http-errors | 1.6.3 | indirect |
| npm | http-errors | 1.8.1 | indirect |
| npm | http-errors | 2.0.1 | indirect |
| npm | http-proxy-agent | 7.0.2 | indirect |
| npm | http-proxy-agent | 9.1.0 | indirect |
| npm | https-proxy-agent | 7.0.6 | indirect |
| npm | https-proxy-agent | 9.1.0 | indirect |
| npm | human-signals | 8.0.1 | indirect |
| npm | i18next | 26.4.0 | indirect |
| npm | iconv-lite | 0.6.3 | indirect |
| npm | iconv-lite | 0.7.3 | indirect |
| npm | ieee754 | 1.2.1 | indirect |
| npm | ignore | 7.0.6 | indirect |
| npm | immediate | 3.0.6 | indirect |
| npm | import-fresh | 4.0.0 | indirect |
| npm | import-lazy | 4.0.0 | indirect |
| npm | import-meta-resolve | 4.2.0 | indirect |
| npm | indent-string | 4.0.0 | indirect |
| npm | index-to-position | 1.2.0 | indirect |
| npm | inherits | 2.0.3 | indirect |
| npm | inherits | 2.0.4 | indirect |
| npm | ini | 1.3.8 | indirect |
| npm | ini | 6.0.0 | indirect |
| npm | inline-style-parser | 0.2.7 | indirect |
| npm | ipaddr.js | 1.9.1 | indirect |
| npm | iron-webcrypto | 1.2.1 | indirect |
| npm | is-absolute-url | 4.0.1 | indirect |
| npm | is-alphabetical | 2.0.1 | indirect |
| npm | is-alphanumerical | 2.0.1 | indirect |
| npm | is-core-module | 2.16.2 | indirect |
| npm | is-decimal | 2.0.1 | indirect |
| npm | is-deflate | 1.0.0 | indirect |
| npm | is-docker | 3.0.0 | indirect |
| npm | is-docker | 4.0.0 | indirect |
| npm | is-extendable | 0.1.1 | indirect |
| npm | is-extglob | 2.1.1 | indirect |
| npm | is-fullwidth-code-point | 3.0.0 | indirect |
| npm | is-glob | 4.0.3 | indirect |
| npm | is-gzip | 1.0.0 | indirect |
| npm | is-hexadecimal | 2.0.1 | indirect |
| npm | is-in-ssh | 1.0.0 | indirect |
| npm | is-inside-container | 1.0.0 | indirect |
| npm | is-interactive | 2.0.0 | indirect |
| npm | is-number | 7.0.0 | indirect |
| npm | is-path-inside | 4.0.0 | indirect |
| npm | is-plain-obj | 4.1.0 | indirect |
| npm | is-potential-custom-element-name | 1.0.1 | indirect |
| npm | is-promise | 4.0.0 | indirect |
| npm | is-safe-filename | 0.1.1 | indirect |
| npm | is-stream | 4.0.1 | indirect |
| npm | is-unicode-supported | 1.3.0 | indirect |
| npm | is-unicode-supported | 2.1.0 | indirect |
| npm | is-unsafe | 2.0.2 | indirect |
| npm | is-wsl | 3.1.1 | indirect |
| npm | isarray | 1.0.0 | indirect |
| npm | isexe | 2.0.0 | indirect |
| npm | isexe | 4.0.0 | indirect |
| npm | istanbul-lib-coverage | 3.2.2 | indirect |
| npm | istanbul-lib-report | 3.0.1 | indirect |
| npm | istanbul-reports | 3.2.0 | indirect |
| npm | istextorbinary | 9.5.0 | indirect |
| npm | jju | 1.4.0 | indirect |
| npm | js-tokens | 10.0.0 | indirect |
| npm | js-tokens | 4.0.0 | indirect |
| npm | jsdom | 25.0.1 | indirect |
| npm | jsesc | 3.1.0 | indirect |
| npm | json-schema-traverse | 1.0.0 | indirect |
| npm | json-with-bigint | 3.5.12 | indirect |
| npm | json5 | 2.2.3 | indirect |
| npm | jsonc-parser | 2.3.1 | indirect |
| npm | jsonc-parser | 3.3.1 | indirect |
| npm | jsonfile | 6.2.1 | indirect |
| npm | jsonpointer | 5.0.1 | indirect |
| npm | jsonwebtoken | 9.0.3 | indirect |
| npm | jszip | 3.10.1 | indirect |
| npm | jwa | 2.0.1 | indirect |
| npm | jws | 4.0.1 | indirect |
| npm | keyborg | 2.14.1 | indirect |
| npm | keygrip | 1.1.0 | indirect |
| npm | keytar | 7.9.0 | indirect |
| npm | kind-of | 6.0.3 | indirect |
| npm | kleur | 3.0.3 | indirect |
| npm | kleur | 4.1.5 | indirect |
| npm | klona | 2.0.6 | indirect |
| npm | koa | 3.2.1 | indirect |
| npm | koa-compose | 4.1.0 | indirect |
| npm | koa-morgan | 1.0.1 | indirect |
| npm | koa-mount | 4.2.0 | indirect |
| npm | koa-send | 5.0.1 | indirect |
| npm | koa-static | 5.0.0 | indirect |
| npm | kolorist | 1.8.0 | indirect |
| npm | leven | 3.1.0 | indirect |
| npm | leven | 4.1.0 | indirect |
| npm | lie | 3.3.0 | indirect |
| npm | lightningcss | 1.33.0 | indirect |
| npm | lightningcss-android-arm64 | 1.33.0 | indirect |
| npm | lightningcss-darwin-arm64 | 1.33.0 | indirect |
| npm | lightningcss-darwin-x64 | 1.33.0 | indirect |
| npm | lightningcss-freebsd-x64 | 1.33.0 | indirect |
| npm | lightningcss-linux-arm-gnueabihf | 1.33.0 | indirect |
| npm | lightningcss-linux-arm64-gnu | 1.33.0 | indirect |
| npm | lightningcss-linux-arm64-musl | 1.33.0 | indirect |
| npm | lightningcss-linux-x64-gnu | 1.33.0 | indirect |
| npm | lightningcss-linux-x64-musl | 1.33.0 | indirect |
| npm | lightningcss-win32-arm64-msvc | 1.33.0 | indirect |
| npm | lightningcss-win32-x64-msvc | 1.33.0 | indirect |
| npm | linkify-it | 5.0.2 | indirect |
| npm | local-pkg | 1.2.1 | indirect |
| npm | locate-path | 6.0.0 | indirect |
| npm | lodash | 4.18.1 | indirect |
| npm | lodash.camelcase | 4.3.0 | indirect |
| npm | lodash.includes | 4.3.0 | indirect |
| npm | lodash.isboolean | 3.0.3 | indirect |
| npm | lodash.isinteger | 4.0.4 | indirect |
| npm | lodash.isnumber | 3.0.3 | indirect |
| npm | lodash.isplainobject | 4.0.6 | indirect |
| npm | lodash.isstring | 4.0.1 | indirect |
| npm | lodash.once | 4.1.1 | indirect |
| npm | lodash.truncate | 4.4.2 | indirect |
| npm | log-symbols | 6.0.0 | indirect |
| npm | log-symbols | 7.0.1 | indirect |
| npm | longest-streak | 3.1.0 | indirect |
| npm | loupe | 3.2.1 | indirect |
| npm | lru-cache | 10.4.3 | indirect |
| npm | lru-cache | 11.5.2 | indirect |
| npm | lru-cache | 5.1.1 | indirect |
| npm | lru-cache | 6.0.0 | indirect |
| npm | lunr | 2.3.9 | indirect |
| npm | lz-string | 1.5.0 | indirect |
| npm | lzutf8 | 0.6.3 | indirect |
| npm | magic-string | 0.30.21 | indirect |
| npm | magic-string | 1.2.3 | indirect |
| npm | magicast | 0.5.4 | indirect |
| npm | make-dir | 4.0.0 | indirect |
| npm | markdown-extensions | 2.0.0 | indirect |
| npm | markdown-it | 14.3.0 | indirect |
| npm | markdown-table | 3.0.4 | indirect |
| npm | marked | 14.0.0 | indirect |
| npm | marked | 15.0.12 | indirect |
| npm | marked | 18.0.11 | indirect |
| npm | math-intrinsics | 1.1.0 | indirect |
| npm | mdast-util-definitions | 6.0.0 | indirect |
| npm | mdast-util-directive | 3.1.0 | indirect |
| npm | mdast-util-find-and-replace | 3.0.2 | indirect |
| npm | mdast-util-from-markdown | 2.0.3 | indirect |
| npm | mdast-util-gfm | 3.1.0 | indirect |
| npm | mdast-util-gfm-autolink-literal | 2.0.1 | indirect |
| npm | mdast-util-gfm-footnote | 2.1.0 | indirect |
| npm | mdast-util-gfm-strikethrough | 2.0.0 | indirect |
| npm | mdast-util-gfm-table | 2.0.0 | indirect |
| npm | mdast-util-gfm-task-list-item | 2.0.0 | indirect |
| npm | mdast-util-mdx | 3.0.0 | indirect |
| npm | mdast-util-mdx-expression | 2.0.1 | indirect |
| npm | mdast-util-mdx-jsx | 3.2.0 | indirect |
| npm | mdast-util-mdxjs-esm | 2.0.1 | indirect |
| npm | mdast-util-phrasing | 4.1.0 | indirect |
| npm | mdast-util-to-hast | 13.2.1 | indirect |
| npm | mdast-util-to-markdown | 2.1.2 | indirect |
| npm | mdast-util-to-string | 4.0.0 | indirect |
| npm | mdn-data | 2.0.28 | indirect |
| npm | mdn-data | 2.27.1 | indirect |
| npm | mdurl | 2.1.0 | indirect |
| npm | media-typer | 0.3.0 | indirect |
| npm | media-typer | 1.1.1 | indirect |
| npm | merge-descriptors | 2.0.0 | indirect |
| npm | merge2 | 1.4.1 | indirect |
| npm | micromark | 4.0.2 | indirect |
| npm | micromark-core-commonmark | 2.0.3 | indirect |
| npm | micromark-extension-directive | 4.0.0 | indirect |
| npm | micromark-extension-gfm | 3.0.0 | indirect |
| npm | micromark-extension-gfm-autolink-literal | 2.1.0 | indirect |
| npm | micromark-extension-gfm-footnote | 2.1.0 | indirect |
| npm | micromark-extension-gfm-strikethrough | 2.1.0 | indirect |
| npm | micromark-extension-gfm-table | 2.1.1 | indirect |
| npm | micromark-extension-gfm-tagfilter | 2.0.0 | indirect |
| npm | micromark-extension-gfm-task-list-item | 2.1.0 | indirect |
| npm | micromark-extension-mdx-expression | 3.0.1 | indirect |
| npm | micromark-extension-mdx-jsx | 3.0.2 | indirect |
| npm | micromark-extension-mdx-md | 2.0.0 | indirect |
| npm | micromark-extension-mdxjs | 3.0.0 | indirect |
| npm | micromark-extension-mdxjs-esm | 3.0.0 | indirect |
| npm | micromark-factory-destination | 2.0.1 | indirect |
| npm | micromark-factory-label | 2.0.1 | indirect |
| npm | micromark-factory-mdx-expression | 2.0.3 | indirect |
| npm | micromark-factory-space | 2.0.1 | indirect |
| npm | micromark-factory-title | 2.0.1 | indirect |
| npm | micromark-factory-whitespace | 2.0.1 | indirect |
| npm | micromark-util-character | 2.1.1 | indirect |
| npm | micromark-util-chunked | 2.0.1 | indirect |
| npm | micromark-util-classify-character | 2.0.1 | indirect |
| npm | micromark-util-combine-extensions | 2.0.1 | indirect |
| npm | micromark-util-decode-numeric-character-reference | 2.0.2 | indirect |
| npm | micromark-util-decode-string | 2.0.1 | indirect |
| npm | micromark-util-encode | 2.0.1 | indirect |
| npm | micromark-util-events-to-acorn | 2.0.3 | indirect |
| npm | micromark-util-html-tag-name | 2.0.1 | indirect |
| npm | micromark-util-normalize-identifier | 2.0.1 | indirect |
| npm | micromark-util-resolve-all | 2.0.1 | indirect |
| npm | micromark-util-sanitize-uri | 2.0.1 | indirect |
| npm | micromark-util-subtokenize | 2.1.0 | indirect |
| npm | micromark-util-symbol | 2.0.1 | indirect |
| npm | micromark-util-types | 2.0.2 | indirect |
| npm | micromatch | 4.0.8 | indirect |
| npm | mime | 1.6.0 | indirect |
| npm | mime-db | 1.52.0 | indirect |
| npm | mime-db | 1.54.0 | indirect |
| npm | mime-types | 2.1.35 | indirect |
| npm | mime-types | 3.0.2 | indirect |
| npm | mimic-function | 5.0.1 | indirect |
| npm | mimic-response | 3.1.0 | indirect |
| npm | min-indent | 1.0.1 | indirect |
| npm | minimatch | 10.2.3 | indirect |
| npm | minimatch | 10.2.6 | indirect |
| npm | minimist | 1.2.8 | indirect |
| npm | minipass | 7.1.3 | indirect |
| npm | minizlib | 3.1.0 | indirect |
| npm | mkdirp-classic | 0.5.3 | indirect |
| npm | mlly | 1.8.2 | indirect |
| npm | monaco-editor | 0.56.0 | indirect |
| npm | monaco-editor-core | 0.56.0 | indirect |
| npm | morgan | 1.11.0 | indirect |
| npm | mrmime | 2.0.1 | indirect |
| npm | ms | 2.0.0 | indirect |
| npm | ms | 2.1.3 | indirect |
| npm | muggle-string | 0.4.1 | indirect |
| npm | multer | 2.2.0 | indirect |
| npm | mustache | 4.2.0 | indirect |
| npm | mute-stream | 0.0.8 | indirect |
| npm | mute-stream | 3.0.0 | indirect |
| npm | nanoid | 3.3.18 | indirect |
| npm | nanotar | 0.3.0 | indirect |
| npm | napi-build-utils | 2.0.0 | indirect |
| npm | negotiator | 0.6.3 | indirect |
| npm | negotiator | 1.1.0 | indirect |
| npm | neotraverse | 1.0.1 | indirect |
| npm | nlcst-to-string | 4.0.0 | indirect |
| npm | node-abi | 3.95.0 | indirect |
| npm | node-addon-api | 4.3.0 | indirect |
| npm | node-addon-api | 8.9.2 | indirect |
| npm | node-fetch-native | 1.6.7 | indirect |
| npm | node-gyp-build | 4.8.4 | indirect |
| npm | node-mock-http | 1.0.5 | indirect |
| npm | node-releases | 2.0.54 | indirect |
| npm | node-sarif-builder | 3.4.0 | indirect |
| npm | normalize-package-data | 6.0.2 | indirect |
| npm | normalize-path | 3.0.0 | indirect |
| npm | npm-run-path | 6.0.0 | indirect |
| npm | nth-check | 2.1.1 | indirect |
| npm | nwsapi | 2.2.0 | indirect |
| npm | nwsapi | 2.2.24 | indirect |
| npm | object-inspect | 1.13.4 | indirect |
| npm | obug | 2.1.4 | indirect |
| npm | octokit | 5.0.5 | indirect |
| npm | ofetch | 1.5.1 | indirect |
| npm | ohash | 2.0.12 | indirect |
| npm | on-finished | 2.4.1 | indirect |
| npm | on-headers | 1.1.0 | indirect |
| npm | once | 1.4.0 | indirect |
| npm | onetime | 7.0.0 | indirect |
| npm | oniguruma-parser | 0.12.2 | indirect |
| npm | oniguruma-to-es | 4.3.6 | indirect |
| npm | open | 10.2.0 | indirect |
| npm | open | 11.0.1 | indirect |
| npm | ora | 8.2.0 | indirect |
| npm | ora | 9.4.1 | indirect |
| npm | oxc-parser | 0.127.0 | indirect |
| npm | oxc-resolver | 11.21.2 | indirect |
| npm | oxlint | 1.80.0 | indirect |
| npm | oxlint-tsgolint | 7.0.2001 | indirect |
| npm | p-limit | 3.1.0 | indirect |
| npm | p-limit | 7.3.1 | indirect |
| npm | p-locate | 5.0.0 | indirect |
| npm | p-map | 7.0.6 | indirect |
| npm | p-queue | 9.3.3 | indirect |
| npm | p-timeout | 7.0.1 | indirect |
| npm | package-json-from-dist | 1.0.1 | indirect |
| npm | package-manager-detector | 1.8.0 | indirect |
| npm | pagefind | 1.5.2 | indirect |
| npm | pako | 0.2.9 | indirect |
| npm | pako | 1.0.11 | indirect |
| npm | parse-entities | 4.0.2 | indirect |
| npm | parse-json | 8.3.0 | indirect |
| npm | parse-latin | 7.0.0 | indirect |
| npm | parse-ms | 4.0.0 | indirect |
| npm | parse-semver | 1.1.1 | indirect |
| npm | parse5 | 6.0.1 | indirect |
| npm | parse5 | 7.3.0 | indirect |
| npm | parse5-htmlparser2-tree-adapter | 7.1.0 | indirect |
| npm | parse5-parser-stream | 7.1.2 | indirect |
| npm | parseurl | 1.3.3 | indirect |
| npm | path-browserify | 1.0.1 | indirect |
| npm | path-exists | 4.0.0 | indirect |
| npm | path-expression-matcher | 1.6.2 | indirect |
| npm | path-is-absolute | 1.0.1 | indirect |
| npm | path-key | 3.1.1 | indirect |
| npm | path-key | 4.0.0 | indirect |
| npm | path-parse | 1.0.7 | indirect |
| npm | path-scurry | 2.0.2 | indirect |
| npm | path-to-regexp | 8.4.2 | indirect |
| npm | path-type | 6.0.0 | indirect |
| npm | pathe | 2.0.3 | indirect |
| npm | pathe | catalog: | indirect |
| npm | pathval | 2.0.1 | indirect |
| npm | pct-encode | 1.0.3 | indirect |
| npm | peek-stream | 1.1.3 | indirect |
| npm | pend | 1.2.0 | indirect |
| npm | piccolore | 0.1.3 | indirect |
| npm | picomatch | 2.3.2 | indirect |
| npm | picomatch | 4.0.7 | indirect |
| npm | pkg-types | 1.3.1 | indirect |
| npm | pkg-types | 2.3.1 | indirect |
| npm | playwright | 1.62.1 | indirect |
| npm | playwright-core | 1.62.1 | indirect |
| npm | plist | 5.0.0 | indirect |
| npm | postcss | 8.5.26 | indirect |
| npm | postcss-nested | 6.2.0 | indirect |
| npm | postcss-selector-parser | 6.1.4 | indirect |
| npm | powershell-utils | 0.1.0 | indirect |
| npm | powershell-utils | 0.2.0 | indirect |
| npm | prebuild-install | 7.1.3 | indirect |
| npm | prettier-plugin-astro | 0.14.1 | indirect |
| npm | prettier-plugin-organize-imports | 4.3.0 | indirect |
| npm | prettier-plugin-sh | 0.19.0 | indirect |
| npm | pretty-format | 27.5.1 | indirect |
| npm | pretty-ms | 9.3.0 | indirect |
| npm | prex | 0.4.9 | indirect |
| npm | prismjs | 1.30.0 | indirect |
| npm | process | 0.11.10 | indirect |
| npm | process-ancestry | 0.1.0 | indirect |
| npm | process-nextick-args | 2.0.1 | indirect |
| npm | promise-debounce | 1.0.1 | indirect |
| npm | prompts | 2.4.2 | indirect |
| npm | proper-lockfile | 2.0.1 | indirect |
| npm | proper-lockfile | 4.1.2 | indirect |
| npm | property-information | 7.2.0 | indirect |
| npm | proxy-addr | 2.0.7 | indirect |
| npm | proxy-agent-negotiate | 1.1.0 | indirect |
| npm | pump | 2.0.1 | indirect |
| npm | pump | 3.0.4 | indirect |
| npm | pumpify | 1.5.1 | indirect |
| npm | punycode | 2.3.1 | indirect |
| npm | punycode.js | 2.3.1 | indirect |
| npm | pyodide | 0.26.2 | indirect |
| npm | qs | 6.15.3 | indirect |
| npm | quansync | 0.2.11 | indirect |
| npm | queue-microtask | 1.2.3 | indirect |
| npm | radix3 | 1.1.2 | indirect |
| npm | range-parser | 1.3.0 | indirect |
| npm | raw-body | 3.0.2 | indirect |
| npm | rc | 1.2.8 | indirect |
| npm | rc-config-loader | 4.1.4 | indirect |
| npm | react-docgen | 8.0.3 | indirect |
| npm | react-docgen-typescript | 2.4.0 | indirect |
| npm | react-error-boundary | 6.1.3 | indirect |
| npm | react-hotkeys-hook | 5.3.3 | indirect |
| npm | react-is | 17.0.2 | indirect |
| npm | react-markdown | 10.1.0 | indirect |
| npm | react-refresh | 0.18.0 | indirect |
| npm | read | 1.0.7 | indirect |
| npm | read-pkg | 9.0.1 | indirect |
| npm | readable-stream | 2.3.8 | indirect |
| npm | readable-stream | 3.6.2 | indirect |
| npm | readable-stream | 4.7.0 | indirect |
| npm | readdirp | 4.1.2 | indirect |
| npm | readdirp | 5.1.1 | indirect |
| npm | recast | 0.23.21 | indirect |
| npm | recma-build-jsx | 1.0.0 | indirect |
| npm | recma-jsx | 1.0.1 | indirect |
| npm | recma-parse | 1.0.0 | indirect |
| npm | recma-stringify | 1.0.0 | indirect |
| npm | redent | 3.0.0 | indirect |
| npm | reduce-flatten | 2.0.0 | indirect |
| npm | regex | 6.1.0 | indirect |
| npm | regex-recursion | 6.0.2 | indirect |
| npm | regex-utilities | 2.3.0 | indirect |
| npm | rehype | 13.0.2 | indirect |
| npm | rehype | catalog: | indirect |
| npm | rehype-expressive-code | 0.44.1 | indirect |
| npm | rehype-format | 5.0.1 | indirect |
| npm | rehype-parse | 9.0.1 | indirect |
| npm | rehype-raw | 7.0.0 | indirect |
| npm | rehype-recma | 1.0.0 | indirect |
| npm | rehype-stringify | 10.0.1 | indirect |
| npm | remark-directive | 4.0.0 | indirect |
| npm | remark-gfm | 4.0.1 | indirect |
| npm | remark-gfm | catalog: | indirect |
| npm | remark-heading-id | 1.0.1 | indirect |
| npm | remark-heading-id | catalog: | indirect |
| npm | remark-mdx | 3.1.1 | indirect |
| npm | remark-parse | 11.0.0 | indirect |
| npm | remark-rehype | 11.1.2 | indirect |
| npm | remark-smartypants | 3.0.3 | indirect |
| npm | remark-stringify | 11.0.0 | indirect |
| npm | request-light | 0.5.8 | indirect |
| npm | request-light | 0.7.0 | indirect |
| npm | require-from-string | 2.0.2 | indirect |
| npm | resolve | 1.22.12 | indirect |
| npm | resolve-from | 5.0.0 | indirect |
| npm | resolve-path | 1.4.0 | indirect |
| npm | resolve-pkg-maps | 1.0.0 | indirect |
| npm | resolve.exports | 2.0.3 | indirect |
| npm | restore-cursor | 5.1.0 | indirect |
| npm | retext | 9.0.0 | indirect |
| npm | retext-latin | 4.0.0 | indirect |
| npm | retext-smartypants | 6.2.0 | indirect |
| npm | retext-stringify | 4.0.0 | indirect |
| npm | retry | 0.10.1 | indirect |
| npm | retry | 0.12.0 | indirect |
| npm | reusify | 1.1.0 | indirect |
| npm | rimraf | 6.1.3 | indirect |
| npm | rimraf | catalog: | indirect |
| npm | rolldown | 1.2.6 | indirect |
| npm | rollup-plugin-visualizer | 7.1.1 | indirect |
| npm | router | 2.2.0 | indirect |
| npm | rrweb-cssom | 0.7.1 | indirect |
| npm | rrweb-cssom | 0.8.0 | indirect |
| npm | rtl-css-js | 1.16.1 | indirect |
| npm | run-applescript | 7.1.0 | indirect |
| npm | run-parallel | 1.2.0 | indirect |
| npm | rxjs | 7.8.2 | indirect |
| npm | s.color | 0.0.15 | indirect |
| npm | safe-buffer | 5.1.2 | indirect |
| npm | safe-buffer | 5.2.1 | indirect |
| npm | safer-buffer | 2.1.2 | indirect |
| npm | sass-formatter | 0.7.9 | indirect |
| npm | satteri | 0.10.5 | indirect |
| npm | satteri | 0.9.5 | indirect |
| npm | sax | 1.6.1 | indirect |
| npm | saxes | 6.0.0 | indirect |
| npm | scheduler | 0.27.0 | indirect |
| npm | secretlint | 10.2.2 | indirect |
| npm | section-matter | 1.0.0 | indirect |
| npm | send | 1.2.1 | indirect |
| npm | serve-static | 2.2.1 | indirect |
| npm | setimmediate | 1.0.5 | indirect |
| npm | setprototypeof | 1.1.0 | indirect |
| npm | setprototypeof | 1.2.0 | indirect |
| npm | sh-syntax | 0.6.0 | indirect |
| npm | shebang-command | 2.0.0 | indirect |
| npm | shebang-regex | 3.0.0 | indirect |
| npm | shell-quote | 1.9.0 | indirect |
| npm | shiki | 4.4.3 | indirect |
| npm | side-channel | 1.1.1 | indirect |
| npm | side-channel-list | 1.0.1 | indirect |
| npm | side-channel-map | 1.0.1 | indirect |
| npm | side-channel-weakmap | 1.0.2 | indirect |
| npm | siginfo | 2.0.0 | indirect |
| npm | signal-exit | 3.0.7 | indirect |
| npm | signal-exit | 4.1.0 | indirect |
| npm | simple-concat | 1.0.1 | indirect |
| npm | simple-get | 4.0.1 | indirect |
| npm | simple-git | 3.36.0 | indirect |
| npm | sirv | 3.0.2 | indirect |
| npm | sisteransi | 1.0.5 | indirect |
| npm | sitemap | 9.0.1 | indirect |
| npm | slash | 5.1.0 | indirect |
| npm | slice-ansi | 4.0.0 | indirect |
| npm | smol-toml | 1.8.0 | indirect |
| npm | source-map | 0.6.1 | indirect |
| npm | source-map | 0.7.6 | indirect |
| npm | source-map | 0.8.0 | indirect |
| npm | source-map-js | 1.2.1 | indirect |
| npm | space-separated-tokens | 2.0.2 | indirect |
| npm | spdx-correct | 3.2.0 | indirect |
| npm | spdx-exceptions | 2.5.0 | indirect |
| npm | spdx-expression-parse | 3.0.1 | indirect |
| npm | spdx-license-ids | 3.0.23 | indirect |
| npm | sprintf-js | 1.0.3 | indirect |
| npm | stackback | 0.0.2 | indirect |
| npm | statuses | 1.5.0 | indirect |
| npm | statuses | 2.0.2 | indirect |
| npm | std-env | 4.2.0 | indirect |
| npm | stdin-discarder | 0.2.2 | indirect |
| npm | stdin-discarder | 0.3.2 | indirect |
| npm | storybook | 10.5.10 | indirect |
| npm | stream-replace-string | 2.0.0 | indirect |
| npm | stream-shift | 1.0.3 | indirect |
| npm | streamsearch | 1.1.0 | indirect |
| npm | streamx | 2.28.1 | indirect |
| npm | string-argv | 0.3.2 | indirect |
| npm | string-width | 4.2.3 | indirect |
| npm | string-width | 7.2.0 | indirect |
| npm | string-width | 8.2.2 | indirect |
| npm | string_decoder | 1.1.1 | indirect |
| npm | string_decoder | 1.3.0 | indirect |
| npm | stringify-entities | 4.0.4 | indirect |
| npm | strip-ansi | 6.0.1 | indirect |
| npm | strip-ansi | 7.2.0 | indirect |
| npm | strip-bom | 3.0.0 | indirect |
| npm | strip-bom-string | 1.0.0 | indirect |
| npm | strip-final-newline | 4.0.0 | indirect |
| npm | strip-indent | 3.0.0 | indirect |
| npm | strip-indent | 4.1.1 | indirect |
| npm | strip-json-comments | 2.0.1 | indirect |
| npm | strip-json-comments | 5.0.3 | indirect |
| npm | strnum | 2.4.2 | indirect |
| npm | structured-source | 4.0.0 | indirect |
| npm | style-to-js | 1.1.21 | indirect |
| npm | style-to-object | 1.0.14 | indirect |
| npm | stylis | 4.4.0 | indirect |
| npm | suf-log | 2.5.3 | indirect |
| npm | supports-color | 10.2.2 | indirect |
| npm | supports-color | 5.5.0 | indirect |
| npm | supports-color | 7.2.0 | indirect |
| npm | supports-color | 8.1.1 | indirect |
| npm | supports-hyperlinks | 3.2.0 | indirect |
| npm | supports-preserve-symlinks-flag | 1.0.0 | indirect |
| npm | svgo | 4.1.0 | indirect |
| npm | swagger-ui-dist | 5.32.14 | indirect |
| npm | swagger-ui-express | 5.0.1 | indirect |
| npm | symbol-tree | 3.2.4 | indirect |
| npm | table | 6.9.0 | indirect |
| npm | table-layout | 1.0.2 | indirect |
| npm | tabster | 8.8.0 | indirect |
| npm | tar | 7.5.22 | indirect |
| npm | tar | catalog: | indirect |
| npm | tar-fs | 2.1.5 | indirect |
| npm | tar-fs | 3.1.3 | indirect |
| npm | tar-stream | 2.2.0 | indirect |
| npm | tar-stream | 3.2.1 | indirect |
| npm | teex | 1.0.1 | indirect |
| npm | temporal-polyfill | 1.0.4 | indirect |
| npm | temporal-spec | 1.0.1 | indirect |
| npm | temporal-utils | 1.0.2 | indirect |
| npm | terminal-link | 4.0.0 | indirect |
| npm | test-exclude | 8.0.0 | indirect |
| npm | text-decoder | 1.2.7 | indirect |
| npm | text-table | 0.2.0 | indirect |
| npm | textextensions | 6.11.0 | indirect |
| npm | through2 | 2.0.5 | indirect |
| npm | tiny-inflate | 1.0.3 | indirect |
| npm | tiny-invariant | 1.3.3 | indirect |
| npm | tinybench | 2.9.0 | indirect |
| npm | tinyclip | 0.1.15 | indirect |
| npm | tinyexec | 1.3.0 | indirect |
| npm | tinyglobby | 0.2.17 | indirect |
| npm | tinyrainbow | 2.0.0 | indirect |
| npm | tinyrainbow | 3.1.1 | indirect |
| npm | tinyspy | 4.0.4 | indirect |
| npm | tldts | 6.1.86 | indirect |
| npm | tldts-core | 6.1.86 | indirect |
| npm | tmp | 0.2.7 | indirect |
| npm | to-regex-range | 5.0.1 | indirect |
| npm | toad-cache | 3.7.4 | indirect |
| npm | toidentifier | 1.0.1 | indirect |
| npm | totalist | 3.0.1 | indirect |
| npm | tough-cookie | 5.1.2 | indirect |
| npm | tr46 | 5.1.1 | indirect |
| npm | tree-kill | 1.2.2 | indirect |
| npm | tree-sitter-c-sharp | 0.23.5 | indirect |
| npm | tree-sitter-java | 0.23.5 | indirect |
| npm | tree-sitter-javascript | 0.23.1 | indirect |
| npm | tree-sitter-javascript | 0.25.0 | indirect |
| npm | tree-sitter-python | 0.25.0 | indirect |
| npm | tree-sitter-typescript | 0.23.2 | indirect |
| npm | trim-lines | 3.0.1 | indirect |
| npm | trough | 2.2.0 | indirect |
| npm | ts-dedent | 2.3.0 | indirect |
| npm | tsconfig-paths | 4.2.0 | indirect |
| npm | tsscmp | 1.0.6 | indirect |
| npm | tsx | 4.23.12 | indirect |
| npm | tunnel | 0.0.6 | indirect |
| npm | tunnel-agent | 0.6.0 | indirect |
| npm | turbo | 2.10.12 | indirect |
| npm | type-fest | 4.41.0 | indirect |
| npm | type-is | 1.6.18 | indirect |
| npm | type-is | 2.1.0 | indirect |
| npm | typed-rest-client | 1.8.11 | indirect |
| npm | typedarray | 0.0.6 | indirect |
| npm | typedoc | 0.28.20 | indirect |
| npm | typedoc-plugin-markdown | 4.13.0 | indirect |
| npm | typesafe-path | 0.2.2 | indirect |
| npm | typescript-auto-import-cache | 0.3.6 | indirect |
| npm | typical | 4.0.0 | indirect |
| npm | typical | 5.2.0 | indirect |
| npm | uc.micro | 2.1.0 | indirect |
| npm | ufo | 1.6.4 | indirect |
| npm | ultrahtml | 1.7.0 | indirect |
| npm | uncrypto | 0.1.3 | indirect |
| npm | underscore | 1.13.8 | indirect |
| npm | undici | 7.29.0 | indirect |
| npm | undici | 8.10.0 | indirect |
| npm | undici-types | 7.18.2 | indirect |
| npm | undici-types | 8.3.0 | indirect |
| npm | unicorn-magic | 0.1.0 | indirect |
| npm | unicorn-magic | 0.3.0 | indirect |
| npm | unicorn-magic | 0.4.0 | indirect |
| npm | unified | 11.0.5 | indirect |
| npm | unifont | 0.7.5 | indirect |
| npm | unist-util-find-after | 5.0.0 | indirect |
| npm | unist-util-is | 3.0.0 | indirect |
| npm | unist-util-is | 6.0.1 | indirect |
| npm | unist-util-modify-children | 4.0.0 | indirect |
| npm | unist-util-position | 5.0.0 | indirect |
| npm | unist-util-position-from-estree | 2.0.0 | indirect |
| npm | unist-util-remove-position | 5.0.0 | indirect |
| npm | unist-util-stringify-position | 4.0.0 | indirect |
| npm | unist-util-visit | 1.4.1 | indirect |
| npm | unist-util-visit | 5.1.0 | indirect |
| npm | unist-util-visit | catalog: | indirect |
| npm | unist-util-visit-children | 3.0.0 | indirect |
| npm | unist-util-visit-parents | 2.1.2 | indirect |
| npm | unist-util-visit-parents | 6.0.2 | indirect |
| npm | universal-github-app-jwt | 2.2.2 | indirect |
| npm | universal-user-agent | 7.0.3 | indirect |
| npm | universalify | 2.0.1 | indirect |
| npm | unpipe | 1.0.0 | indirect |
| npm | unplugin | 2.3.11 | indirect |
| npm | unplugin-dts | 1.0.3 | indirect |
| npm | unstorage | 1.17.5 | indirect |
| npm | update-browserslist-db | 1.3.1 | indirect |
| npm | uri-template | 2.0.0 | indirect |
| npm | url-extras | 0.1.0 | indirect |
| npm | url-join | 4.0.1 | indirect |
| npm | use-sync-external-store | 1.6.0 | indirect |
| npm | util-deprecate | 1.0.2 | indirect |
| npm | v8-to-istanbul | 9.3.0 | indirect |
| npm | validate-html-nesting | 1.2.4 | indirect |
| npm | validate-npm-package-license | 3.0.4 | indirect |
| npm | vary | 1.1.2 | indirect |
| npm | version-range | 4.15.0 | indirect |
| npm | vfile | 6.0.3 | indirect |
| npm | vfile-location | 5.0.3 | indirect |
| npm | vfile-message | 4.0.3 | indirect |
| npm | vite-plugin-checker | 0.14.5 | indirect |
| npm | vite-plugin-dts | 5.0.3 | indirect |
| npm | vitefu | 1.1.3 | indirect |
| npm | vitest | 4.1.11 | indirect |
| npm | vitest | catalog: | indirect |
| npm | volar-service-css | 0.0.71 | indirect |
| npm | volar-service-emmet | 0.0.71 | indirect |
| npm | volar-service-html | 0.0.71 | indirect |
| npm | volar-service-prettier | 0.0.71 | indirect |
| npm | volar-service-typescript | 0.0.71 | indirect |
| npm | volar-service-typescript-twoslash-queries | 0.0.71 | indirect |
| npm | volar-service-yaml | 0.0.71 | indirect |
| npm | vscode-css-languageservice | 6.3.10 | indirect |
| npm | vscode-html-languageservice | 5.6.2 | indirect |
| npm | vscode-json-languageservice | 4.1.8 | indirect |
| npm | vscode-jsonrpc | 8.2.0 | indirect |
| npm | vscode-jsonrpc | 9.0.1 | indirect |
| npm | vscode-languageclient | 10.1.0 | indirect |
| npm | vscode-languageserver | 10.1.0 | indirect |
| npm | vscode-languageserver | 9.0.1 | indirect |
| npm | vscode-languageserver-protocol | 3.17.5 | indirect |
| npm | vscode-languageserver-protocol | 3.18.2 | indirect |
| npm | vscode-languageserver-textdocument | 1.0.13 | indirect |
| npm | vscode-languageserver-textdocument | 1.0.14 | indirect |
| npm | vscode-languageserver-types | 3.17.5 | indirect |
| npm | vscode-languageserver-types | 3.18.0 | indirect |
| npm | vscode-nls | 5.2.0 | indirect |
| npm | vscode-oniguruma | 2.0.1 | indirect |
| npm | vscode-textmate | 9.3.2 | indirect |
| npm | vscode-uri | 3.2.0 | indirect |
| npm | w3c-xmlserializer | 5.0.0 | indirect |
| npm | web-namespaces | 2.0.1 | indirect |
| npm | web-tree-sitter | 0.26.13 | indirect |
| npm | webidl-conversions | 7.0.0 | indirect |
| npm | webpack-virtual-modules | 0.6.2 | indirect |
| npm | whatwg-encoding | 3.1.1 | indirect |
| npm | whatwg-mimetype | 3.0.0 | indirect |
| npm | whatwg-mimetype | 4.0.0 | indirect |
| npm | whatwg-url | 14.2.0 | indirect |
| npm | which | 2.0.2 | indirect |
| npm | which | 7.0.0 | indirect |
| npm | why-is-node-running | 2.3.0 | indirect |
| npm | wordwrapjs | 4.0.1 | indirect |
| npm | workerpool | 9.3.4 | indirect |
| npm | wrap-ansi | 9.0.2 | indirect |
| npm | wrappy | 1.0.2 | indirect |
| npm | ws | 8.21.3 | indirect |
| npm | wsl-utils | 0.1.0 | indirect |
| npm | wsl-utils | 1.0.0 | indirect |
| npm | xdg-basedir | 5.1.0 | indirect |
| npm | xml-name-validator | 5.0.0 | indirect |
| npm | xml-naming | 0.3.0 | indirect |
| npm | xml2js | 0.5.0 | indirect |
| npm | xmlbuilder | 11.0.1 | indirect |
| npm | xmlbuilder | 15.1.1 | indirect |
| npm | xmlchars | 2.2.0 | indirect |
| npm | xtend | 4.0.2 | indirect |
| npm | xxhash-wasm | 1.1.0 | indirect |
| npm | y18n | 5.0.8 | indirect |
| npm | yallist | 3.1.1 | indirect |
| npm | yallist | 4.0.0 | indirect |
| npm | yallist | 5.0.0 | indirect |
| npm | yaml-language-server | 1.23.0 | indirect |
| npm | yargs | 18.0.0 | indirect |
| npm | yargs | 18.1.0 | indirect |
| npm | yargs-parser | 21.1.1 | indirect |
| npm | yargs-parser | 22.0.0 | indirect |
| npm | yauzl | 3.4.0 | indirect |
| npm | yazl | 2.5.1 | indirect |
| npm | yocto-queue | 0.1.0 | indirect |
| npm | yocto-queue | 1.2.2 | indirect |
| npm | yoctocolors | 2.2.0 | indirect |
| npm | zod | 3.25.76 | indirect |
| npm | zod | 4.4.3 | indirect |
| npm | zwitch | 2.0.4 | indirect |
| PyPI | aiohttp | — | indirect |
| PyPI | azure-core | — | indirect |
| PyPI | azure-mgmt-core | 1.6.0 | indirect |
| PyPI | black | 26.3.1 | indirect |
| PyPI | colorama | 0.4.6 | indirect |
| PyPI | corehttp | — | indirect |
| PyPI | coverage | 7.6.1 | indirect |
| PyPI | debugpy | 1.8.2 | indirect |
| PyPI | filelock | — | indirect |
| PyPI | geojson | — | indirect |
| PyPI | isodate | — | indirect |
| PyPI | mypy | 1.19.1 | indirect |
| PyPI | mypy | 2.1.0 | indirect |
| PyPI | myst-parser | — | indirect |
| PyPI | pip | — | indirect |
| PyPI | pkginfo | — | indirect |
| PyPI | ptvsd | 4.3.2 | indirect |
| PyPI | pylint | — | indirect |
| PyPI | pylint | 4.0.4 | indirect |
| PyPI | pylint | 4.0.6 | indirect |
| PyPI | pyright | 1.1.407 | indirect |
| PyPI | pyright | 1.1.411 | indirect |
| PyPI | pytest | 9.0.3 | indirect |
| PyPI | pytest-asyncio | — | indirect |
| PyPI | pytest-xdist | — | indirect |
| PyPI | setuptools | — | indirect |
| PyPI | sphinx | — | indirect |
| PyPI | sphinx-rtd-theme | — | indirect |
| PyPI | sphinxcontrib-jquery | — | indirect |
| PyPI | tox | — | indirect |
| PyPI | tox | 4.16.0 | indirect |
| PyPI | tox-uv | — | indirect |
| PyPI | types-pyyaml | 6.0.12.8 | indirect |
| PyPI | typing-extensions | — | indirect |
Dependency advisories 0
Installing npm:@azure-tools/typespec-go@0.17.3 pulls in 1 packages, direct and transitive: 0 carry known advisories, of which 0 are direct dependencies.
No known advisories affect the assessed dependencies.
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Raw JSON report machine-readable
Feedback
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.