🎮 Rust Crate for locating Steam game installation directories (and Steam itself!)
WilliamVenner/steamlocate-rs holds a health index of 75 out of 100, placing it in the Good band. It scores highest on Vitality (71/100) and lowest on Community & Adoption (51/100). It was last updated today. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 65 is calibrated to 75 on the published index scale (record calibration 2026-08-02).
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| crates.io | steamlocate | 2.1.1 | 9,457 | 23 | 0 days ago | appmanifestdirectorysteamsteamappsvdffilesystemconfig |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 0 days ago |
| 4.8/36 | Commit cadence — 7/52 weeks with commits |
| 11.7/18 | Commit volume — 19 commits in the last year |
| 9/10 | OpenSSF Scorecard: Maintained — 8 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 9 |
| commits_last_year | 19 |
| human_commit_share | 0.96 |
| days_since_last_push | 0 |
| active_weeks_last_year | 7 |
| 27/27 | Ships releases — 4 releases published |
| 36/36 | Release recency — latest release 0 days ago |
| 12.6/27 | Release cadence — a release every ~212.6 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 4 |
| latest_release_tag | 2.1.1 |
| releases_from_tags | no |
| days_since_latest_release | 0 |
| mean_days_between_releases | 212.6 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 28.6/60 | Stars — 59 stars |
| 10.7/25 | Forks — 20 forks |
| 3.3/15 | Watchers — 5 watchers |
| forks | 20 |
| stars | 59 |
| watchers | 5 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | 3 |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | github.com, shields.io |
| has_pull_request_template | no |
| 53/80 | Monthly downloads — 9,457 downloads/month across crates |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | steamlocate |
| dependents | — |
| ecosystems | crates |
| total_downloads | 190,403 |
| monthly_downloads | 9,457 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 8.4/22.5 | Commit distribution — top contributor authored 63% of commits |
| 9.5/13.5 | Contributor breadth — 7 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 4 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 7 |
| top_contributor_share | 0.628 |
| 38/42 | Issue resolution — 90% of issues closed |
| 28.5/30 | PR acceptance — 92/97 decided PRs merged |
| 13/13 | Newcomer PR acceptance — 2/2 first-time contributors' PRs merged in 30d |
| 4.5/15 | OpenSSF Scorecard: Code-Review — Found 8/24 approved changesets -- score normalized to 3 |
| merged_prs | 92 |
| open_issues | 2 |
| closed_issues | 19 |
| prs_merged_7d | 3 |
| prs_decided_7d | 3 |
| prs_merged_30d | 4 |
| prs_decided_30d | 4 |
| issue_closed_ratio | 0.905 |
| closed_unmerged_prs | 5 |
| first_time_authors_30d | 1 |
| first_time_prs_merged_30d | 2 |
| first_time_prs_decided_30d | 2 |
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 17.9/25 | Owner reach — 310 followers of WilliamVenner |
| 25/25 | Track record — 185 public repos, account ~10 yr old |
| followers | 310 |
| owner_type | User |
| is_verified | — |
| owner_login | WilliamVenner |
| public_repos | 185 |
| account_age_days | 3,973 |
| 25/25 | Published & resolvable — 1 package(s) on crates |
| 35/35 | Publish recency — latest publish 0 days ago |
| 20/20 | Version history — 23 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | steamlocate |
| ecosystems | crates |
| any_deprecated | no |
| min_days_since_publish | 0 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 2 workflow(s) |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 6.4/6.4 | .editorconfig |
| 12/20 | OpenSSF Scorecard: CI-Tests — 17 out of 25 merged PRs checked by a CI test -- score normalized to 6 |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | yes |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://docs.rs/steamlocate |
| 10/10 | Repository description |
| 10/10 | Topics — 15 topics |
| 0/10 | Wiki |
| topics | rust, steam, steamapps, appmanifest, vdf, vdf-format, acf, acf-format, games, game, steamapp, crate, module, library, cargo |
| has_wiki | no |
| homepage | — |
| docs_site | https://docs.rs/steamlocate |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 1.5/2.5 | CI-Tests — 17 out of 25 merged PRs checked by a CI test -- score normalized to 6 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 2.2/7.5 | Code-Review — Found 8/24 approved changesets -- score normalized to 3 |
| 2.5/2.5 | Contributors — project has 4 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 6.8/7.5 | Maintained — 8 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 9 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 6.8/7.5 | Vulnerabilities — 1 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 17 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 1 |
| scorecard_aggregate | 5.4 |
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 0/25 | Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
| source | osv |
| advisories | 1 |
| affected_packages | 1 |
| assessed_packages | 91 |
| unassessed_packages | 0 |
| affected_by_severity | unknown 1 |
| direct_affected_packages | 0 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 37.8/40 | Legible commit history — 68 of 96 human commits state their intent (structured subject or explanatory body) |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 0.708 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 12.6/18 | One-command bootstrap — Cargo.toml (toolchain convention, no task runner) |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — Rust (statically typed) |
| 10/10 | Reproducible environment — lockfile |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 8/8 | Automated maintenance — 4 of the last 100 commits are automated dependency updates |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | no |
| has_tests | yes |
| lockfiles | Cargo.lock |
| has_dockerfile | no |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | Cargo.toml |
| dependency_bot_commit_share | 0.04 |
| 45/45 | Type-checkable code — Rust (statically typed) |
| 55/55 | Manageable file sizes — 0/19 source files over 60KB |
| primary_language | Rust |
| largest_source_bytes | 14,694 |
| source_files_sampled | 19 |
| oversized_source_files | 0 |
| 0/40 | API schema (OpenAPI/GraphQL/proto) — not applicable to this kind of software |
| 0/20 | MCP server — not applicable to this kind of software |
| 40/40 | Runnable examples — examples |
| example_dirs | examples |
| has_mcp_signal | no |
| api_schema_files | — |
| interfaces_expected_of | — |
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Each point covers 5 days.
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 6 | CI-Tests | 17 out of 25 merged PRs checked by a CI test -- score normalized to 6 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 3 | Code-Review | Found 8/24 approved changesets -- score normalized to 3 |
| 10 | Contributors | project has 4 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 9 | Maintained | 8 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 9 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 9 | Vulnerabilities | 1 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| crates.io | crc | 3.0 | Cargo.toml |
| crates.io | keyvalues-parser | 0.2 | Cargo.toml |
| crates.io | keyvalues-serde | 0.2 | Cargo.toml |
| crates.io | serde | 1.0 | Cargo.toml |
| crates.io | serde_derive | 1.0 | Cargo.toml |
Full resolved dependency set from the GitHub dependency graph: 5 direct and 86 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| crates.io | crc | 3.4.0 | direct |
| crates.io | keyvalues-parser | 0.2.3 | direct |
| crates.io | keyvalues-serde | 0.2.3 | direct |
| crates.io | serde | 1.0.228 | direct |
| crates.io | serde_derive | 1.0.228 | direct |
| crates.io | anyhow | 1.0.102 | indirect |
| crates.io | async-trait | 0.1.89 | indirect |
| crates.io | autocfg | 1.5.0 | indirect |
| crates.io | bitflags | 2.11.0 | indirect |
| crates.io | bumpalo | 3.20.2 | indirect |
| crates.io | cast | 0.3.0 | indirect |
| crates.io | cc | 1.2.59 | indirect |
| crates.io | cfg-if | 1.0.4 | indirect |
| crates.io | console | 0.16.3 | indirect |
| crates.io | crc-catalog | 2.4.0 | indirect |
| crates.io | encode_unicode | 1.0.0 | indirect |
| crates.io | equivalent | 1.0.2 | indirect |
| crates.io | errno | 0.3.14 | indirect |
| crates.io | fastrand | 2.4.0 | indirect |
| crates.io | find-msvc-tools | 0.1.9 | indirect |
| crates.io | foldhash | 0.1.5 | indirect |
| crates.io | futures-core | 0.3.32 | indirect |
| crates.io | futures-task | 0.3.32 | indirect |
| crates.io | futures-util | 0.3.32 | indirect |
| crates.io | getrandom | 0.4.2 | indirect |
| crates.io | hashbrown | 0.15.5 | indirect |
| crates.io | hashbrown | 0.16.1 | indirect |
| crates.io | heck | 0.5.0 | indirect |
| crates.io | id-arena | 2.3.0 | indirect |
| crates.io | indexmap | 2.13.1 | indirect |
| crates.io | insta | 1.47.2 | indirect |
| crates.io | itoa | 1.0.18 | indirect |
| crates.io | js-sys | 0.3.94 | indirect |
| crates.io | leb128fmt | 0.1.0 | indirect |
| crates.io | libc | 0.2.184 | indirect |
| crates.io | libm | 0.2.16 | indirect |
| crates.io | linux-raw-sys | 0.12.1 | indirect |
| crates.io | log | 0.4.29 | indirect |
| crates.io | memchr | 2.8.0 | indirect |
| crates.io | minicov | 0.3.8 | indirect |
| crates.io | nu-ansi-term | 0.50.3 | indirect |
| crates.io | num-traits | 0.2.19 | indirect |
| crates.io | once_cell | 1.21.4 | indirect |
| crates.io | oorandom | 11.1.5 | indirect |
| crates.io | pest | 2.8.6 | indirect |
| crates.io | pin-project-lite | 0.2.17 | indirect |
| crates.io | prettyplease | 0.2.37 | indirect |
| crates.io | proc-macro2 | 1.0.106 | indirect |
| crates.io | quote | 1.0.45 | indirect |
| crates.io | r-efi | 6.0.0 | indirect |
| crates.io | ron | 0.12.1 | indirect |
| crates.io | rustix | 1.1.4 | indirect |
| crates.io | rustversion | 1.0.22 | indirect |
| crates.io | same-file | 1.0.6 | indirect |
| crates.io | semver | 1.0.28 | indirect |
| crates.io | serde_core | 1.0.228 | indirect |
| crates.io | serde_json | 1.0.149 | indirect |
| crates.io | shlex | 1.3.0 | indirect |
| crates.io | similar | 2.7.0 | indirect |
| crates.io | slab | 0.4.12 | indirect |
| crates.io | syn | 2.0.117 | indirect |
| crates.io | tempfile | 3.27.0 | indirect |
| crates.io | typeid | 1.0.3 | indirect |
| crates.io | ucd-trie | 0.1.7 | indirect |
| crates.io | unicode-ident | 1.0.24 | indirect |
| crates.io | unicode-xid | 0.2.6 | indirect |
| crates.io | walkdir | 2.5.0 | indirect |
| crates.io | wasip2 | 1.0.2+wasi-0.2.9 | indirect |
| crates.io | wasip3 | 0.4.0+wasi-0.3.0-rc-2026-01-06 | indirect |
| crates.io | wasm-bindgen | 0.2.117 | indirect |
| crates.io | wasm-bindgen-futures | 0.4.67 | indirect |
| crates.io | wasm-bindgen-macro | 0.2.117 | indirect |
| crates.io | wasm-bindgen-macro-support | 0.2.117 | indirect |
| crates.io | wasm-bindgen-shared | 0.2.117 | indirect |
| crates.io | wasm-bindgen-test | 0.3.67 | indirect |
| crates.io | wasm-bindgen-test-macro | 0.3.67 | indirect |
| crates.io | wasm-bindgen-test-shared | 0.2.117 | indirect |
| crates.io | wasm-encoder | 0.244.0 | indirect |
| crates.io | wasm-metadata | 0.244.0 | indirect |
| crates.io | wasmparser | 0.244.0 | indirect |
| crates.io | winapi-util | 0.1.11 | indirect |
| crates.io | windows-link | 0.2.1 | indirect |
| crates.io | windows-sys | 0.61.2 | indirect |
| crates.io | winreg | 0.56.0 | indirect |
| crates.io | wit-bindgen | 0.51.0 | indirect |
| crates.io | wit-bindgen-core | 0.51.0 | indirect |
| crates.io | wit-bindgen-rust | 0.51.0 | indirect |
| crates.io | wit-bindgen-rust-macro | 0.51.0 | indirect |
| crates.io | wit-component | 0.244.0 | indirect |
| crates.io | wit-parser | 0.244.0 | indirect |
| crates.io | zmij | 1.0.21 | indirect |
This repository publishes no package the index resolves, so its own dependency graph was assessed — 91 packages, which also include development and test pins that never ship: 1 carry known advisories, of which 0 are direct.
| Package | Version | Relation | Severity | Advisories | Fixed in |
|---|---|---|---|---|---|
| anyhow | 1.0.102 | indirect | unknown | 1 | 1.0.103 |
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.31.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — crates.io.