Find what broke in your agent calls. Pin it so it never ships again. Local voice-agent call forensics and regression guards.
attenlabs/hotato holds a health index of 78 out of 100, placing it in the Good band. It scores highest on Engineering Quality (100/100) and lowest on Community & Adoption (46/100). It was last updated 11 days ago. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 67 is calibrated to 78 on the published index scale (record calibration 2026-08-02).
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| PyPI | hotato | 1.20.0 | 1,680 | 53 | 13 days ago | hotatoconversation-qavoice-aivoice-agentsai-agentsvoice-agent-testingllm-evalevalsregression-testingciself-hostedofflinebarge-inturn-takingreliabilityobservabilitymcpagent-nativeollamalivekitpipecatvapiretelltwilio |
Is the project alive — is code being written and are releases shipping?
| 28.8/36 | Push recency — last push 11 days ago |
| 4.2/36 | Commit cadence — 6/52 weeks with commits |
| 18/18 | Commit volume — 600 commits in the last year |
| 0/10 | OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully |
| commits_last_year | 600 |
| human_commit_share | 1 |
| days_since_last_push | 11 |
| active_weeks_last_year | 6 |
| 27/27 | Ships releases — 51 releases published |
| 36/36 | Release recency — latest release 23 days ago |
| 27/27 | Release cadence — a release every ~0.9 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 51 |
| latest_release_tag | v1.18.1 |
| releases_from_tags | no |
| days_since_latest_release | 23 |
| mean_days_between_releases | 0.9 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 0/60 | Stars — 1 stars |
| 0/25 | Forks — 0 forks |
| 0/15 | Watchers — 0 watchers |
| forks | 0 |
| stars | 1 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 18/18 | CONTRIBUTING guide |
| 13.5/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 6.3/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | 5 |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | yes |
| readme_badge_services | github.com, shields.io |
| has_pull_request_template | yes |
| 43/80 | Monthly downloads — 1,680 downloads/month across pypi |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | hotato |
| dependents | — |
| ecosystems | pypi |
| total_downloads | — |
| monthly_downloads | 1,680 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0.2/22.5 | Commit distribution — top contributor authored 99% of commits |
| 2.7/13.5 | Contributor breadth — 2 contributors |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 1 |
| contributors_sampled | 2 |
| top_contributor_share | 0.99 |
| 31.5/42 | Issue resolution — 75% of issues closed |
| 25.3/30 | PR acceptance — 43/51 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 43 |
| open_issues | 2 |
| closed_issues | 6 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 12 |
| prs_decided_30d | 14 |
| issue_closed_ratio | 0.75 |
| closed_unmerged_prs | 8 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
| 30/30 | Ownership backing — organization-owned |
| 0/20 | Verified domain |
| 8/25 | Owner reach — 12 followers of attenlabs |
| 15.5/25 | Track record — 2 public repos, account ~6 yr old |
| followers | 12 |
| owner_type | Organization |
| is_verified | no |
| owner_login | attenlabs |
| public_repos | 2 |
| account_age_days | 2,250 |
| 25/25 | Published & resolvable — 1 package(s) on pypi |
| 35/35 | Publish recency — latest publish 13 days ago |
| 20/20 | Version history — 53 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | hotato |
| ecosystems | pypi |
| any_deprecated | no |
| min_days_since_publish | 13 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 6 workflow(s) |
| 24/24 | Tests present |
| 16/16 | Linter config — pyproject.toml ([tool.ruff]) |
| 9.6/9.6 | Pre-commit hooks |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | yes |
| has_linter_config | yes |
| has_precommit_config | yes |
| 30/30 | README |
| 25/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://hotato.dev |
| 10/10 | Repository description |
| 10/10 | Topics — 8 topics |
| 10/10 | Wiki |
| topics | voice-agents, regression-testing, retell, vapi, call-analysis, forensics, testing, voice-ai |
| has_wiki | yes |
| homepage | https://hotato.dev |
| docs_site | https://hotato.dev |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — no data |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 0/7.5 | Maintained — project was created within the last 90 days. Please review its contents carefully |
| 5/5 | Packaging — packaging workflow detected |
| 2/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
| 5/5 | SAST — SAST tool detected: CodeQL |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 7.5/7.5 | Token-Permissions — GitHub workflow tokens follow principle of least privilege |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 6.3 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 45/45 | Agent instructions — AGENTS.md |
| 15/15 | Machine-readable docs (llms.txt) — llms.txt present |
| 40/40 | Legible commit history — 100 of 100 human commits state their intent (structured subject or explanatory body) |
| has_llms_txt | yes |
| llms_txt_url | — |
| legible_history_share | 1 |
| agent_instruction_files | AGENTS.md |
| agent_instruction_max_bytes | 10,985 |
| 18/18 | One-command bootstrap — examples/reference-agent/Makefile |
| 22/22 | Automated tests |
| 11/11 | Lint / format config — pyproject.toml ([tool.ruff]) |
| 11/11 | Static type checking — sdk/typescript/tsconfig.json, src/hotato/py.typed |
| 10/10 | Reproducible environment — Dockerfile, lockfile |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 5/8 | Automated maintenance — dependency automation configured, none observed in the sampled commits |
| 4/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
| has_nix | no |
| has_tests | yes |
| lockfiles | package-lock.json |
| has_dockerfile | yes |
| typed_language | no |
| bootstrap_files | examples/reference-agent/Makefile |
| has_devcontainer | no |
| has_linter_config | yes |
| typecheck_configs | sdk/typescript/tsconfig.json, src/hotato/py.typed |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 27/45 | Type-checkable code — Python with type-check config (sdk/typescript/tsconfig.json, src/hotato/py.typed) |
| 52.6/55 | Manageable file sizes — 21/472 source files over 60KB |
| primary_language | Python |
| largest_source_bytes | 556,333 |
| source_files_sampled | 472 |
| oversized_source_files | 21 |
| 0/40 | API schema (OpenAPI/GraphQL/proto) |
| 20/20 | MCP server |
| 40/40 | Runnable examples — examples |
| example_dirs | examples |
| has_mcp_signal | yes |
| api_schema_files | — |
| interfaces_expected_of | network-service |
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/a | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 0 | Maintained | project was created within the last 90 days. Please review its contents carefully |
| 10 | Packaging | packaging workflow detected |
| 4 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 4 |
| 10 | SAST | SAST tool detected: CodeQL |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 10 | Token-Permissions | GitHub workflow tokens follow principle of least privilege |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
The resolved dependency set could not be collected for this report: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — PyPI.