Optimized package overrides for Socket Optimize
SocketDev/socket-registry holds a health index of 84 out of 100, placing it in the Excellent band. It scores highest on Vitality (88/100) and lowest on Community & Adoption (62/100). It was last updated today. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 71 is calibrated to 84 on the published index scale (record calibration 2026-08-02).
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | @socketsecurity/registry | 2.0.5 | 44,962 | 335 | 31 days ago | socket.devnpmpackagesregistrysecurity |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 0 days ago |
| 22.8/36 | Commit cadence — 33/52 weeks with commits |
| 18/18 | Commit volume — 2,031 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 11 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 2,031 |
| human_commit_share | 1 |
| days_since_last_push | 0 |
| active_weeks_last_year | 33 |
| 27/27 | Ships releases — 3 releases published |
| 36/36 | Release recency — latest release 31 days ago |
| 27/27 | Release cadence — a release every ~1.6 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 3 |
| latest_release_tag | v2.0.5 |
| releases_from_tags | no |
| days_since_latest_release | 31 |
| mean_days_between_releases | 1.6 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 26.5/60 | Stars — 44 stars |
| 0/25 | Forks — 2 forks |
| 4.3/15 | Watchers — 7 watchers |
| forks | 2 |
| stars | 44 |
| watchers | 7 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 18/18 | CONTRIBUTING guide |
| 13.5/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | 3 |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | yes |
| readme_badge_services | github.com, shields.io |
| has_pull_request_template | no |
| 62/80 | Monthly downloads — 44,962 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | @socketsecurity/registry |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 44,962 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0/22.5 | Commit distribution — top contributor authored 100% of commits |
| 8.1/13.5 | Contributor breadth — 6 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 10 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 6 |
| top_contributor_share | 0.998 |
| 39.6/42 | Issue resolution — 94% of issues closed |
| 20.8/30 | PR acceptance — 201/290 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 201 |
| open_issues | 1 |
| closed_issues | 17 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 0 |
| prs_decided_30d | 3 |
| issue_closed_ratio | 0.944 |
| closed_unmerged_prs | 89 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
| 30/30 | Ownership backing — organization-owned |
| 20/20 | Verified domain |
| 21/25 | Owner reach — 822 followers of SocketDev |
| 24.7/25 | Track record — 55 public repos, account ~6 yr old |
| followers | 822 |
| owner_type | Organization |
| is_verified | yes |
| owner_login | SocketDev |
| public_repos | 55 |
| account_age_days | 2,212 |
| 25/25 | Published & resolvable — 1 package(s) on npm |
| 35/35 | Publish recency — latest publish 31 days ago |
| 20/20 | Version history — 335 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | @socketsecurity/registry |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 31 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 11 workflow(s) |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 25/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://Socket.dev |
| 10/10 | Repository description |
| 0/10 | Topics |
| 0/10 | Wiki |
| topics | — |
| has_wiki | no |
| homepage | https://Socket.dev |
| docs_site | https://Socket.dev |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 2.2/7.5 | Branch-Protection — branch protection is not maximal on development and all release branches |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 10 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 11 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — no data |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 15 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 3 |
| scorecard_aggregate | 5.6 |
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 0/25 | Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
| source | osv |
| advisories | 6 |
| affected_packages | 3 |
| assessed_packages | 298 |
| unassessed_packages | 0 |
| affected_by_severity | critical 1, moderate 2 |
| direct_affected_packages | 0 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 45/45 | Agent instructions — CLAUDE.md |
| 0/15 | Machine-readable docs (llms.txt) |
| 40/40 | Legible commit history — 100 of 100 human commits state their intent (structured subject or explanatory body) |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 1 |
| agent_instruction_files | CLAUDE.md |
| agent_instruction_max_bytes | 32,334 |
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — registry/tsconfig.json, tsconfig.json |
| 10/10 | Reproducible environment — lockfile |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 5/8 | Automated maintenance — dependency automation configured, none observed in the sampled commits |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — no data |
| has_nix | no |
| has_tests | yes |
| lockfiles | pnpm-lock.yaml |
| has_dockerfile | no |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | registry/tsconfig.json, tsconfig.json |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 45/45 | Type-checkable code — TypeScript (statically typed) |
| 55/55 | Manageable file sizes — 1/1,173 source files over 60KB |
| primary_language | TypeScript |
| largest_source_bytes | 124,291 |
| source_files_sampled | 1,173 |
| oversized_source_files | 1 |
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 3 | Branch-Protection | branch protection is not maximal on development and all release branches |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 10 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 11 issue activity found in the last 90 days -- score normalized to 10 |
| n/a | Packaging | packaging workflow not detected |
| n/a | Pinned-Dependencies | no dependencies found |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Full resolved dependency set from the GitHub dependency graph: 0 direct and 298 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | @pnpm/exe | 11.9.0 | indirect |
| npm | @pnpm/linux-arm64 | 11.9.0 | indirect |
| npm | @pnpm/linux-x64 | 11.9.0 | indirect |
| npm | @pnpm/linuxstatic-arm64 | 11.9.0 | indirect |
| npm | @pnpm/linuxstatic-x64 | 11.9.0 | indirect |
| npm | @pnpm/macos-arm64 | 11.9.0 | indirect |
| npm | @pnpm/win-arm64 | 11.9.0 | indirect |
| npm | @pnpm/win-x64 | 11.9.0 | indirect |
| npm | @reflink/reflink | 0.1.19 | indirect |
| npm | @reflink/reflink-darwin-arm64 | 0.1.19 | indirect |
| npm | @reflink/reflink-darwin-x64 | 0.1.19 | indirect |
| npm | @reflink/reflink-linux-arm64-gnu | 0.1.19 | indirect |
| npm | @reflink/reflink-linux-arm64-musl | 0.1.19 | indirect |
| npm | @reflink/reflink-linux-x64-gnu | 0.1.19 | indirect |
| npm | @reflink/reflink-linux-x64-musl | 0.1.19 | indirect |
| npm | @reflink/reflink-win32-arm64-msvc | 0.1.19 | indirect |
| npm | @reflink/reflink-win32-x64-msvc | 0.1.19 | indirect |
| npm | @socketsecurity/lib | catalog: | indirect |
| npm | @socketsecurity/registry | catalog: | indirect |
| npm | @types/node | catalog: | indirect |
| npm | array-buffer-byte-length | 1.0.2 | indirect |
| npm | array-includes | 3.1.9 | indirect |
| npm | array.from | 1.1.6 | indirect |
| npm | array.of | 1.0.4 | indirect |
| npm | array.prototype.at | 1.1.3 | indirect |
| npm | array.prototype.every | 1.1.7 | indirect |
| npm | array.prototype.filter | 1.0.4 | indirect |
| npm | array.prototype.find | 2.2.3 | indirect |
| npm | array.prototype.findlast | 1.2.5 | indirect |
| npm | array.prototype.findlastindex | 1.2.6 | indirect |
| npm | array.prototype.flat | 1.3.3 | indirect |
| npm | array.prototype.flatmap | 1.3.3 | indirect |
| npm | array.prototype.foreach | 1.0.7 | indirect |
| npm | array.prototype.map | 1.0.8 | indirect |
| npm | array.prototype.reduce | 1.0.8 | indirect |
| npm | array.prototype.toreversed | 1.1.2 | indirect |
| npm | array.prototype.tosorted | 1.1.4 | indirect |
| npm | arraybuffer.prototype.slice | 1.0.4 | indirect |
| npm | asynciterator.prototype | 1.0.0 | indirect |
| npm | available-typed-arrays | 1.0.7 | indirect |
| npm | data-view-buffer | 1.0.2 | indirect |
| npm | data-view-byte-length | 1.0.2 | indirect |
| npm | data-view-byte-offset | 1.0.1 | indirect |
| npm | date | 2.0.6 | indirect |
| npm | del-cli | catalog: | indirect |
| npm | detect-libc | 2.1.2 | indirect |
| npm | es-aggregate-error | 1.0.14 | indirect |
| npm | es-define-property | 1.0.1 | indirect |
| npm | es-get-iterator | 1.1.3 | indirect |
| npm | es-iterator-helpers | 1.2.1 | indirect |
| npm | es-set-tostringtag | 2.1.0 | indirect |
| npm | es-to-primitive | 1.3.4 | indirect |
| npm | fast-glob | catalog: | indirect |
| npm | fast-json-stable-stringify | 2.1.0 | indirect |
| npm | for-each | 0.3.5 | indirect |
| npm | fs-extra | catalog: | indirect |
| npm | function-bind | 1.1.2 | indirect |
| npm | function.prototype.name | 1.2.0 | indirect |
| npm | functions-have-names | 1.2.3 | indirect |
| npm | get-symbol-description | 1.1.0 | indirect |
| npm | globalthis | 1.0.4 | indirect |
| npm | gopd | 1.2.0 | indirect |
| npm | has | 1.0.4 | indirect |
| npm | has-property-descriptors | 1.0.2 | indirect |
| npm | has-proto | 1.2.0 | indirect |
| npm | has-symbols | 1.1.0 | indirect |
| npm | has-tostringtag | 1.0.2 | indirect |
| npm | internal-slot | 1.1.0 | indirect |
| npm | is-arguments | 1.2.0 | indirect |
| npm | is-array-buffer | 3.0.5 | indirect |
| npm | is-async-function | 2.1.1 | indirect |
| npm | is-bigint | 1.1.0 | indirect |
| npm | is-core-module | 2.16.2 | indirect |
| npm | is-data-view | 1.0.2 | indirect |
| npm | is-generator-function | 1.1.2 | indirect |
| npm | is-map | 2.0.3 | indirect |
| npm | is-nan | 1.3.2 | indirect |
| npm | is-negative-zero | 2.0.3 | indirect |
| npm | is-regex | 1.2.1 | indirect |
| npm | is-set | 2.0.3 | indirect |
| npm | is-shared-array-buffer | 1.0.4 | indirect |
| npm | is-symbol | 1.1.1 | indirect |
| npm | is-typed-array | 1.1.15 | indirect |
| npm | is-weakmap | 2.0.2 | indirect |
| npm | is-weakref | 1.1.1 | indirect |
| npm | is-weakset | 2.0.4 | indirect |
| npm | iterator.prototype | 1.1.5 | indirect |
| npm | json-stable-stringify | 1.3.0 | indirect |
| npm | jsonify | 0.0.1 | indirect |
| npm | object-is | 1.1.6 | indirect |
| npm | object.assign | 4.1.7 | indirect |
| npm | object.entries | 1.1.9 | indirect |
| npm | object.fromentries | 2.0.8 | indirect |
| npm | object.getownpropertydescriptors | 2.1.9 | indirect |
| npm | object.getprototypeof | 1.0.7 | indirect |
| npm | object.groupby | 1.0.3 | indirect |
| npm | object.hasown | 1.1.4 | indirect |
| npm | object.values | 1.2.1 | indirect |
| npm | own-keys | 1.0.2 | indirect |
| npm | pnpm | 11.9.0 | indirect |
| npm | promise.allsettled | 1.0.7 | indirect |
| npm | promise.any | 2.0.6 | indirect |
| npm | reflect.getprototypeof | 1.0.10 | indirect |
| npm | reflect.ownkeys | 1.1.6 | indirect |
| npm | regexp.prototype.flags | 1.5.4 | indirect |
| npm | rolldown | catalog: | indirect |
| npm | safe-array-concat | 1.1.4 | indirect |
| npm | safe-regex-test | 1.1.0 | indirect |
| npm | side-channel | 1.1.1 | indirect |
| npm | stop-iteration-iterator | 1.1.0 | indirect |
| npm | string.fromcodepoint | 1.0.3 | indirect |
| npm | string.prototype.at | 1.0.6 | indirect |
| npm | string.prototype.codepointat | 1.0.1 | indirect |
| npm | string.prototype.endswith | 1.0.2 | indirect |
| npm | string.prototype.includes | 2.0.1 | indirect |
| npm | string.prototype.matchall | 4.0.12 | indirect |
| npm | string.prototype.padend | 3.1.6 | indirect |
| npm | string.prototype.padstart | 3.1.7 | indirect |
| npm | string.prototype.repeat | 1.0.0 | indirect |
| npm | string.prototype.replaceall | 1.0.11 | indirect |
| npm | string.prototype.split | 1.0.9 | indirect |
| npm | string.prototype.startswith | 1.0.1 | indirect |
| npm | string.prototype.trim | 1.2.11 | indirect |
| npm | string.prototype.trimend | 1.0.10 | indirect |
| npm | string.prototype.trimleft | 2.1.3 | indirect |
| npm | string.prototype.trimright | 2.1.3 | indirect |
| npm | string.prototype.trimstart | 1.0.8 | indirect |
| npm | tinybench | 5.0.1 | indirect |
| npm | typed-array-buffer | 1.0.3 | indirect |
| npm | typed-array-byte-length | 1.0.3 | indirect |
| npm | typed-array-byte-offset | 1.0.4 | indirect |
| npm | typed-array-length | 1.0.8 | indirect |
| npm | typedarray | 0.0.7 | indirect |
| npm | typedarray.prototype.slice | 1.0.5 | indirect |
| npm | typescript | catalog: | indirect |
| npm | unbox-primitive | 1.1.0 | indirect |
| npm | util.promisify | 1.1.3 | indirect |
| npm | vitest | catalog: | indirect |
| npm | which-boxed-primitive | 1.1.1 | indirect |
| npm | which-collection | 1.0.2 | indirect |
| npm | which-typed-array | 1.1.22 | indirect |
| npm | yoctocolors-cjs | catalog: | indirect |
| PyPI | aiohappyeyeballs | 2.6.2 | indirect |
| PyPI | aiohttp | 3.14.3 | indirect |
| PyPI | aiosignal | 1.4.0 | indirect |
| PyPI | annotated-doc | 0.0.4 | indirect |
| PyPI | annotated-types | 0.7.0 | indirect |
| PyPI | anyio | 4.13.0 | indirect |
| PyPI | ast-grep-cli | 0.42.3 | indirect |
| PyPI | async-timeout | 5.0.1 | indirect |
| PyPI | attrs | 26.1.0 | indirect |
| PyPI | blockbuster | 1.5.26 | indirect |
| PyPI | certifi | 2026.4.22 | indirect |
| PyPI | certifi | 2026.5.20 | indirect |
| PyPI | cffi | 2.0.0 | indirect |
| PyPI | charset-normalizer | 3.4.7 | indirect |
| PyPI | click | 8.4.0 | indirect |
| PyPI | click | 8.4.1 | indirect |
| PyPI | cloudpickle | 3.1.2 | indirect |
| PyPI | colorama | 0.4.6 | indirect |
| PyPI | coloredlogs | 15.0.1 | indirect |
| PyPI | croniter | 6.2.2 | indirect |
| PyPI | cryptography | 50.0.0 | indirect |
| PyPI | distro | 1.9.0 | indirect |
| PyPI | exceptiongroup | 1.3.1 | indirect |
| PyPI | fastapi | 0.136.3 | indirect |
| PyPI | fastuuid | 0.14.0 | indirect |
| PyPI | filelock | 3.29.1 | indirect |
| PyPI | flatbuffers | 25.12.19 | indirect |
| PyPI | forbiddenfruit | 0.1.4 | indirect |
| PyPI | frozenlist | 1.8.0 | indirect |
| PyPI | fsspec | 2026.4.0 | indirect |
| PyPI | googleapis-common-protos | 1.75.0 | indirect |
| PyPI | grpcio | 1.78.0 | indirect |
| PyPI | grpcio-health-checking | 1.78.0 | indirect |
| PyPI | grpcio-tools | 1.78.0 | indirect |
| PyPI | h11 | 0.16.0 | indirect |
| PyPI | h2 | 4.3.0 | indirect |
| PyPI | headroom-ai | 0.30.0 | indirect |
| PyPI | hf-xet | 1.5.1 | indirect |
| PyPI | hpack | 4.1.0 | indirect |
| PyPI | httpcore | 1.0.9 | indirect |
| PyPI | httptools | 0.7.1 | indirect |
| PyPI | httpx | 0.28.1 | indirect |
| PyPI | httpx-sse | 0.4.3 | indirect |
| PyPI | huggingface-hub | 1.18.0 | indirect |
| PyPI | humanfriendly | 10.0 | indirect |
| PyPI | hyperframe | 6.1.0 | indirect |
| PyPI | idna | 3.15 | indirect |
| PyPI | idna | 3.18 | indirect |
| PyPI | importlib-metadata | 8.7.1 | indirect |
| PyPI | importlib-metadata | 8.9.0 | indirect |
| PyPI | jinja2 | 3.1.6 | indirect |
| PyPI | jiter | 0.14.0 | indirect |
| PyPI | jiter | 0.15.0 | indirect |
| PyPI | jsonpatch | 1.33 | indirect |
| PyPI | jsonpointer | 3.1.1 | indirect |
| PyPI | jsonschema | 4.26.0 | indirect |
| PyPI | jsonschema-rs | 0.44.1 | indirect |
| PyPI | jsonschema-specifications | 2025.9.1 | indirect |
| PyPI | langchain-core | 1.4.0 | indirect |
| PyPI | langchain-openai | 1.2.1 | indirect |
| PyPI | langchain-protocol | 0.0.15 | indirect |
| PyPI | langgraph | 1.2.0 | indirect |
| PyPI | langgraph-api | 0.8.7 | indirect |
| PyPI | langgraph-checkpoint | 4.1.1 | indirect |
| PyPI | langgraph-cli | 0.4.26 | indirect |
| PyPI | langgraph-prebuilt | 1.1.0 | indirect |
| PyPI | langgraph-runtime-inmem | 0.28.1 | indirect |
| PyPI | langgraph-sdk | 0.3.15 | indirect |
| PyPI | langsmith | 0.8.18 | indirect |
| PyPI | litellm | 1.88.1 | indirect |
| PyPI | magika | 1.0.3 | indirect |
| PyPI | markdown-it-py | 4.2.0 | indirect |
| PyPI | markupsafe | 3.0.3 | indirect |
| PyPI | mcp | 1.28.1 | indirect |
| PyPI | mdurl | 0.1.2 | indirect |
| PyPI | mpmath | 1.3.0 | indirect |
| PyPI | multidict | 6.7.1 | indirect |
| PyPI | numpy | 2.2.6 | indirect |
| PyPI | numpy | 2.4.6 | indirect |
| PyPI | onnxruntime | 1.23.2 | indirect |
| PyPI | onnxruntime | 1.26.0 | indirect |
| PyPI | openai | 2.37.0 | indirect |
| PyPI | openai | 2.41.0 | indirect |
| PyPI | opentelemetry-api | 1.41.1 | indirect |
| PyPI | opentelemetry-api | 1.42.1 | indirect |
| PyPI | opentelemetry-exporter-otlp-proto-common | 1.41.1 | indirect |
| PyPI | opentelemetry-exporter-otlp-proto-http | 1.41.1 | indirect |
| PyPI | opentelemetry-proto | 1.41.1 | indirect |
| PyPI | opentelemetry-sdk | 1.41.1 | indirect |
| PyPI | opentelemetry-semantic-conventions | 0.62b1 | indirect |
| PyPI | orjson | 3.11.9 | indirect |
| PyPI | ormsgpack | 1.12.2 | indirect |
| PyPI | packaging | 26.2 | indirect |
| PyPI | pathspec | 1.1.1 | indirect |
| PyPI | propcache | 0.5.2 | indirect |
| PyPI | protobuf | 6.33.6 | indirect |
| PyPI | protobuf | 7.35.0 | indirect |
| PyPI | pycparser | 3.0 | indirect |
| PyPI | pydantic | 2.13.4 | indirect |
| PyPI | pydantic-core | 2.46.4 | indirect |
| PyPI | pydantic-settings | 2.14.2 | indirect |
| PyPI | pygments | 2.20.0 | indirect |
| PyPI | pyjwt | 2.13.0 | indirect |
| PyPI | pyreadline3 | 3.5.6 | indirect |
| PyPI | python-dateutil | 2.9.0.post0 | indirect |
| PyPI | python-dotenv | 1.2.2 | indirect |
| PyPI | python-multipart | 0.0.32 | indirect |
| PyPI | pywin32 | 312 | indirect |
| PyPI | pyyaml | 6.0.3 | indirect |
| PyPI | referencing | 0.37.0 | indirect |
| PyPI | regex | 2026.5.9 | indirect |
| PyPI | requests | 2.34.2 | indirect |
| PyPI | requests-toolbelt | 1.0.0 | indirect |
| PyPI | rich | 15.0.0 | indirect |
| PyPI | rpds-py | 0.30.0 | indirect |
| PyPI | rpds-py | 2026.5.1 | indirect |
| PyPI | safetensors | 0.8.0 | indirect |
| PyPI | setuptools | 83.0.0 | indirect |
| PyPI | shellingham | 1.5.4 | indirect |
| PyPI | six | 1.17.0 | indirect |
| PyPI | skillspector | 2.0.0 | indirect |
| PyPI | sniffio | 1.3.1 | indirect |
| PyPI | socket-headroom-pin | 0.0.0 | indirect |
| PyPI | socket-skillspector-pin | 0.0.0 | indirect |
| PyPI | sqlite-vec | 0.1.9 | indirect |
| PyPI | sse-starlette | 3.3.4 | indirect |
| PyPI | sse-starlette | 3.4.4 | indirect |
| PyPI | starlette | 1.3.1 | indirect |
| PyPI | structlog | 25.5.0 | indirect |
| PyPI | sympy | 1.14.0 | indirect |
| PyPI | tenacity | 9.1.4 | indirect |
| PyPI | tiktoken | 0.13.0 | indirect |
| PyPI | tokenizers | 0.22.2 | indirect |
| PyPI | tomli | 2.4.1 | indirect |
| PyPI | tqdm | 4.67.3 | indirect |
| PyPI | tqdm | 4.68.2 | indirect |
| PyPI | transformers | 5.10.2 | indirect |
| PyPI | truststore | 0.10.4 | indirect |
| PyPI | typer | 0.23.2 | indirect |
| PyPI | typer | 0.25.1 | indirect |
| PyPI | typing-extensions | 4.15.0 | indirect |
| PyPI | typing-inspection | 0.4.2 | indirect |
| PyPI | urllib3 | 2.7.0 | indirect |
| PyPI | uuid-utils | 0.15.0 | indirect |
| PyPI | uvicorn | 0.47.0 | indirect |
| PyPI | uvicorn | 0.49.0 | indirect |
| PyPI | uvloop | 0.22.1 | indirect |
| PyPI | watchdog | 6.0.0 | indirect |
| PyPI | watchfiles | 1.1.1 | indirect |
| PyPI | websockets | 16.0 | indirect |
| PyPI | xxhash | 3.7.0 | indirect |
| PyPI | yara-python | 4.5.4 | indirect |
| PyPI | yarl | 1.24.2 | indirect |
| PyPI | zipp | 3.23.1 | indirect |
| PyPI | zipp | 4.1.0 | indirect |
| PyPI | zstandard | 0.25.0 | indirect |
This repository publishes no package the index resolves, so its own dependency graph was assessed — 298 packages, which also include development and test pins that never ship: 3 carry known advisories, of which 0 are direct.
| Package | Version | Relation | Severity | Advisories | Fixed in |
|---|---|---|---|---|---|
| vitest | catalog: | indirect | critical | 2 | 4.1.0 |
| h2 | 4.3.0 | indirect | moderate | 2 | 4.4.1 |
| langgraph-api | 0.8.7 | indirect | moderate | 2 | 0.10.0 |
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.