Public recordWeak
Software health reportschema 0.34.0 · metrics 2.10.0 · 2026-09-05 22:27 UTC
JX3BOX / jx3box-editor
💠Article, Editor, Upload components.
JX3BOX/jx3box-editor holds a health index of 42 out of 100, placing it in the Weak band. It scores highest on Sustainability & Governance (73/100) and lowest on Community & Adoption (23/100). It was last updated 40 days ago. A single contributor accounts for most of its recent work.
42
overall / 100Software health index
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
42
Exceptional93-100The record's top tier (≈ top 5%); essentially all checked criteria met
Excellent80-92Strong across the board; minor gaps
Good65-79Healthy; gaps are limited and manageable
Moderate50-64Acceptable with notable gaps; review recommended
Weak35-49Material weaknesses across several areas
At Risk20-34Significant weaknesses; adoption warrants caution
Critical1-19Severe problems (abandoned, single-maintainer, no hygiene)
Score profile
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 45 is calibrated to 42 on the published index scale (record calibration 2026-08-02).
Ownership
JX3BOXOrganization · verified domain
45 followers87 public repossince Jun 2018
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
Package ecosystems
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | @jx3box/jx3box-editor | 3.2.13 | 1,221 | 302 | 40 days ago | — |
| Packagist | tinymce/tinymcepoints to another repo — not scored | 8.9.0 | 194,748 | 246 | 5 days ago | textjavascriptwysiwygtinymcehtmleditingrichtextcontenteditablerterich-editorrich-text-editorrich-text |
Metrics by category
Vitality
Is the project alive — is code being written and are releases shipping?
35
Development activity
58Moderate
How it's scored
| 18/36 | Push recency — last push 40 days ago |
| 12.5/36 | Commit cadence — 18/52 weeks with commits |
| 18/18 | Commit volume — 107 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 14 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Inputs used
| commits_last_year | 107 |
| human_commit_share | 1 |
| days_since_last_push | 40 |
| active_weeks_last_year | 18 |
Release discipline
1Critical
How it's scored
| 0/27 | Ships releases — no releases published |
| 0/36 | Release recency — no releases |
| 0/27 | Release cadence — no releases |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
Inputs used
| releases_count | 0 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.
Community & Adoption
Does the project have users, downloads, attention, and a welcoming setup for contributors?
23
Popularity & adoption
3Critical
How it's scored
| 0/60 | Stars — 0 stars |
| 0/25 | Forks — 1 forks |
| 2.7/15 | Watchers — 4 watchers |
Inputs used
| forks | 1 |
| stars | 0 |
| watchers | 4 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community health
25At Risk
How it's scored
| 22.5/22.5 | README |
| 0/22.5 | License — no license file detected |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
Inputs used
| has_readme | yes |
| has_license | no |
| readme_badges | 0 |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | — |
| has_pull_request_template | no |
Ecosystem adoption (downloads)
52Moderate
How it's scored
| 41.2/80 | Monthly downloads — 1,221 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
Inputs used
| packages | @jx3box/jx3box-editor |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 1,221 |
| unverified_packages_excluded | — |
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.
Sustainability & Governance
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
73
How it's scored
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 10/22.5 | Commit distribution — top contributor authored 56% of commits |
| 9.5/13.5 | Contributor breadth — 7 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 5 contributing companies or organizations |
Inputs used
| bus_factor | 1 |
| contributors_sampled | 7 |
| top_contributor_share | 0.556 |
How it's scored
| 38.9/42 | Issue resolution — 93% of issues closed |
| 30/30 | PR acceptance — 3/3 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Inputs used
| merged_prs | 3 |
| open_issues | 2 |
| closed_issues | 25 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 0 |
| prs_decided_30d | 0 |
| issue_closed_ratio | 0.926 |
| closed_unmerged_prs | 0 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
Excluded from scoring (no data or not applicable): Newcomer PR acceptance. Remaining weights renormalized.
Ownership & stewardship
87Excellent
How it's scored
| 30/30 | Ownership backing — organization-owned |
| 20/20 | Verified domain |
| 12/25 | Owner reach — 45 followers of JX3BOX |
| 25/25 | Track record — 87 public repos, account ~8 yr old |
Inputs used
| followers | 45 |
| owner_type | Organization |
| is_verified | yes |
| owner_login | JX3BOX |
| public_repos | 87 |
| account_age_days | 3,011 |
Package maintenance
100Exceptional
How it's scored
| 25/25 | Published & resolvable — 1 package(s) on npm |
| 35/35 | Publish recency — latest publish 40 days ago |
| 20/20 | Version history — 302 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
Inputs used
| packages | @jx3box/jx3box-editor |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 40 |
Engineering Quality
Are baseline engineering and documentation practices in place?
57
Engineering practices
38Weak
How it's scored
| 24/24 | CI workflows — 3 workflow(s) |
| 0/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
Inputs used
| has_ci | yes |
| has_tests | no |
| has_editorconfig | yes |
| has_linter_config | no |
| has_precommit_config | no |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.
Documentation
85Excellent
How it's scored
| 30/30 | README |
| 25/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 10/10 | Topics — 1 topics |
| 10/10 | Wiki |
Inputs used
| topics | package |
| has_wiki | yes |
| homepage | — |
| docs_site | — |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Security
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
32
Security posture
31At Risk
How it's scored
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 5 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 0/2.5 | License — license file not detected |
| 7.5/7.5 | Maintained — 14 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 134 existing vulnerabilities detected |
Inputs used
| source | openssf_scorecard |
| checks_evaluated | 15 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 3 |
| scorecard_aggregate | 3.1 |
Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.
Dependency advisories
38Weak
How it's scored
| 9.2/35 | Direct dependencies free of known advisories — 2 affected: axios 0.19.2 (high 8.6), uuid 9.0.1 (high 7.5) |
| 6.3/25 | Indirect dependencies free of known advisories — 2 affected: follow-redirects 1.5.10 (high 8.0), tinymce 6.8.6 (high 8.7) |
| 22/40 | No advisories left outstanding — 4 advisory-carrying package(s) unaddressed past 90 days; oldest published 2,070 days ago |
Inputs used
| source | osv |
| advisories | 36 |
| affected_packages | 4 |
| assessed_packages | 200 |
| unassessed_packages | 0 |
| affected_by_severity | high 4 |
| direct_affected_packages | 2 |
Matched the npm:@jx3box/jx3box-editor@3.2.13 runtime dependency closure — what installing the published package pulls in — 200 packages. Reachability is not analyzed.
AI Readiness
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
31
Agent context & guidance
21At Risk
How it's scored
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 20.8/40 | Legible commit history — 39 of 100 human commits state their intent (structured subject or explanatory body) |
Inputs used
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 0.39 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
How it's scored
| 0/18 | One-command bootstrap |
| 0/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — jsconfig.json, tsconfig.json |
| 10/10 | Reproducible environment — lockfile |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 0/8 | Automated maintenance — no automated dependency updates observed |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Inputs used
| has_nix | no |
| has_tests | no |
| lockfiles | package-lock.json |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | jsconfig.json, tsconfig.json |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
How it's scored
| 27/45 | Type-checkable code — JavaScript with type-check config (jsconfig.json, tsconfig.json) |
| 50/55 | Manageable file sizes — 24/265 source files over 60KB |
Inputs used
| primary_language | JavaScript |
| largest_source_bytes | 1,233,940 |
| source_files_sampled | 265 |
| oversized_source_files | 24 |
Key facts
0GitHub stars
7contributors
107commits, last 12 months
40days since last push
0releases
1bus factor
2open issues
npm, Packagistpackage ecosystems
Data collection warnings
- packagist package 'tinymce/tinymce' points at a different repository (https://github.com/tinymce/tinymce-dist); excluded from ecosystem scoring
More detail
OpenSSF Scorecard 3.1 / 10
3.1aggregate
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 5 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 0 | License | license file not detected |
| 10 | Maintained | 14 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| n/a | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 134 existing vulnerabilities detected |
Direct dependencies 30
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| npm | @element-plus/icons-vue | ^2.0.10 | package.json |
| npm | @imengyu/vue3-context-menu | ^1.5.4 | package.json |
| npm | @jx3box/jx3box-common | ^9.2.9 | package.json |
| npm | @jx3box/jx3box-data | ^3.9.6 | package.json |
| npm | @jx3box/jx3box-emotion | ^1.3.1 | package.json |
| npm | @jx3box/jx3box-macro | ^1.0.4 | package.json |
| npm | @jx3box/jx3box-talent | ^1.3.14 | package.json |
| npm | @tinymce/tinymce-vue | ^5.0.0 | package.json |
| npm | axios | ^0.19.2 | package.json |
| npm | cheerio | ^1.1.2 | package.json |
| npm | dayjs | ^1.11.19 | package.json |
| npm | element-plus | ^2.2.29 | package.json |
| npm | github-markdown-css | ^5.9.0 | package.json |
| npm | hevue-img-preview | ^5.0.0 | package.json |
| npm | highlight.js | ^11.7.0 | package.json |
| npm | jquery | ^3.5.1 | package.json |
| npm | js-base64 | ^3.6.1 | package.json |
| npm | katex | ^0.16.4 | package.json |
| npm | lodash | ^4.17.21 | package.json |
| npm | lucide | ^0.577.0 | package.json |
| npm | photoswipe | ^4.1.2 | package.json |
| npm | sanitize-html | ^2.17.0 | package.json |
| npm | sortablejs | ^1.15.0 | package.json |
| npm | uuid | ^9.0.1 | package.json |
| npm | vditor | ^3.11.2 | package.json |
| npm | viewerjs | ^1.11.6 | package.json |
| npm | vue | ^3.2.13 | package.json |
| npm | vue-plugin-load-script | ^1.3.6 | package.json |
| npm | vuedraggable | ^4.1.0 | package.json |
| npm | xss | ^1.0.8 | package.json |
All dependencies 1,437
Full resolved dependency set from the GitHub dependency graph: 35 direct and 1,402 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | @element-plus/icons-vue | 2.3.2 | direct |
| npm | @imengyu/vue3-context-menu | 1.5.4 | direct |
| npm | @jx3box/jx3box-common | 9.2.9 | direct |
| npm | @jx3box/jx3box-data | 3.9.6 | direct |
| npm | @jx3box/jx3box-emotion | 1.3.1 | direct |
| npm | @jx3box/jx3box-macro | 1.0.4 | direct |
| npm | @jx3box/jx3box-talent | 1.3.14 | direct |
| npm | @tinymce/tinymce-vue | 5.1.1 | direct |
| npm | axios | 0.19.2 | direct |
| npm | axios | 1.13.6 | direct |
| npm | cheerio | 1.0.0-rc.12 | direct |
| npm | cheerio | 1.2.0 | direct |
| npm | dayjs | 1.11.19 | direct |
| npm | element-plus | 2.13.5 | direct |
| npm | github-markdown-css | 5.9.0 | direct |
| npm | hevue-img-preview | 5.0.3 | direct |
| npm | highlight.js | 10.7.3 | direct |
| npm | highlight.js | 11.11.1 | direct |
| npm | jquery | 3.7.1 | direct |
| npm | js-base64 | 3.7.8 | direct |
| npm | katex | 0.16.38 | direct |
| npm | lodash | 4.17.23 | direct |
| npm | lucide | 0.577.0 | direct |
| npm | photoswipe | 4.1.3 | direct |
| npm | sanitize-html | 2.17.1 | direct |
| npm | sortablejs | 1.14.0 | direct |
| npm | sortablejs | 1.15.7 | direct |
| npm | uuid | 8.3.2 | direct |
| npm | uuid | 9.0.1 | direct |
| npm | vditor | 3.11.2 | direct |
| npm | viewerjs | 1.11.7 | direct |
| npm | vue | 3.5.30 | direct |
| npm | vue-plugin-load-script | 1.3.6 | direct |
| npm | vuedraggable | 4.1.0 | direct |
| npm | xss | 1.0.15 | direct |
| npm | @achrinza/node-ipc | 9.2.10 | indirect |
| npm | @adobe/css-tools | 4.4.4 | indirect |
| npm | @alloc/quick-lru | 5.2.0 | indirect |
| npm | @babel/code-frame | 7.12.11 | indirect |
| npm | @babel/code-frame | 7.29.0 | indirect |
| npm | @babel/compat-data | 7.29.0 | indirect |
| npm | @babel/core | 7.29.0 | indirect |
| npm | @babel/eslint-parser | 7.28.6 | indirect |
| npm | @babel/generator | 7.29.1 | indirect |
| npm | @babel/helper-annotate-as-pure | 7.27.3 | indirect |
| npm | @babel/helper-compilation-targets | 7.28.6 | indirect |
| npm | @babel/helper-create-class-features-plugin | 7.28.6 | indirect |
| npm | @babel/helper-create-regexp-features-plugin | 7.28.5 | indirect |
| npm | @babel/helper-define-polyfill-provider | 0.6.7 | indirect |
| npm | @babel/helper-globals | 7.28.0 | indirect |
| npm | @babel/helper-member-expression-to-functions | 7.28.5 | indirect |
| npm | @babel/helper-module-imports | 7.28.6 | indirect |
| npm | @babel/helper-module-transforms | 7.28.6 | indirect |
| npm | @babel/helper-optimise-call-expression | 7.27.1 | indirect |
| npm | @babel/helper-plugin-utils | 7.28.6 | indirect |
| npm | @babel/helper-remap-async-to-generator | 7.27.1 | indirect |
| npm | @babel/helper-replace-supers | 7.28.6 | indirect |
| npm | @babel/helper-skip-transparent-expression-wrappers | 7.27.1 | indirect |
| npm | @babel/helper-string-parser | 7.27.1 | indirect |
| npm | @babel/helper-validator-identifier | 7.28.5 | indirect |
| npm | @babel/helper-validator-option | 7.27.1 | indirect |
| npm | @babel/helper-wrap-function | 7.28.6 | indirect |
| npm | @babel/helpers | 7.28.6 | indirect |
| npm | @babel/highlight | 7.25.9 | indirect |
| npm | @babel/parser | 7.29.0 | indirect |
| npm | @babel/plugin-bugfix-firefox-class-in-computed-class-key | 7.28.5 | indirect |
| npm | @babel/plugin-bugfix-safari-class-field-initializer-scope | 7.27.1 | indirect |
| npm | @babel/plugin-bugfix-safari-id-destructuring-collision-in-function-expression | 7.27.1 | indirect |
| npm | @babel/plugin-bugfix-v8-spread-parameters-in-optional-chaining | 7.27.1 | indirect |
| npm | @babel/plugin-bugfix-v8-static-class-fields-redefine-readonly | 7.28.6 | indirect |
| npm | @babel/plugin-proposal-class-properties | 7.18.6 | indirect |
| npm | @babel/plugin-proposal-decorators | 7.29.0 | indirect |
| npm | @babel/plugin-proposal-nullish-coalescing-operator | 7.18.6 | indirect |
| npm | @babel/plugin-proposal-optional-chaining | 7.21.0 | indirect |
| npm | @babel/plugin-proposal-private-property-in-object | 7.21.0-placeholder-for-preset-env.2 | indirect |
| npm | @babel/plugin-syntax-decorators | 7.28.6 | indirect |
| npm | @babel/plugin-syntax-dynamic-import | 7.8.3 | indirect |
| npm | @babel/plugin-syntax-flow | 7.28.6 | indirect |
| npm | @babel/plugin-syntax-import-assertions | 7.28.6 | indirect |
| npm | @babel/plugin-syntax-import-attributes | 7.28.6 | indirect |
| npm | @babel/plugin-syntax-jsx | 7.28.6 | indirect |
| npm | @babel/plugin-syntax-nullish-coalescing-operator | 7.8.3 | indirect |
| npm | @babel/plugin-syntax-optional-chaining | 7.8.3 | indirect |
| npm | @babel/plugin-syntax-typescript | 7.28.6 | indirect |
| npm | @babel/plugin-syntax-unicode-sets-regex | 7.18.6 | indirect |
| npm | @babel/plugin-transform-arrow-functions | 7.27.1 | indirect |
| npm | @babel/plugin-transform-async-generator-functions | 7.29.0 | indirect |
| npm | @babel/plugin-transform-async-to-generator | 7.28.6 | indirect |
| npm | @babel/plugin-transform-block-scoped-functions | 7.27.1 | indirect |
| npm | @babel/plugin-transform-block-scoping | 7.28.6 | indirect |
| npm | @babel/plugin-transform-class-properties | 7.28.6 | indirect |
| npm | @babel/plugin-transform-class-static-block | 7.28.6 | indirect |
| npm | @babel/plugin-transform-classes | 7.28.6 | indirect |
| npm | @babel/plugin-transform-computed-properties | 7.28.6 | indirect |
| npm | @babel/plugin-transform-destructuring | 7.28.5 | indirect |
| npm | @babel/plugin-transform-dotall-regex | 7.28.6 | indirect |
| npm | @babel/plugin-transform-duplicate-keys | 7.27.1 | indirect |
| npm | @babel/plugin-transform-duplicate-named-capturing-groups-regex | 7.29.0 | indirect |
| npm | @babel/plugin-transform-dynamic-import | 7.27.1 | indirect |
| npm | @babel/plugin-transform-explicit-resource-management | 7.28.6 | indirect |
| npm | @babel/plugin-transform-exponentiation-operator | 7.28.6 | indirect |
| npm | @babel/plugin-transform-export-namespace-from | 7.27.1 | indirect |
| npm | @babel/plugin-transform-flow-strip-types | 7.27.1 | indirect |
| npm | @babel/plugin-transform-for-of | 7.27.1 | indirect |
| npm | @babel/plugin-transform-function-name | 7.27.1 | indirect |
| npm | @babel/plugin-transform-json-strings | 7.28.6 | indirect |
| npm | @babel/plugin-transform-literals | 7.27.1 | indirect |
| npm | @babel/plugin-transform-logical-assignment-operators | 7.28.6 | indirect |
| npm | @babel/plugin-transform-member-expression-literals | 7.27.1 | indirect |
| npm | @babel/plugin-transform-modules-amd | 7.27.1 | indirect |
| npm | @babel/plugin-transform-modules-commonjs | 7.28.6 | indirect |
| npm | @babel/plugin-transform-modules-systemjs | 7.29.0 | indirect |
| npm | @babel/plugin-transform-modules-umd | 7.27.1 | indirect |
| npm | @babel/plugin-transform-named-capturing-groups-regex | 7.29.0 | indirect |
| npm | @babel/plugin-transform-new-target | 7.27.1 | indirect |
| npm | @babel/plugin-transform-nullish-coalescing-operator | 7.28.6 | indirect |
| npm | @babel/plugin-transform-numeric-separator | 7.28.6 | indirect |
| npm | @babel/plugin-transform-object-rest-spread | 7.28.6 | indirect |
| npm | @babel/plugin-transform-object-super | 7.27.1 | indirect |
| npm | @babel/plugin-transform-optional-catch-binding | 7.28.6 | indirect |
| npm | @babel/plugin-transform-optional-chaining | 7.28.6 | indirect |
| npm | @babel/plugin-transform-parameters | 7.27.7 | indirect |
| npm | @babel/plugin-transform-private-methods | 7.28.6 | indirect |
| npm | @babel/plugin-transform-private-property-in-object | 7.28.6 | indirect |
| npm | @babel/plugin-transform-property-literals | 7.27.1 | indirect |
| npm | @babel/plugin-transform-regenerator | 7.29.0 | indirect |
| npm | @babel/plugin-transform-regexp-modifiers | 7.28.6 | indirect |
| npm | @babel/plugin-transform-reserved-words | 7.27.1 | indirect |
| npm | @babel/plugin-transform-runtime | 7.29.0 | indirect |
| npm | @babel/plugin-transform-shorthand-properties | 7.27.1 | indirect |
| npm | @babel/plugin-transform-spread | 7.28.6 | indirect |
| npm | @babel/plugin-transform-sticky-regex | 7.27.1 | indirect |
| npm | @babel/plugin-transform-template-literals | 7.27.1 | indirect |
| npm | @babel/plugin-transform-typeof-symbol | 7.27.1 | indirect |
| npm | @babel/plugin-transform-typescript | 7.28.6 | indirect |
| npm | @babel/plugin-transform-unicode-escapes | 7.27.1 | indirect |
| npm | @babel/plugin-transform-unicode-property-regex | 7.28.6 | indirect |
| npm | @babel/plugin-transform-unicode-regex | 7.27.1 | indirect |
| npm | @babel/plugin-transform-unicode-sets-regex | 7.28.6 | indirect |
| npm | @babel/preset-env | 7.29.0 | indirect |
| npm | @babel/preset-flow | 7.27.1 | indirect |
| npm | @babel/preset-modules | 0.1.6-no-external-plugins | indirect |
| npm | @babel/preset-typescript | 7.28.5 | indirect |
| npm | @babel/register | 7.29.3 | indirect |
| npm | @babel/runtime | 7.28.6 | indirect |
| npm | @babel/template | 7.28.6 | indirect |
| npm | @babel/traverse | 7.29.0 | indirect |
| npm | @babel/types | 7.29.0 | indirect |
| npm | @colors/colors | 1.6.0 | indirect |
| npm | @ctrl/tinycolor | 4.2.0 | indirect |
| npm | @dabh/diagnostics | 2.0.8 | indirect |
| npm | @discoveryjs/json-ext | 0.5.7 | indirect |
| npm | @esbuild/darwin-arm64 | 0.25.12 | indirect |
| npm | @eslint-community/eslint-utils | 4.9.1 | indirect |
| npm | @eslint-community/regexpp | 4.12.2 | indirect |
| npm | @eslint/eslintrc | 0.4.3 | indirect |
| npm | @floating-ui/core | 1.7.5 | indirect |
| npm | @floating-ui/dom | 1.7.6 | indirect |
| npm | @floating-ui/utils | 0.2.11 | indirect |
| npm | @hapi/hoek | 9.3.0 | indirect |
| npm | @hapi/topo | 5.1.0 | indirect |
| npm | @humanwhocodes/config-array | 0.5.0 | indirect |
| npm | @humanwhocodes/object-schema | 1.2.1 | indirect |
| npm | @imengyu/vue-scroll-rect | 0.1.8 | indirect |
| npm | @jridgewell/gen-mapping | 0.3.13 | indirect |
| npm | @jridgewell/remapping | 2.3.5 | indirect |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirect |
| npm | @jridgewell/source-map | 0.3.11 | indirect |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirect |
| npm | @jridgewell/trace-mapping | 0.3.31 | indirect |
| npm | @jx3box/jx3box-build-common | 0.1.10 | indirect |
| npm | @jx3box/reporter | 0.0.5 | indirect |
| npm | @leichtgewicht/ip-codec | 2.0.5 | indirect |
| npm | @mdx-js/react | 3.1.1 | indirect |
| npm | @nicolo-ribaudo/eslint-scope-5-internals | 5.1.1-v1 | indirect |
| npm | @node-ipc/js-queue | 2.0.3 | indirect |
| npm | @nodelib/fs.scandir | 2.1.5 | indirect |
| npm | @nodelib/fs.stat | 2.0.5 | indirect |
| npm | @nodelib/fs.walk | 1.2.8 | indirect |
| npm | @parcel/watcher | 2.5.6 | indirect |
| npm | @parcel/watcher-darwin-arm64 | 2.5.6 | indirect |
| npm | @polka/url | 1.0.0-next.29 | indirect |
| npm | @sideway/address | 4.1.5 | indirect |
| npm | @sideway/formula | 3.0.1 | indirect |
| npm | @sideway/pinpoint | 2.0.0 | indirect |
| npm | @so-ric/colorspace | 1.1.6 | indirect |
| npm | @soda/friendly-errors-webpack-plugin | 1.8.1 | indirect |
| npm | @soda/get-current-script | 1.0.2 | indirect |
| npm | @storybook/addon-actions | 8.6.14 | indirect |
| npm | @storybook/addon-backgrounds | 8.6.14 | indirect |
| npm | @storybook/addon-controls | 8.6.14 | indirect |
| npm | @storybook/addon-docs | 8.6.14 | indirect |
| npm | @storybook/addon-essentials | 8.6.14 | indirect |
| npm | @storybook/addon-highlight | 8.6.14 | indirect |
| npm | @storybook/addon-interactions | 8.6.14 | indirect |
| npm | @storybook/addon-links | 8.6.18 | indirect |
| npm | @storybook/addon-measure | 8.6.14 | indirect |
| npm | @storybook/addon-outline | 8.6.14 | indirect |
| npm | @storybook/addon-toolbars | 8.6.14 | indirect |
| npm | @storybook/addon-viewport | 8.6.14 | indirect |
| npm | @storybook/blocks | 8.6.14 | indirect |
| npm | @storybook/builder-webpack5 | 8.6.14 | indirect |
| npm | @storybook/components | 8.6.14 | indirect |
| npm | @storybook/core | 8.6.18 | indirect |
| npm | @storybook/core-webpack | 8.6.14 | indirect |
| npm | @storybook/csf-plugin | 8.6.14 | indirect |
| npm | @storybook/global | 5.0.0 | indirect |
| npm | @storybook/icons | 1.6.0 | indirect |
| npm | @storybook/instrumenter | 8.6.14 | indirect |
| npm | @storybook/manager-api | 8.6.14 | indirect |
| npm | @storybook/preset-vue3-webpack | 8.6.14 | indirect |
| npm | @storybook/preview-api | 8.6.14 | indirect |
| npm | @storybook/react-dom-shim | 8.6.14 | indirect |
| npm | @storybook/test | 8.6.14 | indirect |
| npm | @storybook/theming | 8.6.14 | indirect |
| npm | @storybook/theming | 8.6.18 | indirect |
| npm | @storybook/vue3 | 8.6.14 | indirect |
| npm | @storybook/vue3-webpack5 | 8.6.14 | indirect |
| npm | @sxzz/popperjs-es | 2.11.8 | indirect |
| npm | @tailwindcss/node | 4.2.2 | indirect |
| npm | @tailwindcss/oxide | 4.2.2 | indirect |
| npm | @tailwindcss/oxide-darwin-arm64 | 4.2.2 | indirect |
| npm | @tailwindcss/postcss | 4.2.2 | indirect |
| npm | @testing-library/dom | 10.4.0 | indirect |
| npm | @testing-library/jest-dom | 6.5.0 | indirect |
| npm | @testing-library/user-event | 14.5.2 | indirect |
| npm | @types/aria-query | 5.0.4 | indirect |
| npm | @types/body-parser | 1.19.6 | indirect |
| npm | @types/bonjour | 3.5.13 | indirect |
| npm | @types/connect | 3.4.38 | indirect |
| npm | @types/connect-history-api-fallback | 1.5.4 | indirect |
| npm | @types/eslint | 8.56.12 | indirect |
| npm | @types/eslint-scope | 3.7.7 | indirect |
| npm | @types/estree | 1.0.8 | indirect |
| npm | @types/express | 4.17.25 | indirect |
| npm | @types/express-serve-static-core | 4.19.8 | indirect |
| npm | @types/express-serve-static-core | 5.1.1 | indirect |
| npm | @types/html-minifier-terser | 6.1.0 | indirect |
| npm | @types/http-errors | 2.0.5 | indirect |
| npm | @types/http-proxy | 1.17.17 | indirect |
| npm | @types/json-schema | 7.0.15 | indirect |
| npm | @types/lodash | 4.17.24 | indirect |
| npm | @types/lodash-es | 4.17.12 | indirect |
| npm | @types/mdx | 2.0.13 | indirect |
| npm | @types/mime | 1.3.5 | indirect |
| npm | @types/minimist | 1.2.5 | indirect |
| npm | @types/node | 25.4.0 | indirect |
| npm | @types/node-forge | 1.3.14 | indirect |
| npm | @types/normalize-package-data | 2.4.4 | indirect |
| npm | @types/parse-json | 4.0.2 | indirect |
| npm | @types/q | 1.5.8 | indirect |
| npm | @types/qs | 6.15.0 | indirect |
| npm | @types/range-parser | 1.2.7 | indirect |
| npm | @types/react | 19.2.14 | indirect |
| npm | @types/retry | 0.12.0 | indirect |
| npm | @types/semver | 7.7.1 | indirect |
| npm | @types/send | 0.17.6 | indirect |
| npm | @types/send | 1.2.1 | indirect |
| npm | @types/serve-index | 1.9.4 | indirect |
| npm | @types/serve-static | 1.15.10 | indirect |
| npm | @types/sockjs | 0.3.36 | indirect |
| npm | @types/triple-beam | 1.3.5 | indirect |
| npm | @types/uuid | 9.0.8 | indirect |
| npm | @types/web-bluetooth | 0.0.20 | indirect |
| npm | @types/webpack-env | 1.18.8 | indirect |
| npm | @types/ws | 8.18.1 | indirect |
| npm | @typescript-eslint/eslint-plugin | 5.62.0 | indirect |
| npm | @typescript-eslint/parser | 5.62.0 | indirect |
| npm | @typescript-eslint/scope-manager | 5.62.0 | indirect |
| npm | @typescript-eslint/type-utils | 5.62.0 | indirect |
| npm | @typescript-eslint/types | 5.62.0 | indirect |
| npm | @typescript-eslint/typescript-estree | 5.62.0 | indirect |
| npm | @typescript-eslint/utils | 5.62.0 | indirect |
| npm | @typescript-eslint/visitor-keys | 5.62.0 | indirect |
| npm | @vitest/expect | 2.0.5 | indirect |
| npm | @vitest/pretty-format | 2.0.5 | indirect |
| npm | @vitest/pretty-format | 2.1.9 | indirect |
| npm | @vitest/spy | 2.0.5 | indirect |
| npm | @vitest/utils | 2.0.5 | indirect |
| npm | @vitest/utils | 2.1.9 | indirect |
| npm | @vue-macros/common | 1.16.1 | indirect |
| npm | @vue/babel-helper-vue-jsx-merge-props | 1.4.0 | indirect |
| npm | @vue/babel-helper-vue-transform-on | 1.5.0 | indirect |
| npm | @vue/babel-plugin-jsx | 1.5.0 | indirect |
| npm | @vue/babel-plugin-resolve-type | 1.5.0 | indirect |
| npm | @vue/babel-plugin-transform-vue-jsx | 1.4.0 | indirect |
| npm | @vue/babel-preset-app | 5.0.9 | indirect |
| npm | @vue/babel-preset-jsx | 1.4.0 | indirect |
| npm | @vue/babel-sugar-composition-api-inject-h | 1.4.0 | indirect |
| npm | @vue/babel-sugar-composition-api-render-instance | 1.4.0 | indirect |
| npm | @vue/babel-sugar-functional-vue | 1.4.0 | indirect |
| npm | @vue/babel-sugar-inject-h | 1.4.0 | indirect |
| npm | @vue/babel-sugar-v-model | 1.4.0 | indirect |
| npm | @vue/babel-sugar-v-on | 1.4.0 | indirect |
| npm | @vue/cli-overlay | 5.0.9 | indirect |
| npm | @vue/cli-plugin-babel | 5.0.9 | indirect |
| npm | @vue/cli-plugin-eslint | 5.0.9 | indirect |
| npm | @vue/cli-plugin-router | 5.0.9 | indirect |
| npm | @vue/cli-plugin-typescript | 5.0.9 | indirect |
| npm | @vue/cli-plugin-vuex | 5.0.9 | indirect |
| npm | @vue/cli-service | 5.0.9 | indirect |
| npm | @vue/cli-shared-utils | 5.0.9 | indirect |
| npm | @vue/compiler-core | 3.5.30 | indirect |
| npm | @vue/compiler-dom | 3.5.30 | indirect |
| npm | @vue/compiler-sfc | 3.5.30 | indirect |
| npm | @vue/compiler-ssr | 3.5.30 | indirect |
| npm | @vue/component-compiler-utils | 3.3.0 | indirect |
| npm | @vue/eslint-config-typescript | 11.0.3 | indirect |
| npm | @vue/reactivity | 3.5.30 | indirect |
| npm | @vue/runtime-core | 3.5.30 | indirect |
| npm | @vue/runtime-dom | 3.5.30 | indirect |
| npm | @vue/server-renderer | 3.5.30 | indirect |
| npm | @vue/shared | 3.5.30 | indirect |
| npm | @vue/web-component-wrapper | 1.3.0 | indirect |
| npm | @vueuse/core | 12.0.0 | indirect |
| npm | @vueuse/metadata | 12.0.0 | indirect |
| npm | @vueuse/shared | 12.0.0 | indirect |
| npm | @webassemblyjs/ast | 1.14.1 | indirect |
| npm | @webassemblyjs/floating-point-hex-parser | 1.13.2 | indirect |
| npm | @webassemblyjs/helper-api-error | 1.13.2 | indirect |
| npm | @webassemblyjs/helper-buffer | 1.14.1 | indirect |
| npm | @webassemblyjs/helper-numbers | 1.13.2 | indirect |
| npm | @webassemblyjs/helper-wasm-bytecode | 1.13.2 | indirect |
| npm | @webassemblyjs/helper-wasm-section | 1.14.1 | indirect |
| npm | @webassemblyjs/ieee754 | 1.13.2 | indirect |
| npm | @webassemblyjs/leb128 | 1.13.2 | indirect |
| npm | @webassemblyjs/utf8 | 1.13.2 | indirect |
| npm | @webassemblyjs/wasm-edit | 1.14.1 | indirect |
| npm | @webassemblyjs/wasm-gen | 1.14.1 | indirect |
| npm | @webassemblyjs/wasm-opt | 1.14.1 | indirect |
| npm | @webassemblyjs/wasm-parser | 1.14.1 | indirect |
| npm | @webassemblyjs/wast-printer | 1.14.1 | indirect |
| npm | @xtuc/ieee754 | 1.2.0 | indirect |
| npm | @xtuc/long | 4.2.2 | indirect |
| npm | @zeit/schemas | 2.36.0 | indirect |
| npm | accepts | 1.3.8 | indirect |
| npm | acorn | 7.4.1 | indirect |
| npm | acorn | 8.16.0 | indirect |
| npm | acorn-import-phases | 1.0.4 | indirect |
| npm | acorn-jsx | 5.3.2 | indirect |
| npm | acorn-walk | 8.3.5 | indirect |
| npm | address | 1.2.2 | indirect |
| npm | ajv | 6.14.0 | indirect |
| npm | ajv | 8.18.0 | indirect |
| npm | ajv | 8.20.0 | indirect |
| npm | ajv-formats | 2.1.1 | indirect |
| npm | ajv-keywords | 3.5.2 | indirect |
| npm | ajv-keywords | 5.1.0 | indirect |
| npm | amdefine | 1.0.1 | indirect |
| npm | ansi-align | 3.0.1 | indirect |
| npm | ansi-colors | 4.1.3 | indirect |
| npm | ansi-escapes | 3.2.0 | indirect |
| npm | ansi-escapes | 5.0.0 | indirect |
| npm | ansi-html-community | 0.0.8 | indirect |
| npm | ansi-regex | 3.0.1 | indirect |
| npm | ansi-regex | 5.0.1 | indirect |
| npm | ansi-regex | 6.2.2 | indirect |
| npm | ansi-styles | 3.2.1 | indirect |
| npm | ansi-styles | 4.3.0 | indirect |
| npm | ansi-styles | 5.2.0 | indirect |
| npm | ansi-styles | 6.2.3 | indirect |
| npm | any-promise | 1.3.0 | indirect |
| npm | anymatch | 3.1.3 | indirect |
| npm | arch | 2.2.0 | indirect |
| npm | arg | 5.0.2 | indirect |
| npm | argparse | 1.0.10 | indirect |
| npm | aria-query | 5.3.0 | indirect |
| npm | arr-diff | 4.0.0 | indirect |
| npm | arr-flatten | 1.1.0 | indirect |
| npm | arr-union | 3.1.0 | indirect |
| npm | array-buffer-byte-length | 1.0.2 | indirect |
| npm | array-flatten | 1.1.1 | indirect |
| npm | array-union | 2.1.0 | indirect |
| npm | array-unique | 0.3.2 | indirect |
| npm | array.prototype.reduce | 1.0.8 | indirect |
| npm | arraybuffer.prototype.slice | 1.0.4 | indirect |
| npm | asap | 2.0.6 | indirect |
| npm | assert-never | 1.4.0 | indirect |
| npm | assertion-error | 2.0.1 | indirect |
| npm | assign-symbols | 1.0.0 | indirect |
| npm | ast-kit | 1.4.3 | indirect |
| npm | ast-types | 0.14.2 | indirect |
| npm | ast-types | 0.16.1 | indirect |
| npm | ast-walker-scope | 0.6.2 | indirect |
| npm | astral-regex | 2.0.0 | indirect |
| npm | async | 3.2.6 | indirect |
| npm | async-function | 1.0.0 | indirect |
| npm | async-validator | 4.2.5 | indirect |
| npm | asynckit | 0.4.0 | indirect |
| npm | at-least-node | 1.0.0 | indirect |
| npm | atob | 2.1.2 | indirect |
| npm | autoprefixer | 10.4.27 | indirect |
| npm | available-typed-arrays | 1.0.7 | indirect |
| npm | babel-core | 7.0.0-bridge.0 | indirect |
| npm | babel-loader | 8.4.1 | indirect |
| npm | babel-plugin-dynamic-import-node | 2.3.3 | indirect |
| npm | babel-plugin-polyfill-corejs2 | 0.4.16 | indirect |
| npm | babel-plugin-polyfill-corejs3 | 0.13.0 | indirect |
| npm | babel-plugin-polyfill-corejs3 | 0.14.1 | indirect |
| npm | babel-plugin-polyfill-regenerator | 0.6.7 | indirect |
| npm | babel-walk | 3.0.0-canary-5 | indirect |
| npm | balanced-match | 1.0.2 | indirect |
| npm | base | 0.11.2 | indirect |
| npm | base64-js | 1.5.1 | indirect |
| npm | baseline-browser-mapping | 2.10.0 | indirect |
| npm | batch | 0.6.1 | indirect |
| npm | better-opn | 3.0.2 | indirect |
| npm | big.js | 5.2.2 | indirect |
| npm | binary-extensions | 2.3.0 | indirect |
| npm | bl | 4.1.0 | indirect |
| npm | bluebird | 3.7.2 | indirect |
| npm | body-parser | 1.20.4 | indirect |
| npm | bonjour-service | 1.3.0 | indirect |
| npm | boolbase | 1.0.0 | indirect |
| npm | boxen | 7.0.0 | indirect |
| npm | brace-expansion | 1.1.12 | indirect |
| npm | braces | 2.3.2 | indirect |
| npm | braces | 3.0.3 | indirect |
| npm | browser-assert | 1.2.1 | indirect |
| npm | browserslist | 4.28.1 | indirect |
| npm | buffer | 5.7.1 | indirect |
| npm | buffer-from | 1.1.2 | indirect |
| npm | bytes | 3.0.0 | indirect |
| npm | bytes | 3.1.2 | indirect |
| npm | cache-base | 1.0.1 | indirect |
| npm | call-bind | 1.0.8 | indirect |
| npm | call-bind-apply-helpers | 1.0.2 | indirect |
| npm | call-bound | 1.0.4 | indirect |
| npm | callsites | 3.1.0 | indirect |
| npm | camel-case | 4.1.2 | indirect |
| npm | camelcase | 5.3.1 | indirect |
| npm | camelcase | 7.0.1 | indirect |
| npm | caniuse-api | 3.0.0 | indirect |
| npm | caniuse-lite | 1.0.30001777 | indirect |
| npm | case-sensitive-paths-webpack-plugin | 2.4.0 | indirect |
| npm | chai | 5.3.3 | indirect |
| npm | chalk | 2.4.2 | indirect |
| npm | chalk | 3.0.0 | indirect |
| npm | chalk | 4.1.2 | indirect |
| npm | chalk | 5.0.1 | indirect |
| npm | chalk | 5.3.0 | indirect |
| npm | chalk | 5.6.2 | indirect |
| npm | chalk-template | 0.4.0 | indirect |
| npm | character-parser | 2.2.0 | indirect |
| npm | check-error | 2.1.3 | indirect |
| npm | cheerio-select | 2.1.0 | indirect |
| npm | chokidar | 3.6.0 | indirect |
| npm | chokidar | 4.0.3 | indirect |
| npm | chrome-trace-event | 1.0.4 | indirect |
| npm | ci-info | 1.6.0 | indirect |
| npm | cjs-module-lexer | 1.4.3 | indirect |
| npm | class-utils | 0.3.6 | indirect |
| npm | clean-css | 5.3.3 | indirect |
| npm | cli-boxes | 3.0.0 | indirect |
| npm | cli-color | 2.0.4 | indirect |
| npm | cli-cursor | 2.1.0 | indirect |
| npm | cli-cursor | 3.1.0 | indirect |
| npm | cli-cursor | 4.0.0 | indirect |
| npm | cli-highlight | 2.1.11 | indirect |
| npm | cli-spinners | 2.9.2 | indirect |
| npm | cli-truncate | 3.1.0 | indirect |
| npm | clipboardy | 2.3.0 | indirect |
| npm | clipboardy | 3.0.0 | indirect |
| npm | cliui | 7.0.4 | indirect |
| npm | clone | 1.0.4 | indirect |
| npm | clone | 2.1.2 | indirect |
| npm | clone-deep | 4.0.1 | indirect |
| npm | coa | 2.0.2 | indirect |
| npm | collection-visit | 1.0.0 | indirect |
| npm | color | 5.0.3 | indirect |
| npm | color-convert | 1.9.3 | indirect |
| npm | color-convert | 2.0.1 | indirect |
| npm | color-convert | 3.1.3 | indirect |
| npm | color-name | 1.1.3 | indirect |
| npm | color-name | 1.1.4 | indirect |
| npm | color-name | 2.1.0 | indirect |
| npm | color-string | 2.1.4 | indirect |
| npm | colord | 2.9.3 | indirect |
| npm | colorette | 2.0.20 | indirect |
| npm | combined-stream | 1.0.8 | indirect |
| npm | commander | 11.0.0 | indirect |
| npm | commander | 2.20.3 | indirect |
| npm | commander | 7.2.0 | indirect |
| npm | commander | 8.3.0 | indirect |
| npm | commondir | 1.0.1 | indirect |
| npm | component-emitter | 1.3.1 | indirect |
| npm | compressible | 2.0.18 | indirect |
| npm | compression | 1.8.1 | indirect |
| npm | concat-map | 0.0.1 | indirect |
| npm | confbox | 0.1.8 | indirect |
| npm | confbox | 0.2.4 | indirect |
| npm | connect-history-api-fallback | 2.0.0 | indirect |
| npm | consolidate | 0.15.1 | indirect |
| npm | constantinople | 4.0.1 | indirect |
| npm | constants-browserify | 1.0.0 | indirect |
| npm | content-disposition | 0.5.2 | indirect |
| npm | content-disposition | 0.5.4 | indirect |
| npm | content-type | 1.0.5 | indirect |
| npm | convert-source-map | 2.0.0 | indirect |
| npm | cookie | 0.7.2 | indirect |
| npm | cookie-signature | 1.0.7 | indirect |
| npm | copy-anything | 2.0.6 | indirect |
| npm | copy-descriptor | 0.1.1 | indirect |
| npm | copy-webpack-plugin | 9.1.0 | indirect |
| npm | core-js | 3.48.0 | indirect |
| npm | core-js-compat | 3.48.0 | indirect |
| npm | core-util-is | 1.0.3 | indirect |
| npm | cosmiconfig | 6.0.0 | indirect |
| npm | cosmiconfig | 7.1.0 | indirect |
| npm | cross-spawn | 5.1.0 | indirect |
| npm | cross-spawn | 6.0.6 | indirect |
| npm | cross-spawn | 7.0.6 | indirect |
| npm | css-declaration-sorter | 6.4.1 | indirect |
| npm | css-loader | 6.11.0 | indirect |
| npm | css-minimizer-webpack-plugin | 3.4.1 | indirect |
| npm | css-select | 2.1.0 | indirect |
| npm | css-select | 4.3.0 | indirect |
| npm | css-select | 5.2.2 | indirect |
| npm | css-select-base-adapter | 0.1.1 | indirect |
| npm | css-tree | 1.0.0-alpha.37 | indirect |
| npm | css-tree | 1.1.3 | indirect |
| npm | css-what | 3.4.2 | indirect |
| npm | css-what | 6.2.2 | indirect |
| npm | css.escape | 1.5.1 | indirect |
| npm | cssesc | 3.0.0 | indirect |
| npm | cssfilter | 0.0.10 | indirect |
| npm | csslab | 6.0.1 | indirect |
| npm | cssnano | 5.1.15 | indirect |
| npm | cssnano-preset-default | 5.2.14 | indirect |
| npm | cssnano-utils | 3.1.0 | indirect |
| npm | csso | 4.2.0 | indirect |
| npm | csstype | 3.2.3 | indirect |
| npm | d | 1.0.2 | indirect |
| npm | data-view-buffer | 1.0.2 | indirect |
| npm | data-view-byte-length | 1.0.2 | indirect |
| npm | data-view-byte-offset | 1.0.1 | indirect |
| npm | debounce | 1.2.1 | indirect |
| npm | debug | 2.6.9 | indirect |
| npm | debug | 3.1.0 | indirect |
| npm | debug | 4.3.4 | indirect |
| npm | debug | 4.4.3 | indirect |
| npm | decode-uri-component | 0.2.2 | indirect |
| npm | deep-eql | 5.0.2 | indirect |
| npm | deep-extend | 0.6.0 | indirect |
| npm | deep-is | 0.1.4 | indirect |
| npm | deepmerge | 1.5.2 | indirect |
| npm | deepmerge | 4.3.1 | indirect |
| npm | default-gateway | 6.0.3 | indirect |
| npm | defaults | 1.0.4 | indirect |
| npm | define-data-property | 1.1.4 | indirect |
| npm | define-lazy-prop | 2.0.0 | indirect |
| npm | define-properties | 1.2.1 | indirect |
| npm | define-property | 0.2.5 | indirect |
| npm | define-property | 1.0.0 | indirect |
| npm | define-property | 2.0.2 | indirect |
| npm | delayed-stream | 1.0.0 | indirect |
| npm | depd | 1.1.2 | indirect |
| npm | depd | 2.0.0 | indirect |
| npm | dequal | 2.0.3 | indirect |
| npm | destroy | 1.2.0 | indirect |
| npm | detect-libc | 2.1.2 | indirect |
| npm | detect-node | 2.1.0 | indirect |
| npm | diff-match-patch | 1.0.5 | indirect |
| npm | dir-glob | 3.0.1 | indirect |
| npm | dns-packet | 5.6.1 | indirect |
| npm | doctrine | 3.0.0 | indirect |
| npm | doctypes | 1.1.0 | indirect |
| npm | dom-accessibility-api | 0.5.16 | indirect |
| npm | dom-accessibility-api | 0.6.3 | indirect |
| npm | dom-converter | 0.2.0 | indirect |
| npm | dom-serializer | 0.2.2 | indirect |
| npm | dom-serializer | 1.4.1 | indirect |
| npm | dom-serializer | 2.0.0 | indirect |
| npm | dom-walk | 0.1.2 | indirect |
| npm | domelementtype | 1.3.1 | indirect |
| npm | domelementtype | 2.3.0 | indirect |
| npm | domhandler | 4.3.1 | indirect |
| npm | domhandler | 5.0.3 | indirect |
| npm | domutils | 1.7.0 | indirect |
| npm | domutils | 2.8.0 | indirect |
| npm | domutils | 3.2.2 | indirect |
| npm | dot-case | 3.0.4 | indirect |
| npm | dotenv | 10.0.0 | indirect |
| npm | dotenv-expand | 5.1.0 | indirect |
| npm | dunder-proto | 1.0.1 | indirect |
| npm | duplexer | 0.1.2 | indirect |
| npm | eastasianwidth | 0.2.0 | indirect |
| npm | easy-stack | 1.0.1 | indirect |
| npm | ee-first | 1.1.1 | indirect |
| npm | electron-to-chromium | 1.5.307 | indirect |
| npm | emoji-regex | 8.0.0 | indirect |
| npm | emoji-regex | 9.2.2 | indirect |
| npm | emojis-list | 3.0.0 | indirect |
| npm | enabled | 2.0.0 | indirect |
| npm | encodeurl | 2.0.0 | indirect |
| npm | encoding-sniffer | 0.2.1 | indirect |
| npm | end-of-stream | 1.4.5 | indirect |
| npm | enhanced-resolve | 5.20.0 | indirect |
| npm | enquirer | 2.4.1 | indirect |
| npm | entities | 2.2.0 | indirect |
| npm | entities | 4.5.0 | indirect |
| npm | entities | 6.0.1 | indirect |
| npm | entities | 7.0.1 | indirect |
| npm | errno | 0.1.8 | indirect |
| npm | error-ex | 1.3.4 | indirect |
| npm | error-stack-parser | 2.1.4 | indirect |
| npm | es-abstract | 1.24.1 | indirect |
| npm | es-array-method-boxes-properly | 1.0.0 | indirect |
| npm | es-define-property | 1.0.1 | indirect |
| npm | es-errors | 1.3.0 | indirect |
| npm | es-module-lexer | 1.7.0 | indirect |
| npm | es-module-lexer | 2.0.0 | indirect |
| npm | es-object-atoms | 1.1.1 | indirect |
| npm | es-set-tostringtag | 2.1.0 | indirect |
| npm | es-to-primitive | 1.3.0 | indirect |
| npm | es5-ext | 0.10.64 | indirect |
| npm | es6-iterator | 2.0.3 | indirect |
| npm | es6-symbol | 3.1.4 | indirect |
| npm | es6-weak-map | 2.0.3 | indirect |
| npm | esbuild | 0.25.12 | indirect |
| npm | esbuild-register | 3.6.0 | indirect |
| npm | escalade | 3.2.0 | indirect |
| npm | escape-html | 1.0.3 | indirect |
| npm | escape-string-regexp | 1.0.5 | indirect |
| npm | escape-string-regexp | 4.0.0 | indirect |
| npm | eslint | 7.32.0 | indirect |
| npm | eslint-plugin-vue | 9.33.0 | indirect |
| npm | eslint-scope | 5.1.1 | indirect |
| npm | eslint-scope | 7.2.2 | indirect |
| npm | eslint-utils | 2.1.0 | indirect |
| npm | eslint-visitor-keys | 1.3.0 | indirect |
| npm | eslint-visitor-keys | 2.1.0 | indirect |
| npm | eslint-visitor-keys | 3.4.3 | indirect |
| npm | eslint-webpack-plugin | 3.2.0 | indirect |
| npm | esm-resolve | 1.0.11 | indirect |
| npm | esniff | 2.0.1 | indirect |
| npm | espree | 7.3.1 | indirect |
| npm | espree | 9.6.1 | indirect |
| npm | esprima | 4.0.1 | indirect |
| npm | esquery | 1.7.0 | indirect |
| npm | esrecurse | 4.3.0 | indirect |
| npm | estraverse | 4.3.0 | indirect |
| npm | estraverse | 5.3.0 | indirect |
| npm | estree-walker | 2.0.2 | indirect |
| npm | estree-walker | 3.0.3 | indirect |
| npm | esutils | 2.0.3 | indirect |
| npm | etag | 1.8.1 | indirect |
| npm | event-emitter | 0.3.5 | indirect |
| npm | event-pubsub | 4.3.0 | indirect |
| npm | eventemitter3 | 4.0.7 | indirect |
| npm | eventemitter3 | 5.0.4 | indirect |
| npm | events | 3.3.0 | indirect |
| npm | execa | 0.8.0 | indirect |
| npm | execa | 1.0.0 | indirect |
| npm | execa | 5.1.1 | indirect |
| npm | execa | 7.2.0 | indirect |
| npm | expand-brackets | 2.1.4 | indirect |
| npm | express | 4.22.1 | indirect |
| npm | exsolve | 1.0.8 | indirect |
| npm | ext | 1.7.0 | indirect |
| npm | extend | 3.0.2 | indirect |
| npm | extend-shallow | 2.0.1 | indirect |
| npm | extend-shallow | 3.0.2 | indirect |
| npm | extglob | 2.0.4 | indirect |
| npm | fast-deep-equal | 3.1.3 | indirect |
| npm | fast-glob | 3.3.3 | indirect |
| npm | fast-json-stable-stringify | 2.1.0 | indirect |
| npm | fast-levenshtein | 2.0.6 | indirect |
| npm | fast-uri | 3.1.0 | indirect |
| npm | fastq | 1.20.1 | indirect |
| npm | faye-websocket | 0.11.4 | indirect |
| npm | fecha | 4.2.3 | indirect |
| npm | figures | 2.0.0 | indirect |
| npm | file-entry-cache | 6.0.1 | indirect |
| npm | fill-range | 4.0.0 | indirect |
| npm | fill-range | 7.1.1 | indirect |
| npm | finalhandler | 1.3.2 | indirect |
| npm | find-cache-dir | 2.1.0 | indirect |
| npm | find-cache-dir | 3.3.2 | indirect |
| npm | find-up | 3.0.0 | indirect |
| npm | find-up | 4.1.0 | indirect |
| npm | fingerprintjs2 | 2.1.4 | indirect |
| npm | flat | 5.0.2 | indirect |
| npm | flat-cache | 3.2.0 | indirect |
| npm | flatted | 3.4.1 | indirect |
| npm | flow-parser | 0.312.0 | indirect |
| npm | fn.name | 1.1.0 | indirect |
| npm | follow-redirects | 1.15.11 | indirect |
| npm | follow-redirects | 1.5.10 | indirect |
| npm | for-each | 0.3.5 | indirect |
| npm | for-in | 1.0.2 | indirect |
| npm | fork-ts-checker-webpack-plugin | 6.5.3 | indirect |
| npm | fork-ts-checker-webpack-plugin | 8.0.0 | indirect |
| npm | form-data | 4.0.5 | indirect |
| npm | forwarded | 0.2.0 | indirect |
| npm | fraction.js | 5.3.4 | indirect |
| npm | fragment-cache | 0.2.1 | indirect |
| npm | fresh | 0.5.2 | indirect |
| npm | fs-extra | 10.1.0 | indirect |
| npm | fs-extra | 9.1.0 | indirect |
| npm | fs-monkey | 1.1.0 | indirect |
| npm | fs.realpath | 1.0.0 | indirect |
| npm | fsevents | 2.3.3 | indirect |
| npm | function-bind | 1.1.2 | indirect |
| npm | function.prototype.name | 1.1.8 | indirect |
| npm | functional-red-black-tree | 1.0.1 | indirect |
| npm | functions-have-names | 1.2.3 | indirect |
| npm | generator-function | 2.0.1 | indirect |
| npm | gensync | 1.0.0-beta.2 | indirect |
| npm | get-caller-file | 2.0.5 | indirect |
| npm | get-intrinsic | 1.3.0 | indirect |
| npm | get-proto | 1.0.1 | indirect |
| npm | get-stream | 3.0.0 | indirect |
| npm | get-stream | 4.1.0 | indirect |
| npm | get-stream | 6.0.1 | indirect |
| npm | get-symbol-description | 1.1.0 | indirect |
| npm | get-value | 2.0.6 | indirect |
| npm | glob | 7.2.3 | indirect |
| npm | glob-parent | 5.1.2 | indirect |
| npm | glob-parent | 6.0.2 | indirect |
| npm | glob-to-regexp | 0.4.1 | indirect |
| npm | global | 4.4.0 | indirect |
| npm | globals | 13.24.0 | indirect |
| npm | globalthis | 1.0.4 | indirect |
| npm | globby | 11.1.0 | indirect |
| npm | gopd | 1.2.0 | indirect |
| npm | graceful-fs | 4.2.11 | indirect |
| npm | graphemer | 1.4.0 | indirect |
| npm | gzip-size | 6.0.0 | indirect |
| npm | handle-thing | 2.0.1 | indirect |
| npm | has-bigints | 1.1.0 | indirect |
| npm | has-flag | 3.0.0 | indirect |
| npm | has-flag | 4.0.0 | indirect |
| npm | has-property-descriptors | 1.0.2 | indirect |
| npm | has-proto | 1.2.0 | indirect |
| npm | has-symbols | 1.1.0 | indirect |
| npm | has-tostringtag | 1.0.2 | indirect |
| npm | has-value | 0.3.1 | indirect |
| npm | has-value | 1.0.0 | indirect |
| npm | has-values | 0.1.4 | indirect |
| npm | has-values | 1.0.0 | indirect |
| npm | hash-sum | 1.0.2 | indirect |
| npm | hash-sum | 2.0.0 | indirect |
| npm | hasown | 2.0.2 | indirect |
| npm | he | 1.2.0 | indirect |
| npm | hosted-git-info | 2.8.9 | indirect |
| npm | hpack.js | 2.1.6 | indirect |
| npm | html-entities | 2.6.0 | indirect |
| npm | html-escaper | 2.0.2 | indirect |
| npm | html-minifier-terser | 6.1.0 | indirect |
| npm | html-tags | 2.0.0 | indirect |
| npm | html-webpack-plugin | 5.6.6 | indirect |
| npm | htmlparser2 | 10.1.0 | indirect |
| npm | htmlparser2 | 6.1.0 | indirect |
| npm | htmlparser2 | 8.0.2 | indirect |
| npm | http-deceiver | 1.2.7 | indirect |
| npm | http-errors | 1.8.1 | indirect |
| npm | http-errors | 2.0.1 | indirect |
| npm | http-parser-js | 0.5.10 | indirect |
| npm | http-proxy | 1.18.1 | indirect |
| npm | http-proxy-middleware | 2.0.9 | indirect |
| npm | human-signals | 2.1.0 | indirect |
| npm | human-signals | 4.3.1 | indirect |
| npm | husky | 8.0.3 | indirect |
| npm | iconv-lite | 0.4.24 | indirect |
| npm | iconv-lite | 0.6.3 | indirect |
| npm | icss-utils | 5.1.0 | indirect |
| npm | ieee754 | 1.2.1 | indirect |
| npm | ignore | 4.0.6 | indirect |
| npm | ignore | 5.3.2 | indirect |
| npm | image-size | 0.5.5 | indirect |
| npm | immediate | 3.0.6 | indirect |
| npm | immutable | 5.1.5 | indirect |
| npm | import-fresh | 3.3.1 | indirect |
| npm | imurmurhash | 0.1.4 | indirect |
| npm | indent-string | 4.0.0 | indirect |
| npm | inflight | 1.0.6 | indirect |
| npm | inherits | 2.0.4 | indirect |
| npm | ini | 1.3.8 | indirect |
| npm | ini | 3.0.1 | indirect |
| npm | internal-slot | 1.1.0 | indirect |
| npm | interpret | 1.4.0 | indirect |
| npm | ipaddr.js | 1.9.1 | indirect |
| npm | ipaddr.js | 2.3.0 | indirect |
| npm | is-accessor-descriptor | 1.0.1 | indirect |
| npm | is-arguments | 1.2.0 | indirect |
| npm | is-array-buffer | 3.0.5 | indirect |
| npm | is-arrayish | 0.2.1 | indirect |
| npm | is-async-function | 2.1.1 | indirect |
| npm | is-bigint | 1.1.0 | indirect |
| npm | is-binary-path | 2.1.0 | indirect |
| npm | is-boolean-object | 1.2.2 | indirect |
| npm | is-buffer | 1.1.6 | indirect |
| npm | is-callable | 1.2.7 | indirect |
| npm | is-ci | 1.2.1 | indirect |
| npm | is-core-module | 2.16.1 | indirect |
| npm | is-data-descriptor | 1.0.1 | indirect |
| npm | is-data-view | 1.0.2 | indirect |
| npm | is-date-object | 1.1.0 | indirect |
| npm | is-descriptor | 0.1.7 | indirect |
| npm | is-descriptor | 1.0.3 | indirect |
| npm | is-docker | 2.2.1 | indirect |
| npm | is-expression | 4.0.0 | indirect |
| npm | is-extendable | 0.1.1 | indirect |
| npm | is-extendable | 1.0.1 | indirect |
| npm | is-extglob | 2.1.1 | indirect |
| npm | is-file-esm | 1.0.0 | indirect |
| npm | is-finalizationregistry | 1.1.1 | indirect |
| npm | is-fullwidth-code-point | 2.0.0 | indirect |
| npm | is-fullwidth-code-point | 3.0.0 | indirect |
| npm | is-fullwidth-code-point | 4.0.0 | indirect |
| npm | is-generator-function | 1.1.2 | indirect |
| npm | is-glob | 4.0.3 | indirect |
| npm | is-interactive | 1.0.0 | indirect |
| npm | is-map | 2.0.3 | indirect |
| npm | is-negative-zero | 2.0.3 | indirect |
| npm | is-number | 3.0.0 | indirect |
| npm | is-number | 7.0.0 | indirect |
| npm | is-number-object | 1.1.1 | indirect |
| npm | is-plain-obj | 3.0.0 | indirect |
| npm | is-plain-object | 2.0.4 | indirect |
| npm | is-plain-object | 5.0.0 | indirect |
| npm | is-port-reachable | 4.0.0 | indirect |
| npm | is-promise | 2.2.2 | indirect |
| npm | is-regex | 1.2.1 | indirect |
| npm | is-set | 2.0.3 | indirect |
| npm | is-shared-array-buffer | 1.0.4 | indirect |
| npm | is-stream | 1.1.0 | indirect |
| npm | is-stream | 2.0.1 | indirect |
| npm | is-stream | 3.0.0 | indirect |
| npm | is-string | 1.1.1 | indirect |
| npm | is-symbol | 1.1.1 | indirect |
| npm | is-typed-array | 1.1.15 | indirect |
| npm | is-unicode-supported | 0.1.0 | indirect |
| npm | is-weakmap | 2.0.2 | indirect |
| npm | is-weakref | 1.1.1 | indirect |
| npm | is-weakset | 2.0.4 | indirect |
| npm | is-what | 3.14.1 | indirect |
| npm | is-windows | 1.0.2 | indirect |
| npm | is-wsl | 2.2.0 | indirect |
| npm | isarray | 1.0.0 | indirect |
| npm | isarray | 2.0.5 | indirect |
| npm | isexe | 2.0.0 | indirect |
| npm | isobject | 2.1.0 | indirect |
| npm | isobject | 3.0.1 | indirect |
| npm | javascript-stringify | 2.1.0 | indirect |
| npm | jest-worker | 27.5.1 | indirect |
| npm | jest-worker | 28.1.3 | indirect |
| npm | jiti | 2.6.1 | indirect |
| npm | joi | 17.13.3 | indirect |
| npm | js-message | 1.0.7 | indirect |
| npm | js-stringify | 1.0.2 | indirect |
| npm | js-tokens | 4.0.0 | indirect |
| npm | js-yaml | 3.14.2 | indirect |
| npm | jscodeshift | 0.13.1 | indirect |
| npm | jsdoc-type-pratt-parser | 4.8.0 | indirect |
| npm | jsesc | 3.1.0 | indirect |
| npm | json-buffer | 3.0.1 | indirect |
| npm | json-parse-better-errors | 1.0.2 | indirect |
| npm | json-parse-even-better-errors | 2.3.1 | indirect |
| npm | json-schema-traverse | 0.4.1 | indirect |
| npm | json-schema-traverse | 1.0.0 | indirect |
| npm | json-stable-stringify-without-jsonify | 1.0.1 | indirect |
| npm | json5 | 1.0.2 | indirect |
| npm | json5 | 2.2.3 | indirect |
| npm | jsonfile | 6.2.0 | indirect |
| npm | jstransformer | 1.0.0 | indirect |
| npm | keyv | 4.5.4 | indirect |
| npm | kind-of | 3.2.2 | indirect |
| npm | kind-of | 4.0.0 | indirect |
| npm | kind-of | 6.0.3 | indirect |
| npm | klona | 2.0.6 | indirect |
| npm | kuler | 2.0.0 | indirect |
| npm | launch-editor | 2.13.1 | indirect |
| npm | launch-editor-middleware | 2.13.1 | indirect |
| npm | less | 3.13.1 | indirect |
| npm | less | 4.5.1 | indirect |
| npm | less-loader | 11.1.4 | indirect |
| npm | less-watch-compiler | 1.17.5 | indirect |
| npm | levn | 0.4.1 | indirect |
| npm | lie | 3.1.1 | indirect |
| npm | lightningcss | 1.32.0 | indirect |
| npm | lightningcss-darwin-arm64 | 1.32.0 | indirect |
| npm | lilconfig | 2.1.0 | indirect |
| npm | lines-and-columns | 1.2.4 | indirect |
| npm | lint-staged | 13.3.0 | indirect |
| npm | listr2 | 6.6.1 | indirect |
| npm | loader-runner | 4.3.1 | indirect |
| npm | loader-utils | 1.4.2 | indirect |
| npm | loader-utils | 2.0.4 | indirect |
| npm | local-pkg | 1.1.2 | indirect |
| npm | localforage | 1.10.0 | indirect |
| npm | locate-path | 3.0.0 | indirect |
| npm | locate-path | 5.0.0 | indirect |
| npm | lodash-es | 4.17.23 | indirect |
| npm | lodash-unified | 1.0.3 | indirect |
| npm | lodash.debounce | 4.0.8 | indirect |
| npm | lodash.defaultsdeep | 4.6.1 | indirect |
| npm | lodash.kebabcase | 4.1.1 | indirect |
| npm | lodash.mapvalues | 4.6.0 | indirect |
| npm | lodash.memoize | 4.1.2 | indirect |
| npm | lodash.merge | 4.6.2 | indirect |
| npm | lodash.truncate | 4.4.2 | indirect |
| npm | lodash.uniq | 4.5.0 | indirect |
| npm | log-symbols | 4.1.0 | indirect |
| npm | log-update | 2.3.0 | indirect |
| npm | log-update | 5.0.1 | indirect |
| npm | logform | 2.7.0 | indirect |
| npm | loupe | 3.2.1 | indirect |
| npm | lower-case | 2.0.2 | indirect |
| npm | lru-cache | 4.1.5 | indirect |
| npm | lru-cache | 5.1.1 | indirect |
| npm | lru-cache | 6.0.0 | indirect |
| npm | lru-cache | 8.0.5 | indirect |
| npm | lru-queue | 0.1.0 | indirect |
| npm | luaparse | 0.3.1 | indirect |
| npm | luat2json | 0.0.2 | indirect |
| npm | lz-string | 1.5.0 | indirect |
| npm | magic-string | 0.30.21 | indirect |
| npm | magic-string-ast | 0.7.1 | indirect |
| npm | make-dir | 2.1.0 | indirect |
| npm | make-dir | 3.1.0 | indirect |
| npm | map-cache | 0.2.2 | indirect |
| npm | map-or-similar | 1.5.0 | indirect |
| npm | map-visit | 1.0.0 | indirect |
| npm | math-intrinsics | 1.1.0 | indirect |
| npm | mdn-data | 2.0.14 | indirect |
| npm | mdn-data | 2.0.4 | indirect |
| npm | media-typer | 0.3.0 | indirect |
| npm | memfs | 3.5.3 | indirect |
| npm | memoize-one | 6.0.0 | indirect |
| npm | memoizee | 0.4.17 | indirect |
| npm | memoizerific | 1.11.3 | indirect |
| npm | merge-descriptors | 1.0.3 | indirect |
| npm | merge-source-map | 1.1.0 | indirect |
| npm | merge-stream | 2.0.0 | indirect |
| npm | merge2 | 1.4.1 | indirect |
| npm | methods | 1.1.2 | indirect |
| npm | micromatch | 3.1.10 | indirect |
| npm | micromatch | 4.0.5 | indirect |
| npm | micromatch | 4.0.8 | indirect |
| npm | mime | 1.6.0 | indirect |
| npm | mime-db | 1.33.0 | indirect |
| npm | mime-db | 1.52.0 | indirect |
| npm | mime-db | 1.54.0 | indirect |
| npm | mime-types | 2.1.18 | indirect |
| npm | mime-types | 2.1.35 | indirect |
| npm | mimic-fn | 1.2.0 | indirect |
| npm | mimic-fn | 2.1.0 | indirect |
| npm | mimic-fn | 4.0.0 | indirect |
| npm | min-document | 2.19.2 | indirect |
| npm | min-indent | 1.0.1 | indirect |
| npm | mini-css-extract-plugin | 2.10.1 | indirect |
| npm | minimalistic-assert | 1.0.1 | indirect |
| npm | minimatch | 3.1.5 | indirect |
| npm | minimist | 1.2.8 | indirect |
| npm | minipass | 3.3.6 | indirect |
| npm | mixin-deep | 1.3.2 | indirect |
| npm | mkdirp | 0.5.6 | indirect |
| npm | mlly | 1.8.1 | indirect |
| npm | module-alias | 2.3.4 | indirect |
| npm | moment | 2.30.1 | indirect |
| npm | mrmime | 2.0.1 | indirect |
| npm | ms | 2.0.0 | indirect |
| npm | ms | 2.1.2 | indirect |
| npm | ms | 2.1.3 | indirect |
| npm | multicast-dns | 7.2.5 | indirect |
| npm | mz | 2.7.0 | indirect |
| npm | nanoid | 3.3.11 | indirect |
| npm | nanomatch | 1.2.13 | indirect |
| npm | native-request | 1.1.2 | indirect |
| npm | natural-compare | 1.4.0 | indirect |
| npm | natural-compare-lite | 1.4.0 | indirect |
| npm | needle | 3.3.1 | indirect |
| npm | negotiator | 0.6.3 | indirect |
| npm | negotiator | 0.6.4 | indirect |
| npm | neo-async | 2.6.2 | indirect |
| npm | next-tick | 1.1.0 | indirect |
| npm | nice-try | 1.0.5 | indirect |
| npm | no-case | 3.0.4 | indirect |
| npm | node-abort-controller | 3.1.1 | indirect |
| npm | node-addon-api | 7.1.1 | indirect |
| npm | node-dir | 0.1.17 | indirect |
| npm | node-fetch | 2.7.0 | indirect |
| npm | node-forge | 1.3.3 | indirect |
| npm | node-releases | 2.0.36 | indirect |
| npm | normalize-package-data | 2.5.0 | indirect |
| npm | normalize-path | 1.0.0 | indirect |
| npm | normalize-path | 3.0.0 | indirect |
| npm | normalize-url | 6.1.0 | indirect |
| npm | normalize-wheel-es | 1.2.0 | indirect |
| npm | npm-run-path | 2.0.2 | indirect |
| npm | npm-run-path | 4.0.1 | indirect |
| npm | npm-run-path | 5.3.0 | indirect |
| npm | nth-check | 1.0.2 | indirect |
| npm | nth-check | 2.1.1 | indirect |
| npm | object-assign | 4.1.1 | indirect |
| npm | object-copy | 0.1.0 | indirect |
| npm | object-inspect | 1.13.4 | indirect |
| npm | object-keys | 1.1.1 | indirect |
| npm | object-visit | 1.0.1 | indirect |
| npm | object.assign | 4.1.7 | indirect |
| npm | object.getownpropertydescriptors | 2.1.9 | indirect |
| npm | object.pick | 1.3.0 | indirect |
| npm | object.values | 1.2.1 | indirect |
| npm | obuf | 1.1.2 | indirect |
| npm | on-finished | 2.4.1 | indirect |
| npm | on-headers | 1.1.0 | indirect |
| npm | once | 1.4.0 | indirect |
| npm | one-time | 1.0.0 | indirect |
| npm | onetime | 2.0.1 | indirect |
| npm | onetime | 5.1.2 | indirect |
| npm | onetime | 6.0.0 | indirect |
| npm | open | 8.4.2 | indirect |
| npm | opener | 1.5.2 | indirect |
| npm | optionator | 0.9.4 | indirect |
| npm | ora | 5.4.1 | indirect |
| npm | own-keys | 1.0.1 | indirect |
| npm | p-finally | 1.0.0 | indirect |
| npm | p-limit | 2.3.0 | indirect |
| npm | p-locate | 3.0.0 | indirect |
| npm | p-locate | 4.1.0 | indirect |
| npm | p-retry | 4.6.2 | indirect |
| npm | p-try | 2.2.0 | indirect |
| npm | papaparse | 5.5.3 | indirect |
| npm | param-case | 3.0.4 | indirect |
| npm | parent-module | 1.0.1 | indirect |
| npm | parse-json | 5.2.0 | indirect |
| npm | parse-node-version | 1.0.1 | indirect |
| npm | parse-srcset | 1.0.2 | indirect |
| npm | parse5 | 5.1.1 | indirect |
| npm | parse5 | 6.0.1 | indirect |
| npm | parse5 | 7.3.0 | indirect |
| npm | parse5-htmlparser2-tree-adapter | 6.0.1 | indirect |
| npm | parse5-htmlparser2-tree-adapter | 7.1.0 | indirect |
| npm | parse5-parser-stream | 7.1.2 | indirect |
| npm | parseurl | 1.3.3 | indirect |
| npm | pascal-case | 3.1.2 | indirect |
| npm | pascalcase | 0.1.1 | indirect |
| npm | path-browserify | 1.0.1 | indirect |
| npm | path-exists | 3.0.0 | indirect |
| npm | path-exists | 4.0.0 | indirect |
| npm | path-is-absolute | 1.0.1 | indirect |
| npm | path-is-inside | 1.0.2 | indirect |
| npm | path-key | 2.0.1 | indirect |
| npm | path-key | 3.1.1 | indirect |
| npm | path-key | 4.0.0 | indirect |
| npm | path-parse | 1.0.7 | indirect |
| npm | path-to-regexp | 0.1.12 | indirect |
| npm | path-to-regexp | 3.3.0 | indirect |
| npm | path-type | 4.0.0 | indirect |
| npm | pathe | 2.0.3 | indirect |
| npm | pathval | 2.0.1 | indirect |
| npm | picocolors | 0.2.1 | indirect |
| npm | picocolors | 1.1.1 | indirect |
| npm | picomatch | 2.3.1 | indirect |
| npm | picomatch | 4.0.3 | indirect |
| npm | pidtree | 0.6.0 | indirect |
| npm | pify | 4.0.1 | indirect |
| npm | pirates | 4.0.7 | indirect |
| npm | pkg-dir | 3.0.0 | indirect |
| npm | pkg-dir | 4.2.0 | indirect |
| npm | pkg-types | 1.3.1 | indirect |
| npm | pkg-types | 2.3.0 | indirect |
| npm | polished | 4.3.1 | indirect |
| npm | portfinder | 1.0.38 | indirect |
| npm | posix-character-classes | 0.1.1 | indirect |
| npm | possible-typed-array-names | 1.1.0 | indirect |
| npm | postcss | 7.0.39 | indirect |
| npm | postcss | 8.5.8 | indirect |
| npm | postcss-calc | 8.2.4 | indirect |
| npm | postcss-colormin | 5.3.1 | indirect |
| npm | postcss-convert-values | 5.1.3 | indirect |
| npm | postcss-discard-comments | 5.1.2 | indirect |
| npm | postcss-discard-duplicates | 5.1.0 | indirect |
| npm | postcss-discard-empty | 5.1.1 | indirect |
| npm | postcss-discard-overridden | 5.1.0 | indirect |
| npm | postcss-loader | 6.2.1 | indirect |
| npm | postcss-merge-longhand | 5.1.7 | indirect |
| npm | postcss-merge-rules | 5.1.4 | indirect |
| npm | postcss-minify-font-values | 5.1.0 | indirect |
| npm | postcss-minify-gradients | 5.1.1 | indirect |
| npm | postcss-minify-params | 5.1.4 | indirect |
| npm | postcss-minify-selectors | 5.2.1 | indirect |
| npm | postcss-modules-extract-imports | 3.1.0 | indirect |
| npm | postcss-modules-local-by-default | 4.2.0 | indirect |
| npm | postcss-modules-scope | 3.2.1 | indirect |
| npm | postcss-modules-values | 4.0.0 | indirect |
| npm | postcss-normalize-charset | 5.1.0 | indirect |
| npm | postcss-normalize-display-values | 5.1.0 | indirect |
| npm | postcss-normalize-positions | 5.1.1 | indirect |
| npm | postcss-normalize-repeat-style | 5.1.1 | indirect |
| npm | postcss-normalize-string | 5.1.0 | indirect |
| npm | postcss-normalize-timing-functions | 5.1.0 | indirect |
| npm | postcss-normalize-unicode | 5.1.1 | indirect |
| npm | postcss-normalize-url | 5.1.0 | indirect |
| npm | postcss-normalize-whitespace | 5.1.1 | indirect |
| npm | postcss-ordered-values | 5.1.3 | indirect |
| npm | postcss-reduce-initial | 5.1.2 | indirect |
| npm | postcss-reduce-transforms | 5.1.0 | indirect |
| npm | postcss-safe-parser | 7.0.1 | indirect |
| npm | postcss-selector-parser | 6.1.2 | indirect |
| npm | postcss-selector-parser | 7.1.1 | indirect |
| npm | postcss-svgo | 5.1.0 | indirect |
| npm | postcss-unique-selectors | 5.1.1 | indirect |
| npm | postcss-value-parser | 4.2.0 | indirect |
| npm | prelude-ls | 1.2.1 | indirect |
| npm | prettier | 2.7.1 | indirect |
| npm | pretty-error | 4.0.0 | indirect |
| npm | pretty-format | 27.5.1 | indirect |
| npm | process | 0.11.10 | indirect |
| npm | process-nextick-args | 2.0.1 | indirect |
| npm | progress | 2.0.3 | indirect |
| npm | progress-webpack-plugin | 1.0.16 | indirect |
| npm | promise | 7.3.1 | indirect |
| npm | proxy-addr | 2.0.7 | indirect |
| npm | proxy-from-env | 1.1.0 | indirect |
| npm | prr | 1.0.1 | indirect |
| npm | pseudomap | 1.0.2 | indirect |
| npm | pug | 3.0.4 | indirect |
| npm | pug-attrs | 3.0.0 | indirect |
| npm | pug-code-gen | 3.0.4 | indirect |
| npm | pug-error | 2.1.0 | indirect |
| npm | pug-filters | 4.0.0 | indirect |
| npm | pug-lexer | 5.0.1 | indirect |
| npm | pug-linker | 4.0.0 | indirect |
| npm | pug-load | 3.0.0 | indirect |
| npm | pug-parser | 6.0.0 | indirect |
| npm | pug-runtime | 3.0.1 | indirect |
| npm | pug-strip-comments | 2.0.0 | indirect |
| npm | pug-walk | 2.0.0 | indirect |
| npm | pump | 3.0.4 | indirect |
| npm | punycode | 1.4.1 | indirect |
| npm | punycode | 2.3.1 | indirect |
| npm | q | 1.5.1 | indirect |
| npm | qrcode.vue | 3.9.0 | indirect |
| npm | qs | 6.14.2 | indirect |
| npm | qs | 6.15.0 | indirect |
| npm | quansync | 0.2.11 | indirect |
| npm | querystring | 0.2.1 | indirect |
| npm | queue-microtask | 1.2.3 | indirect |
| npm | randombytes | 2.1.0 | indirect |
| npm | range-parser | 1.2.0 | indirect |
| npm | range-parser | 1.2.1 | indirect |
| npm | raw-body | 2.5.3 | indirect |
| npm | rc | 1.2.8 | indirect |
| npm | react | 19.2.5 | indirect |
| npm | react-dom | 19.2.5 | indirect |
| npm | react-is | 17.0.2 | indirect |
| npm | read-pkg | 5.2.0 | indirect |
| npm | read-pkg-up | 7.0.1 | indirect |
| npm | readable-stream | 2.3.8 | indirect |
| npm | readable-stream | 3.6.2 | indirect |
| npm | readdirp | 3.6.0 | indirect |
| npm | readdirp | 4.1.2 | indirect |
| npm | recast | 0.20.5 | indirect |
| npm | recast | 0.23.11 | indirect |
| npm | rechoir | 0.6.2 | indirect |
| npm | redent | 3.0.0 | indirect |
| npm | reflect.getprototypeof | 1.0.10 | indirect |
| npm | regenerate | 1.4.2 | indirect |
| npm | regenerate-unicode-properties | 10.2.2 | indirect |
| npm | regex-not | 1.0.2 | indirect |
| npm | regexp.prototype.flags | 1.5.4 | indirect |
| npm | regexpp | 3.2.0 | indirect |
| npm | regexpu-core | 6.4.0 | indirect |
| npm | registry-auth-token | 3.3.2 | indirect |
| npm | registry-url | 3.1.0 | indirect |
| npm | regjsgen | 0.8.0 | indirect |
| npm | regjsparser | 0.13.0 | indirect |
| npm | relateurl | 0.2.7 | indirect |
| npm | renderkid | 3.0.0 | indirect |
| npm | repeat-element | 1.1.4 | indirect |
| npm | repeat-string | 1.6.1 | indirect |
| npm | require-directory | 2.1.1 | indirect |
| npm | require-from-string | 2.0.2 | indirect |
| npm | requires-port | 1.0.0 | indirect |
| npm | resolve | 1.22.11 | indirect |
| npm | resolve-from | 4.0.0 | indirect |
| npm | resolve-url | 0.2.1 | indirect |
| npm | restore-cursor | 2.0.0 | indirect |
| npm | restore-cursor | 3.1.0 | indirect |
| npm | restore-cursor | 4.0.0 | indirect |
| npm | ret | 0.1.15 | indirect |
| npm | retry | 0.13.1 | indirect |
| npm | reusify | 1.1.0 | indirect |
| npm | rfdc | 1.4.1 | indirect |
| npm | rimraf | 2.6.3 | indirect |
| npm | rimraf | 3.0.2 | indirect |
| npm | run-parallel | 1.2.0 | indirect |
| npm | safe-array-concat | 1.1.3 | indirect |
| npm | safe-buffer | 5.1.2 | indirect |
| npm | safe-buffer | 5.2.1 | indirect |
| npm | safe-push-apply | 1.0.0 | indirect |
| npm | safe-regex | 1.1.0 | indirect |
| npm | safe-regex-test | 1.1.0 | indirect |
| npm | safe-stable-stringify | 2.5.0 | indirect |
| npm | safer-buffer | 2.1.2 | indirect |
| npm | sass | 1.97.3 | indirect |
| npm | sass-loader | 16.0.7 | indirect |
| npm | sax | 1.2.4 | indirect |
| npm | sax | 1.5.0 | indirect |
| npm | scheduler | 0.27.0 | indirect |
| npm | schema-utils | 2.7.0 | indirect |
| npm | schema-utils | 2.7.1 | indirect |
| npm | schema-utils | 3.3.0 | indirect |
| npm | schema-utils | 4.3.3 | indirect |
| npm | select-hose | 2.0.0 | indirect |
| npm | selfsigned | 2.4.1 | indirect |
| npm | semver | 5.7.2 | indirect |
| npm | semver | 6.3.1 | indirect |
| npm | semver | 7.7.4 | indirect |
| npm | send | 0.19.2 | indirect |
| npm | serialize-javascript | 6.0.2 | indirect |
| npm | serve | 14.2.6 | indirect |
| npm | serve-handler | 6.1.7 | indirect |
| npm | serve-index | 1.9.2 | indirect |
| npm | serve-static | 1.16.3 | indirect |
| npm | set-function-length | 1.2.2 | indirect |
| npm | set-function-name | 2.0.2 | indirect |
| npm | set-proto | 1.0.0 | indirect |
| npm | set-value | 2.0.1 | indirect |
| npm | setprototypeof | 1.2.0 | indirect |
| npm | shallow-clone | 3.0.1 | indirect |
| npm | shebang-command | 1.2.0 | indirect |
| npm | shebang-command | 2.0.0 | indirect |
| npm | shebang-regex | 1.0.0 | indirect |
| npm | shebang-regex | 3.0.0 | indirect |
| npm | shell-quote | 1.8.3 | indirect |
| npm | shelljs | 0.8.5 | indirect |
| npm | side-channel | 1.1.0 | indirect |
| npm | side-channel-list | 1.0.0 | indirect |
| npm | side-channel-map | 1.0.1 | indirect |
| npm | side-channel-weakmap | 1.0.2 | indirect |
| npm | signal-exit | 3.0.7 | indirect |
| npm | sirv | 2.0.4 | indirect |
| npm | slash | 3.0.0 | indirect |
| npm | slice-ansi | 4.0.0 | indirect |
| npm | slice-ansi | 5.0.0 | indirect |
| npm | snapdragon | 0.8.2 | indirect |
| npm | snapdragon-node | 2.1.1 | indirect |
| npm | snapdragon-util | 3.0.1 | indirect |
| npm | sockjs | 0.3.24 | indirect |
| npm | source-map | 0.5.7 | indirect |
| npm | source-map | 0.6.1 | indirect |
| npm | source-map | 0.7.6 | indirect |
| npm | source-map-js | 1.2.1 | indirect |
| npm | source-map-resolve | 0.5.3 | indirect |
| npm | source-map-support | 0.5.21 | indirect |
| npm | source-map-url | 0.4.1 | indirect |
| npm | spdx-correct | 3.2.0 | indirect |
| npm | spdx-exceptions | 2.5.0 | indirect |
| npm | spdx-expression-parse | 3.0.1 | indirect |
| npm | spdx-license-ids | 3.0.23 | indirect |
| npm | spdy | 4.0.2 | indirect |
| npm | spdy-transport | 3.0.0 | indirect |
| npm | split-string | 3.1.0 | indirect |
| npm | sprintf-js | 1.0.3 | indirect |
| npm | ssri | 8.0.1 | indirect |
| npm | stable | 0.1.8 | indirect |
| npm | stack-trace | 0.0.10 | indirect |
| npm | stackframe | 1.3.4 | indirect |
| npm | static-extend | 0.1.2 | indirect |
| npm | statuses | 1.5.0 | indirect |
| npm | statuses | 2.0.2 | indirect |
| npm | stop-iteration-iterator | 1.1.0 | indirect |
| npm | storybook | 8.6.18 | indirect |
| npm | string-argv | 0.3.2 | indirect |
| npm | string-width | 2.1.1 | indirect |
| npm | string-width | 4.2.3 | indirect |
| npm | string-width | 5.1.2 | indirect |
| npm | string.prototype.trim | 1.2.10 | indirect |
| npm | string.prototype.trimend | 1.0.9 | indirect |
| npm | string.prototype.trimstart | 1.0.8 | indirect |
| npm | string_decoder | 1.1.1 | indirect |
| npm | string_decoder | 1.3.0 | indirect |
| npm | strip-ansi | 4.0.0 | indirect |
| npm | strip-ansi | 6.0.1 | indirect |
| npm | strip-ansi | 7.2.0 | indirect |
| npm | strip-eof | 1.0.0 | indirect |
| npm | strip-final-newline | 2.0.0 | indirect |
| npm | strip-final-newline | 3.0.0 | indirect |
| npm | strip-indent | 2.0.0 | indirect |
| npm | strip-indent | 3.0.0 | indirect |
| npm | strip-json-comments | 2.0.1 | indirect |
| npm | strip-json-comments | 3.1.1 | indirect |
| npm | style-loader | 3.3.4 | indirect |
| npm | style-resources-loader | 1.5.0 | indirect |
| npm | stylehacks | 5.1.1 | indirect |
| npm | supports-color | 5.5.0 | indirect |
| npm | supports-color | 7.2.0 | indirect |
| npm | supports-color | 8.1.1 | indirect |
| npm | supports-preserve-symlinks-flag | 1.0.0 | indirect |
| npm | svg-tags | 1.0.0 | indirect |
| npm | svgo | 1.3.2 | indirect |
| npm | svgo | 2.8.2 | indirect |
| npm | synchronous-promise | 2.0.17 | indirect |
| npm | table | 6.9.0 | indirect |
| npm | tailwindcss | 4.2.2 | indirect |
| npm | tapable | 1.1.3 | indirect |
| npm | tapable | 2.3.0 | indirect |
| npm | tapable | 2.3.3 | indirect |
| npm | temp | 0.8.4 | indirect |
| npm | terser | 5.46.0 | indirect |
| npm | terser-webpack-plugin | 5.4.0 | indirect |
| npm | text-hex | 1.0.0 | indirect |
| npm | text-table | 0.2.0 | indirect |
| npm | thenify | 3.3.1 | indirect |
| npm | thenify-all | 1.6.0 | indirect |
| npm | thread-loader | 3.0.4 | indirect |
| npm | thunky | 1.1.0 | indirect |
| npm | timers-ext | 0.1.8 | indirect |
| npm | tiny-invariant | 1.3.3 | indirect |
| npm | tinymce | 6.8.6 | indirect |
| npm | tinyrainbow | 1.2.0 | indirect |
| npm | tinyspy | 3.0.2 | indirect |
| npm | to-object-path | 0.3.0 | indirect |
| npm | to-regex | 3.0.2 | indirect |
| npm | to-regex-range | 2.1.1 | indirect |
| npm | to-regex-range | 5.0.1 | indirect |
| npm | toidentifier | 1.0.1 | indirect |
| npm | token-stream | 1.0.0 | indirect |
| npm | totalist | 3.0.1 | indirect |
| npm | tr46 | 0.0.3 | indirect |
| npm | triple-beam | 1.4.1 | indirect |
| npm | ts-dedent | 2.2.0 | indirect |
| npm | ts-loader | 9.5.4 | indirect |
| npm | ts-map | 1.0.3 | indirect |
| npm | tslib | 1.14.1 | indirect |
| npm | tslib | 2.8.1 | indirect |
| npm | tsutils | 3.21.0 | indirect |
| npm | type | 2.7.3 | indirect |
| npm | type-check | 0.4.0 | indirect |
| npm | type-fest | 0.20.2 | indirect |
| npm | type-fest | 0.6.0 | indirect |
| npm | type-fest | 0.8.1 | indirect |
| npm | type-fest | 1.4.0 | indirect |
| npm | type-fest | 2.19.0 | indirect |
| npm | type-is | 1.6.18 | indirect |
| npm | typed-array-buffer | 1.0.3 | indirect |
| npm | typed-array-byte-length | 1.0.3 | indirect |
| npm | typed-array-byte-offset | 1.0.4 | indirect |
| npm | typed-array-length | 1.0.7 | indirect |
| npm | typescript | 4.5.5 | indirect |
| npm | ufo | 1.6.3 | indirect |
| npm | unbox-primitive | 1.1.0 | indirect |
| npm | undici | 7.22.0 | indirect |
| npm | undici-types | 7.18.2 | indirect |
| npm | unicode-canonical-property-names-ecmascript | 2.0.1 | indirect |
| npm | unicode-match-property-ecmascript | 2.0.0 | indirect |
| npm | unicode-match-property-value-ecmascript | 2.2.1 | indirect |
| npm | unicode-property-aliases-ecmascript | 2.2.0 | indirect |
| npm | union-value | 1.0.1 | indirect |
| npm | universalify | 2.0.1 | indirect |
| npm | unpipe | 1.0.0 | indirect |
| npm | unplugin | 1.16.1 | indirect |
| npm | unplugin-vue-define-options | 1.5.5 | indirect |
| npm | unquote | 1.1.1 | indirect |
| npm | unset-value | 1.0.0 | indirect |
| npm | update-browserslist-db | 1.2.3 | indirect |
| npm | update-check | 1.5.4 | indirect |
| npm | uri-js | 4.4.1 | indirect |
| npm | urix | 0.1.0 | indirect |
| npm | url | 0.11.4 | indirect |
| npm | use | 3.1.1 | indirect |
| npm | util | 0.12.5 | indirect |
| npm | util-deprecate | 1.0.2 | indirect |
| npm | util.promisify | 1.0.1 | indirect |
| npm | utila | 0.4.0 | indirect |
| npm | utils-merge | 1.0.1 | indirect |
| npm | v8-compile-cache | 2.4.0 | indirect |
| npm | validate-npm-package-license | 3.0.4 | indirect |
| npm | vary | 1.1.2 | indirect |
| npm | void-elements | 3.1.0 | indirect |
| npm | vue-component-type-helpers | 3.2.8 | indirect |
| npm | vue-docgen-api | 4.79.2 | indirect |
| npm | vue-docgen-loader | 1.5.1 | indirect |
| npm | vue-eslint-parser | 9.4.3 | indirect |
| npm | vue-hot-reload-api | 2.3.4 | indirect |
| npm | vue-inbrowser-compiler-independent-utils | 4.71.1 | indirect |
| npm | vue-loader | 15.11.1 | indirect |
| npm | vue-loader | 16.8.3 | indirect |
| npm | vue-loader | 17.4.2 | indirect |
| npm | vue-style-loader | 4.1.3 | indirect |
| npm | vue-svg-inline-loader | 2.1.5 | indirect |
| npm | vue-template-es2015-compiler | 1.9.1 | indirect |
| npm | watchpack | 2.5.1 | indirect |
| npm | wbuf | 1.7.3 | indirect |
| npm | wcwidth | 1.0.1 | indirect |
| npm | webidl-conversions | 3.0.1 | indirect |
| npm | webpack | 5.105.4 | indirect |
| npm | webpack-bundle-analyzer | 4.10.2 | indirect |
| npm | webpack-chain | 6.5.1 | indirect |
| npm | webpack-dev-middleware | 5.3.4 | indirect |
| npm | webpack-dev-middleware | 6.1.3 | indirect |
| npm | webpack-dev-server | 4.15.2 | indirect |
| npm | webpack-hot-middleware | 2.26.1 | indirect |
| npm | webpack-merge | 5.10.0 | indirect |
| npm | webpack-sources | 3.3.4 | indirect |
| npm | webpack-virtual-modules | 0.4.6 | indirect |
| npm | webpack-virtual-modules | 0.6.2 | indirect |
| npm | websocket-driver | 0.7.4 | indirect |
| npm | websocket-extensions | 0.1.4 | indirect |
| npm | whatwg-encoding | 3.1.1 | indirect |
| npm | whatwg-fetch | 3.6.20 | indirect |
| npm | whatwg-mimetype | 4.0.0 | indirect |
| npm | whatwg-url | 5.0.0 | indirect |
| npm | which | 1.3.1 | indirect |
| npm | which | 2.0.2 | indirect |
| npm | which-boxed-primitive | 1.1.1 | indirect |
| npm | which-builtin-type | 1.2.1 | indirect |
| npm | which-collection | 1.0.2 | indirect |
| npm | which-typed-array | 1.1.20 | indirect |
| npm | widest-line | 4.0.1 | indirect |
| npm | wildcard | 2.0.1 | indirect |
| npm | winston | 3.19.0 | indirect |
| npm | winston-transport | 4.9.0 | indirect |
| npm | with | 7.0.2 | indirect |
| npm | word-wrap | 1.2.5 | indirect |
| npm | wrap-ansi | 3.0.1 | indirect |
| npm | wrap-ansi | 7.0.0 | indirect |
| npm | wrap-ansi | 8.1.0 | indirect |
| npm | wrappy | 1.0.2 | indirect |
| npm | write-file-atomic | 2.4.3 | indirect |
| npm | ws | 7.5.10 | indirect |
| npm | ws | 8.19.0 | indirect |
| npm | ws | 8.20.0 | indirect |
| npm | xml-name-validator | 4.0.0 | indirect |
| npm | y18n | 5.0.8 | indirect |
| npm | yallist | 2.1.2 | indirect |
| npm | yallist | 3.1.1 | indirect |
| npm | yallist | 4.0.0 | indirect |
| npm | yaml | 1.10.2 | indirect |
| npm | yaml | 2.3.1 | indirect |
| npm | yargs | 16.2.0 | indirect |
| npm | yargs-parser | 20.2.9 | indirect |
| npm | yorkie | 2.0.0 | indirect |
Dependency advisories 4
Installing npm:@jx3box/jx3box-editor@3.2.13 pulls in 200 packages, direct and transitive: 4 carry known advisories, of which 2 are direct dependencies.
| Package | Version | Relation | Severity | Advisories | Fixed in |
|---|---|---|---|---|---|
| axios | 0.19.2 | direct | high | 25 | 1.18.0 |
| uuid | 9.0.1 | direct | high | 1 | 13.0.1 |
| follow-redirects | 1.5.10 | indirect | high | 5 | 1.16.0 |
| tinymce | 6.8.6 | indirect | high | 5 | 8.5.1 |
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Raw JSON report machine-readable
Feedback
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm, Packagist.