Public recordCritical
Software health reportschema 0.34.0 · metrics 2.10.0 · 2026-09-11 19:34 UTC
Taritsyn / WebMarkupMin
The Web Markup Minifier (abbreviated WebMarkupMin) - a .NET library that contains a set of markup minifiers. The objective of this project is to improve the performance of web applications by reducing the size of HTML, XHTML and XML code.
Taritsyn/WebMarkupMin holds a health index of 11 out of 100, placing it in the Critical band. It scores highest on Vitality (82/100) and lowest on Security (16/100). It was last updated 1 day ago. A single contributor accounts for most of its recent work.
11
overall / 100Software health index
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
11
Exceptional93-100The record's top tier (≈ top 5%); essentially all checked criteria met
Excellent80-92Strong across the board; minor gaps
Good65-79Healthy; gaps are limited and manageable
Moderate50-64Acceptable with notable gaps; review recommended
Weak35-49Material weaknesses across several areas
At Risk20-34Significant weaknesses; adoption warrants caution
Critical1-19Severe problems (abandoned, single-maintainer, no hygiene)
Score profile
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 54 is calibrated to 56 on the published index scale (record calibration 2026-08-02). High-Risk Jurisdiction Policy applies a 20% multiplier to weighted overall health and gives it an At Risk ceiling of 34.
Ownership
Andrey TaritsynPersonal account
140 followers30 public repossince Apr 2010
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
Package ecosystems
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| NuGet | WebMarkupMin.AspNet.Brotli | 2.20.2 | - | 16 | 197 days ago | webmarkupminasp.netcompressionbrotli |
| NuGet | WebMarkupMin.AspNet.Common | 2.21.0 | - | 31 | 177 days ago | webmarkupminmarkuphtmlxhtmlminificationminifierminifyasp.netxml |
| NuGet | WebMarkupMin.AspNet4.Common | 2.20.2 | - | 18 | 197 days ago | webmarkupminmarkuphtmlxhtmlminificationminifierminifyasp.netxml |
| NuGet | WebMarkupMin.AspNet4.HttpModules | 2.20.2 | - | 19 | 197 days ago | webmarkupminmarkuphtmlxhtmlminificationminifierminifyasp.nethttp-modulesxml |
| NuGet | WebMarkupMin.AspNet4.Mvc | 2.20.2 | - | 18 | 197 days ago | webmarkupminmarkuphtmlxhtmlminificationminifierminifyasp.netmvcxml |
| NuGet | WebMarkupMin.AspNet4.WebForms | 2.20.2 | - | 18 | 197 days ago | webmarkupminmarkuphtmlxhtmlminificationminifierminifyasp.netwebforms |
| NuGet | WebMarkupMin.AspNetCore1 | 2.21.0 | - | 40 | 177 days ago | webmarkupminmarkuphtmlxhtmlminificationminifierminifyasp.netmiddlewarexml |
| NuGet | WebMarkupMin.AspNetCore2 | 2.21.0 | - | 35 | 177 days ago | webmarkupminmarkuphtmlxhtmlminificationminifierminifyasp.netmiddlewarexml |
Metrics by category
Vitality
Is the project alive — is code being written and are releases shipping?
82
Development activity
70Good
How it's scored
| 36/36 | Push recency — last push 1 days ago |
| 9/36 | Commit cadence — 13/52 weeks with commits |
| 15.3/18 | Commit volume — 49 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 14 commit(s) and 1 issue activity found in the last 90 days -- score normalized to 10 |
Inputs used
| commits_last_year | 49 |
| human_commit_share | 1 |
| days_since_last_push | 1 |
| active_weeks_last_year | 13 |
Release discipline
100Exceptional
How it's scored
| 27/27 | Ships releases — 100 releases published |
| 36/36 | Release recency — latest release 1 days ago |
| 27/27 | Release cadence — a release every ~34.9 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
Inputs used
| releases_count | 100 |
| latest_release_tag | v2.22.4 |
| releases_from_tags | no |
| days_since_latest_release | 1 |
| mean_days_between_releases | 34.9 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.
Community & Adoption
Does the project have users, downloads, attention, and a welcoming setup for contributors?
66
Popularity & adoption
66Good
How it's scored
| 43.7/60 | Stars — 497 stars |
| 13.8/25 | Forks — 46 forks |
| 8.3/15 | Watchers — 32 watchers |
Inputs used
| forks | 46 |
| stars | 497 |
| watchers | 32 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community health
50Moderate
How it's scored
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (Apache-2.0) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
Inputs used
| has_readme | yes |
| has_license | yes |
| readme_badges | 2 |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | shields.io |
| has_pull_request_template | no |
Ecosystem adoption (downloads)
90Excellent
How it's scored
| 71.8/80 | Total downloads — 8,135,277 downloads all-time across nuget |
| 0/20 | Registry dependents — not reported by this ecosystem |
Inputs used
| packages | WebMarkupMin.AspNet.Brotli, WebMarkupMin.AspNet.Common, WebMarkupMin.AspNet4.Common, WebMarkupMin.AspNet4.HttpModules, WebMarkupMin.AspNet4.Mvc, WebMarkupMin.AspNet4.WebForms, WebMarkupMin.AspNetCore1, WebMarkupMin.AspNetCore2 |
| dependents | — |
| ecosystems | nuget |
| total_downloads | 8,135,277 |
| monthly_downloads | — |
| unverified_packages_excluded | — |
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.
Sustainability & Governance
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
53
Maintainer resilience (bus factor)
16Critical
How it's scored
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0.1/22.5 | Commit distribution — top contributor authored 100% of commits |
| 4.1/13.5 | Contributor breadth — 3 contributors |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
Inputs used
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0.997 |
Issue & PR responsiveness
54Moderate
How it's scored
| 41/42 | Issue resolution — 98% of issues closed |
| 6.4/30 | PR acceptance — 3/14 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Inputs used
| merged_prs | 3 |
| open_issues | 4 |
| closed_issues | 163 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 0 |
| prs_decided_30d | 0 |
| issue_closed_ratio | 0.976 |
| closed_unmerged_prs | 11 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
Excluded from scoring (no data or not applicable): Newcomer PR acceptance. Remaining weights renormalized.
Ownership & stewardship
60Moderate
How it's scored
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 15.5/25 | Owner reach — 140 followers of Taritsyn |
| 22.9/25 | Track record — 30 public repos, account ~16 yr old |
Inputs used
| followers | 140 |
| owner_type | User |
| is_verified | — |
| owner_login | Taritsyn |
| public_repos | 30 |
| account_age_days | 5,983 |
Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.
Package maintenance
100Exceptional
How it's scored
| 25/25 | Published & resolvable — 8 package(s) on nuget |
| 35/35 | Publish recency — latest publish 177 days ago |
| 20/20 | Version history — 40 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
Inputs used
| packages | WebMarkupMin.AspNet.Brotli, WebMarkupMin.AspNet.Common, WebMarkupMin.AspNet4.Common, WebMarkupMin.AspNet4.HttpModules, WebMarkupMin.AspNet4.Mvc, WebMarkupMin.AspNet4.WebForms, WebMarkupMin.AspNetCore1, WebMarkupMin.AspNetCore2 |
| ecosystems | nuget |
| any_deprecated | no |
| min_days_since_publish | 177 |
Engineering Quality
Are baseline engineering and documentation practices in place?
47
Engineering practices
38Weak
How it's scored
| 0/24 | CI workflows |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
Inputs used
| has_ci | no |
| has_tests | yes |
| has_editorconfig | yes |
| has_linter_config | no |
| has_precommit_config | no |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.
Documentation
60Moderate
How it's scored
| 30/30 | README |
| 0/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 10/10 | Topics — 8 topics |
| 10/10 | Wiki |
Inputs used
| topics | html, xhtml, xml, minification, minify, markup, dotnet, aspnet |
| has_wiki | yes |
| homepage | — |
| docs_site | — |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Security
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
16
Security posture
6Critical
Jurisdiction risk alert
High-risk jurisdiction exposure detected
1 software.redFlag.role.ownerRussia1 top contributor profilesRussia
Based on self-published public profile locations. This governance signal does not determine nationality, citizenship, intent, sanctions status, or individual trustworthiness.
How jurisdiction exposure is assessedHow it's scored
| 6.8/7.5 | Binary-Artifacts — binaries present in source code |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 0/10 | Dangerous-Workflow — no data |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 14 commit(s) and 1 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — no data |
| 5.2/7.5 | Vulnerabilities — 3 existing vulnerabilities detected |
Inputs used
| source | openssf_scorecard |
| checks_evaluated | 13 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 5 |
| scorecard_aggregate | 3.1 |
| high_risk_jurisdiction_cap | 34 |
| high_risk_jurisdiction_multiplier | 20 |
| security_posture_after_multiplier | 6 |
| security_posture_before_jurisdiction | 31 |
Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Signed-Releases, Token-Permissions. Remaining weights renormalized. High-Risk Jurisdiction Policy applies a 20% multiplier and gives Security posture an At risk ceiling of 34.
Dependency advisories
55Moderate
How it's scored
| 11.8/35 | Direct dependencies free of known advisories — 2 affected: Microsoft.AspNetCore.Http 1.0.4 (high 7.5), Microsoft.AspNetCore.Http 2.0.3 (high 7.5) |
| 0/25 | Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope |
| 29.1/40 | No advisories left outstanding — 2 advisory-carrying package(s) unaddressed past 90 days; oldest published 1,571 days ago |
Inputs used
| source | osv |
| advisories | 6 |
| affected_packages | 4 |
| assessed_packages | 83 |
| unassessed_packages | 1 |
| affected_by_severity | high 3, moderate 1 |
| direct_affected_packages | 2 |
Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories. Remaining weights renormalized. Matched 83 resolved dependencies against OSV. 1 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.
AI Readiness
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
49
Agent context & guidance
3Critical
How it's scored
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 2.7/40 | Legible commit history — 5 of 100 human commits state their intent (structured subject or explanatory body) |
Inputs used
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 0.05 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
How it's scored
| 12.6/18 | One-command bootstrap — samples/WebMarkupMin.Sample.AspNet4.Mvc4/WebMarkupMin.Sample.AspNet4.Mvc4.csproj, samples/WebMarkupMin.Sample.AspNet45.WebForms/WebMarkupMin.Sample.AspNet45.WebForms.csproj, samples/WebMarkupMin.Sample.AspNetCore.ClientSideAssets/WebMarkupMin.Sample.AspNetCore.ClientSideAssets.csproj (toolchain convention, no task runner) |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — C# (statically typed) |
| 0/10 | Reproducible environment |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 0/8 | Automated maintenance — no automated dependency updates observed |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Inputs used
| has_nix | no |
| has_tests | yes |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | samples/WebMarkupMin.Sample.AspNet4.Mvc4/WebMarkupMin.Sample.AspNet4.Mvc4.csproj, samples/WebMarkupMin.Sample.AspNet45.WebForms/WebMarkupMin.Sample.AspNet45.WebForms.csproj, samples/WebMarkupMin.Sample.AspNetCore.ClientSideAssets/WebMarkupMin.Sample.AspNetCore.ClientSideAssets.csproj, samples/WebMarkupMin.Sample.AspNetCore.Infrastructure/WebMarkupMin.Sample.AspNetCore.Infrastructure.csproj, samples/WebMarkupMin.Sample.AspNetCore1.Mvc1/WebMarkupMin.Sample.AspNetCore1.Mvc1.csproj, samples/WebMarkupMin.Sample.AspNetCore10.Mvc10/WebMarkupMin.Sample.AspNetCore10.Mvc10.csproj, samples/WebMarkupMin.Sample.AspNetCore1Full.Mvc1/WebMarkupMin.Sample.AspNetCore1Full.Mvc1.csproj, samples/WebMarkupMin.Sample.AspNetCore21.Mvc21/WebMarkupMin.Sample.AspNetCore21.Mvc21.csproj, samples/WebMarkupMin.Sample.AspNetCore31.Mvc31/WebMarkupMin.Sample.AspNetCore31.Mvc31.csproj, samples/WebMarkupMin.Sample.AspNetCore5.Mvc5/WebMarkupMin.Sample.AspNetCore5.Mvc5.csproj, samples/WebMarkupMin.Sample.AspNetCore6.Mvc6/WebMarkupMin.Sample.AspNetCore6.Mvc6.csproj, samples/WebMarkupMin.Sample.AspNetCore7.Mvc7/WebMarkupMin.Sample.AspNetCore7.Mvc7.csproj, samples/WebMarkupMin.Sample.AspNetCore8.Mvc8/WebMarkupMin.Sample.AspNetCore8.Mvc8.csproj, samples/WebMarkupMin.Sample.AspNetCore9.Mvc9/WebMarkupMin.Sample.AspNetCore9.Mvc9.csproj, samples/WebMarkupMin.Sample.Logic/WebMarkupMin.Sample.Logic.csproj, samples/WebMarkupMin.Sample.Resources/WebMarkupMin.Sample.Resources.csproj, src/WebMarkupMin.AspNet.Brotli/WebMarkupMin.AspNet.Brotli.csproj, src/WebMarkupMin.AspNet.Common/WebMarkupMin.AspNet.Common.csproj, src/WebMarkupMin.AspNet4.Common/WebMarkupMin.AspNet4.Common.csproj, src/WebMarkupMin.AspNet4.HttpModules/WebMarkupMin.AspNet4.HttpModules.csproj, src/WebMarkupMin.AspNet4.Mvc/WebMarkupMin.AspNet4.Mvc.csproj, src/WebMarkupMin.AspNet4.WebForms/WebMarkupMin.AspNet4.WebForms.csproj, src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj, src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj, src/WebMarkupMin.AspNetCore3/WebMarkupMin.AspNetCore3.csproj, src/WebMarkupMin.AspNetCore5/WebMarkupMin.AspNetCore5.csproj, src/WebMarkupMin.AspNetCore6/WebMarkupMin.AspNetCore6.csproj, src/WebMarkupMin.AspNetCore7/WebMarkupMin.AspNetCore7.csproj, src/WebMarkupMin.AspNetCore8/WebMarkupMin.AspNetCore8.csproj, src/WebMarkupMin.AspNetCoreLatest/WebMarkupMin.AspNetCoreLatest.csproj, src/WebMarkupMin.Core/WebMarkupMin.Core.csproj, src/WebMarkupMin.MsAjax/WebMarkupMin.MsAjax.csproj, src/WebMarkupMin.NUglify/WebMarkupMin.NUglify.csproj, src/WebMarkupMin.Yui/WebMarkupMin.Yui.csproj, test/WebMarkupMin.Benchmarks/WebMarkupMin.Benchmarks.csproj, test/WebMarkupMin.Tests.Integration/WebMarkupMin.Tests.Integration.csproj, test/WebMarkupMin.Tests/WebMarkupMin.Tests.csproj |
| dependency_bot_commit_share | 0 |
Code legibility for models
99Exceptional
How it's scored
| 45/45 | Type-checkable code — C# (statically typed) |
| 53.8/55 | Manageable file sizes — 11/503 source files over 60KB |
Inputs used
| primary_language | C# |
| largest_source_bytes | 273,199 |
| source_files_sampled | 503 |
| oversized_source_files | 11 |
Machine-readable interfaces
100Exceptional
How it's scored
| 0/40 | API schema (OpenAPI/GraphQL/proto) — not applicable to this kind of software |
| 0/20 | MCP server — not applicable to this kind of software |
| 40/40 | Runnable examples — samples |
Inputs used
| example_dirs | samples |
| has_mcp_signal | no |
| api_schema_files | — |
| interfaces_expected_of | — |
Excluded from scoring (no data or not applicable): API schema (OpenAPI/GraphQL/proto), MCP server. Remaining weights renormalized.
Key facts
497GitHub stars
3contributors
49commits, last 12 months
1days since last push
100releases
1bus factor
4open issues
—package ecosystems
Data collection warnings
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
More detail
Star and fork history 0 ★ / 46 ⇿
0Stars
46Forks
90Releases
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Major 1Minor 19Patch 60
Each point covers 9 days.
OpenSSF Scorecard 3.1 / 10
3.1aggregate
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 9 | Binary-Artifacts | binaries present in source code |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| n/a | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 14 commit(s) and 1 issue activity found in the last 90 days -- score normalized to 10 |
| n/a | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| n/a | Token-Permissions | No tokens found |
| 7 | Vulnerabilities | 3 existing vulnerabilities detected |
Direct dependencies 29
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.AspNet.Brotli/WebMarkupMin.AspNet.Brotli.csproj |
| NuGet | BrotliSharpLib | 0.3.3 | src/WebMarkupMin.AspNet.Brotli/WebMarkupMin.AspNet.Brotli.csproj |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.AspNet.Common/WebMarkupMin.AspNet.Common.csproj |
| NuGet | Microsoft.AspNet.Mvc | 3.0.20105.1 | src/WebMarkupMin.AspNet4.Mvc/WebMarkupMin.AspNet4.Mvc.csproj |
| NuGet | Microsoft.AspNetCore.Hosting.Abstractions | 1.0.5 | src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj |
| NuGet | Microsoft.AspNetCore.Http | 1.0.4 | src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj |
| NuGet | Microsoft.AspNetCore.Http.Extensions | 1.0.4 | src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj |
| NuGet | Microsoft.AspNetCore.Http.Features | 1.0.4 | src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj |
| NuGet | Microsoft.Extensions.Options | 1.0.2 | src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj |
| NuGet | Microsoft.Net.Http.Headers | 1.0.4 | src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.AspNetCore1/WebMarkupMin.AspNetCore1.csproj |
| NuGet | Microsoft.AspNetCore.Hosting.Abstractions | 2.0.3 | src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj |
| NuGet | Microsoft.AspNetCore.Http | 2.0.3 | src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj |
| NuGet | Microsoft.AspNetCore.Http.Extensions | 2.0.3 | src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj |
| NuGet | Microsoft.AspNetCore.Http.Features | 2.0.3 | src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj |
| NuGet | Microsoft.Extensions.Options | 2.0.2 | src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj |
| NuGet | Microsoft.Net.Http.Headers | 2.0.3 | src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.AspNetCore2/WebMarkupMin.AspNetCore2.csproj |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.AspNetCore3/WebMarkupMin.AspNetCore3.csproj |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.AspNetCore6/WebMarkupMin.AspNetCore6.csproj |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.AspNetCoreLatest/WebMarkupMin.AspNetCoreLatest.csproj |
| NuGet | AdvancedStringBuilder | 0.2.0 | src/WebMarkupMin.Core/WebMarkupMin.Core.csproj |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | src/WebMarkupMin.Core/WebMarkupMin.Core.csproj |
| NuGet | PolyfillsForOldDotNet.System.Buffers | 0.1.3 | src/WebMarkupMin.Core/WebMarkupMin.Core.csproj |
| NuGet | System.Buffers | 4.0.0 | src/WebMarkupMin.Core/WebMarkupMin.Core.csproj |
| NuGet | System.Buffers | 4.4.0 | src/WebMarkupMin.Core/WebMarkupMin.Core.csproj |
| NuGet | AjaxMin | 5.14.5506.26202 | src/WebMarkupMin.MsAjax/WebMarkupMin.MsAjax.csproj |
| NuGet | NUglify | 1.23.0 | src/WebMarkupMin.NUglify/WebMarkupMin.NUglify.csproj |
| NuGet | YUICompressor.NET | 3.1.0 | src/WebMarkupMin.Yui/WebMarkupMin.Yui.csproj |
All dependencies 84
Full resolved dependency set from the GitHub dependency graph: 23 direct and 61 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| NuGet | AdvancedStringBuilder | 0.2.0 | direct |
| NuGet | AjaxMin | 5.14.5506.26202 | direct |
| NuGet | BrotliSharpLib | 0.3.3 | direct |
| NuGet | Microsoft.AspNet.Mvc | 3.0.20105.1 | direct |
| NuGet | Microsoft.AspNet.Mvc | 4.0.40804.0 | direct |
| NuGet | Microsoft.AspNetCore.Hosting.Abstractions | 1.0.5 | direct |
| NuGet | Microsoft.AspNetCore.Hosting.Abstractions | 2.0.3 | direct |
| NuGet | Microsoft.AspNetCore.Http | 1.0.4 | direct |
| NuGet | Microsoft.AspNetCore.Http | 2.0.3 | direct |
| NuGet | Microsoft.AspNetCore.Http.Extensions | 1.0.4 | direct |
| NuGet | Microsoft.AspNetCore.Http.Extensions | 2.0.3 | direct |
| NuGet | Microsoft.AspNetCore.Http.Features | 1.0.4 | direct |
| NuGet | Microsoft.AspNetCore.Http.Features | 2.0.3 | direct |
| NuGet | Microsoft.Extensions.Options | 1.0.2 | direct |
| NuGet | Microsoft.Extensions.Options | 2.0.2 | direct |
| NuGet | Microsoft.Net.Http.Headers | 1.0.4 | direct |
| NuGet | Microsoft.Net.Http.Headers | 2.0.3 | direct |
| NuGet | NUglify | 1.23.0 | direct |
| NuGet | PolyfillsForOldDotNet.System.Buffers | 0.1.3 | direct |
| NuGet | ResxToCs.MSBuild | 1.0.0-alpha7 | direct |
| NuGet | System.Buffers | 4.0.0 | direct |
| NuGet | System.Buffers | 4.4.0 | direct |
| NuGet | YUICompressor.NET | 3.1.0 | direct |
| npm | del | 5.1.0 | indirect |
| npm | gulp | 4.0.2 | indirect |
| npm | gulp-autoprefixer | 7.0.1 | indirect |
| npm | gulp-clean-css | 4.2.0 | indirect |
| npm | gulp-concat | 2.6.1 | indirect |
| npm | gulp-less | 4.0.1 | indirect |
| npm | gulp-rename | 2.0.0 | indirect |
| npm | gulp-sourcemaps | 2.6.5 | indirect |
| npm | gulp-uglify | 3.0.2 | indirect |
| NuGet | Antlr | 3.5.0.2 | indirect |
| NuGet | AutoMapper | 6.2.2 | indirect |
| NuGet | BenchmarkDotNet | 0.15.8 | indirect |
| NuGet | BundleTransformer.ConfigurationIntelliSense | 1.17.0 | indirect |
| NuGet | BundleTransformer.Core | 1.14.1 | indirect |
| NuGet | BundleTransformer.Less | 1.14.0 | indirect |
| NuGet | BundleTransformer.NUglify | 1.17.6 | indirect |
| NuGet | JavaScriptEngineSwitcher.Core | 3.31.0 | indirect |
| NuGet | JavaScriptEngineSwitcher.Msie | 3.31.0 | indirect |
| NuGet | jQuery | 1.10.2 | indirect |
| NuGet | Microsoft.AspNet.FriendlyUrls | 1.0.2 | indirect |
| NuGet | Microsoft.AspNet.FriendlyUrls.Core | 1.0.2 | indirect |
| NuGet | Microsoft.AspNet.Razor | 2.0.30506.0 | indirect |
| NuGet | Microsoft.AspNet.Web.Optimization | 1.1.3 | indirect |
| NuGet | Microsoft.AspNet.WebPages | 2.0.30506.0 | indirect |
| NuGet | Microsoft.AspNetCore.App | — | indirect |
| NuGet | Microsoft.AspNetCore.Diagnostics | 1.0.5 | indirect |
| NuGet | Microsoft.AspNetCore.Mvc | 1.0.6 | indirect |
| NuGet | Microsoft.AspNetCore.Mvc.Core | 1.0.6 | indirect |
| NuGet | Microsoft.AspNetCore.Mvc.Core | 2.1.38 | indirect |
| NuGet | Microsoft.AspNetCore.Mvc.TagHelpers | 1.0.6 | indirect |
| NuGet | Microsoft.AspNetCore.Mvc.TagHelpers | 2.1.3 | indirect |
| NuGet | Microsoft.AspNetCore.Mvc.ViewFeatures | 1.0.6 | indirect |
| NuGet | Microsoft.AspNetCore.Mvc.ViewFeatures | 2.1.3 | indirect |
| NuGet | Microsoft.AspNetCore.Razor | 1.0.4 | indirect |
| NuGet | Microsoft.AspNetCore.Server.IISIntegration | 1.0.6 | indirect |
| NuGet | Microsoft.AspNetCore.Server.Kestrel | 1.0.6 | indirect |
| NuGet | Microsoft.AspNetCore.StaticFiles | 1.0.5 | indirect |
| NuGet | Microsoft.Extensions.Configuration.EnvironmentVariables | 1.0.2 | indirect |
| NuGet | Microsoft.Extensions.Configuration.EnvironmentVariables | 2.1.1 | indirect |
| NuGet | Microsoft.Extensions.Configuration.Json | 1.0.2 | indirect |
| NuGet | Microsoft.Extensions.Configuration.Json | 2.1.1 | indirect |
| NuGet | Microsoft.Extensions.Logging | 1.0.2 | indirect |
| NuGet | Microsoft.Extensions.Logging | 2.1.1 | indirect |
| NuGet | Microsoft.Extensions.Logging.Console | 1.0.2 | indirect |
| NuGet | Microsoft.Extensions.Logging.Console | 2.1.1 | indirect |
| NuGet | Microsoft.Extensions.Logging.Debug | 1.0.2 | indirect |
| NuGet | Microsoft.Extensions.Logging.Debug | 2.1.1 | indirect |
| NuGet | Microsoft.Extensions.Options.ConfigurationExtensions | 1.0.2 | indirect |
| NuGet | Microsoft.NET.Test.Sdk | 17.13.0 | indirect |
| NuGet | Microsoft.VisualStudio.Web.CodeGeneration.Design | 2.1.10 | indirect |
| NuGet | Microsoft.Web.Infrastructure | 1.0.0.0 | indirect |
| NuGet | Modernizr | 2.8.3 | indirect |
| NuGet | Moq | 4.20.72 | indirect |
| NuGet | MsieJavaScriptEngine | 3.3.1 | indirect |
| NuGet | Newtonsoft.Json | 13.0.3 | indirect |
| NuGet | PolyfillsForOldDotNet.System.Threading | 0.1.3 | indirect |
| NuGet | Twitter.Bootstrap.Less | 3.3.0 | indirect |
| NuGet | WebGrease | 1.6.0 | indirect |
| NuGet | xunit | 2.9.3 | indirect |
| NuGet | xunit.runner.visualstudio | 2.4.5 | indirect |
| NuGet | xunit.runner.visualstudio | 2.8.2 | indirect |
Dependency advisories 4
This repository publishes no package the index resolves, so its own dependency graph was assessed — 83 packages, which also include development and test pins that never ship: 4 carry known advisories, of which 2 are direct. 1 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list.
| Package | Version | Relation | Severity | Advisories | Fixed in |
|---|---|---|---|---|---|
| Microsoft.AspNetCore.Http | 1.0.4 | direct | high | 1 | 4.1.1 |
| Microsoft.AspNetCore.Http | 2.0.3 | direct | high | 1 | 4.1.1 |
| AutoMapper | 6.2.2 | indirect | high | 1 | 16.1.1 |
| jQuery | 1.10.2 | indirect | moderate | 3 | 4.4.0 |
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Raw JSON report machine-readable
Feedback
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — NuGet.