Create graphics with a hand-drawn, sketchy, appearance
rough-stuff/rough holds a health index of 25 out of 100, placing it in the At Risk band. It scores highest on Community & Adoption (75/100) and lowest on Vitality (25/100). It was last updated 744 days ago. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 45 is calibrated to 42 on the published index scale (record calibration 2026-08-02).
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | roughjspoints to another repo — not scored | 4.6.6 | 45,742,088 | 47 | 996 days ago | canvassvggraphicssketchyhand-drawn |
Is the project alive — is code being written and are releases shipping?
Silence alone is never the finding — a small, finished library may need no commits for years. This alert requires both: no human commit for a long time, and obligations the project is visibly not discharging. Automated commits do not count as maintenance.
How abandonment is assessed| 0/36 | Push recency — last push 744 days ago |
| 0/36 | Commit cadence — 0/52 weeks with commits |
| 0/18 | Commit volume — 0 commits in the last year |
| 0/10 | OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0 |
| commits_last_year | 0 |
| human_commit_share | 1 |
| days_since_last_push | 744 |
| active_weeks_last_year | 0 |
| 27/27 | Ships releases — 15 releases published |
| 0/36 | Release recency — latest release 2,708 days ago |
| 27/27 | Release cadence — a release every ~37.3 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 15 |
| latest_release_tag | v3.1.0 |
| releases_from_tags | no |
| days_since_latest_release | 2,708 |
| mean_days_between_releases | 37.3 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 60/60 | Stars — 21,125 stars |
| 23.5/25 | Forks — 664 forks |
| 12.3/15 | Watchers — 161 watchers |
| forks | 664 |
| stars | 21,125 |
| watchers | 161 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | 11 |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | opencollective.com |
| has_pull_request_template | no |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0.7/22.5 | Commit distribution — top contributor authored 97% of commits |
| 13.5/13.5 | Contributor breadth — 10 contributors |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 1 |
| contributors_sampled | 10 |
| top_contributor_share | 0.969 |
| 31.6/42 | Issue resolution — 75% of issues closed |
| 23.1/30 | PR acceptance — 64/83 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/12 approved changesets -- score normalized to 0 |
| merged_prs | 64 |
| open_issues | 36 |
| closed_issues | 110 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 0 |
| prs_decided_30d | 0 |
| issue_closed_ratio | 0.753 |
| closed_unmerged_prs | 19 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
| 30/30 | Ownership backing — organization-owned |
| 0/20 | Verified domain — verified-domain status not read for this organization |
| 16.7/25 | Owner reach — 209 followers of rough-stuff |
| 18.6/25 | Track record — 7 public repos, account ~6 yr old |
| followers | 209 |
| owner_type | Organization |
| is_verified | — |
| owner_login | rough-stuff |
| public_repos | 7 |
| account_age_days | 2,247 |
Are baseline engineering and documentation practices in place?
| 0/24 | CI workflows |
| 0/24 | Tests present |
| 16/16 | Linter config — .eslintrc.json |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — 0 out of 8 merged PRs checked by a CI test -- score normalized to 0 |
| has_ci | no |
| has_tests | no |
| has_editorconfig | no |
| has_linter_config | yes |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Documentation directory |
| 15/15 | Documentation / homepage site — http://roughjs.com |
| 10/10 | Repository description |
| 10/10 | Topics — 6 topics |
| 10/10 | Wiki |
| topics | draw, canvas, graphics, svg, html5-canvas, svg-path |
| has_wiki | yes |
| homepage | http://roughjs.com |
| docs_site | http://roughjs.com |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — 0 out of 8 merged PRs checked by a CI test -- score normalized to 0 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/12 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 0/10 | Dangerous-Workflow — no data |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 0/7.5 | Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — no data |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — no data |
| 0/7.5 | Vulnerabilities — 23 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 13 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 5 |
| scorecard_aggregate | 1.5 |
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 25/25 | Indirect dependencies free of known advisories — no indirect dependency carries a known advisory |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
| source | osv |
| advisories | 0 |
| affected_packages | 0 |
| assessed_packages | 4 |
| unassessed_packages | 0 |
| affected_by_severity | none |
| direct_affected_packages | 0 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 12.3/40 | Legible commit history — 23 of 100 human commits state their intent (structured subject or explanatory body) |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 0.23 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | One-command bootstrap |
| 0/22 | Automated tests |
| 11/11 | Lint / format config — .eslintrc.json |
| 11/11 | Static type checking — tsconfig.json |
| 10/10 | Reproducible environment — lockfile |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 0/8 | Automated maintenance — no automated dependency updates observed |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — no data |
| has_nix | no |
| has_tests | no |
| lockfiles | package-lock.json |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | yes |
| typecheck_configs | tsconfig.json |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 27/45 | Type-checkable code — HTML with type-check config (tsconfig.json) |
| 55/55 | Manageable file sizes — 0/18 source files over 60KB |
| primary_language | HTML |
| largest_source_bytes | 18,207 |
| source_files_sampled | 18 |
| oversized_source_files | 0 |
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Each point covers 9 days.
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 0 | CI-Tests | 0 out of 8 merged PRs checked by a CI test -- score normalized to 0 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/12 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| n/a | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 0 | Maintained | 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0 |
| n/a | Packaging | packaging workflow not detected |
| n/a | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| n/a | Token-Permissions | No tokens found |
| 0 | Vulnerabilities | 23 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| npm | hachure-fill | ^0.5.2 | package.json |
| npm | path-data-parser | ^0.1.0 | package.json |
| npm | points-on-curve | ^0.2.0 | package.json |
| npm | points-on-path | ^0.2.1 | package.json |
Full resolved dependency set from the GitHub dependency graph: 4 direct and 186 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | hachure-fill | 0.5.2 | direct |
| npm | path-data-parser | 0.1.0 | direct |
| npm | points-on-curve | 0.2.0 | direct |
| npm | points-on-path | 0.2.1 | direct |
| npm | @aashutoshrathi/word-wrap | 1.2.6 | indirect |
| npm | @babel/code-frame | 7.12.11 | indirect |
| npm | @babel/helper-validator-identifier | 7.22.20 | indirect |
| npm | @babel/highlight | 7.22.20 | indirect |
| npm | @eslint/eslintrc | 0.4.3 | indirect |
| npm | @humanwhocodes/config-array | 0.5.0 | indirect |
| npm | @humanwhocodes/object-schema | 1.2.1 | indirect |
| npm | @jridgewell/gen-mapping | 0.3.3 | indirect |
| npm | @jridgewell/resolve-uri | 3.1.1 | indirect |
| npm | @jridgewell/set-array | 1.1.2 | indirect |
| npm | @jridgewell/source-map | 0.3.5 | indirect |
| npm | @jridgewell/sourcemap-codec | 1.4.15 | indirect |
| npm | @jridgewell/trace-mapping | 0.3.20 | indirect |
| npm | @nodelib/fs.scandir | 2.1.5 | indirect |
| npm | @nodelib/fs.stat | 2.0.5 | indirect |
| npm | @nodelib/fs.walk | 1.2.8 | indirect |
| npm | @rollup/plugin-node-resolve | 13.3.0 | indirect |
| npm | @rollup/plugin-typescript | 8.5.0 | indirect |
| npm | @rollup/pluginutils | 3.1.0 | indirect |
| npm | @types/estree | 0.0.39 | indirect |
| npm | @types/json-schema | 7.0.15 | indirect |
| npm | @types/node | 20.9.2 | indirect |
| npm | @types/resolve | 1.17.1 | indirect |
| npm | @typescript-eslint/eslint-plugin | 4.33.0 | indirect |
| npm | @typescript-eslint/experimental-utils | 4.33.0 | indirect |
| npm | @typescript-eslint/parser | 4.33.0 | indirect |
| npm | @typescript-eslint/scope-manager | 4.33.0 | indirect |
| npm | @typescript-eslint/types | 4.33.0 | indirect |
| npm | @typescript-eslint/typescript-estree | 4.33.0 | indirect |
| npm | @typescript-eslint/visitor-keys | 4.33.0 | indirect |
| npm | acorn | 7.4.1 | indirect |
| npm | acorn | 8.11.2 | indirect |
| npm | acorn-jsx | 5.3.2 | indirect |
| npm | ajv | 6.12.6 | indirect |
| npm | ajv | 8.12.0 | indirect |
| npm | ansi-colors | 4.1.3 | indirect |
| npm | ansi-regex | 5.0.1 | indirect |
| npm | ansi-styles | 3.2.1 | indirect |
| npm | ansi-styles | 4.3.0 | indirect |
| npm | argparse | 1.0.10 | indirect |
| npm | array-union | 2.1.0 | indirect |
| npm | astral-regex | 2.0.0 | indirect |
| npm | balanced-match | 1.0.2 | indirect |
| npm | brace-expansion | 1.1.11 | indirect |
| npm | braces | 3.0.2 | indirect |
| npm | buffer-from | 1.1.2 | indirect |
| npm | builtin-modules | 3.3.0 | indirect |
| npm | callsites | 3.1.0 | indirect |
| npm | chalk | 2.4.2 | indirect |
| npm | chalk | 4.1.2 | indirect |
| npm | color-convert | 1.9.3 | indirect |
| npm | color-convert | 2.0.1 | indirect |
| npm | color-name | 1.1.3 | indirect |
| npm | color-name | 1.1.4 | indirect |
| npm | commander | 2.20.3 | indirect |
| npm | concat-map | 0.0.1 | indirect |
| npm | cross-spawn | 7.0.3 | indirect |
| npm | debug | 4.3.4 | indirect |
| npm | deep-is | 0.1.4 | indirect |
| npm | deepmerge | 4.3.1 | indirect |
| npm | dir-glob | 3.0.1 | indirect |
| npm | doctrine | 3.0.0 | indirect |
| npm | emoji-regex | 8.0.0 | indirect |
| npm | enquirer | 2.4.1 | indirect |
| npm | escape-string-regexp | 1.0.5 | indirect |
| npm | escape-string-regexp | 4.0.0 | indirect |
| npm | eslint | 7.32.0 | indirect |
| npm | eslint-scope | 5.1.1 | indirect |
| npm | eslint-utils | 2.1.0 | indirect |
| npm | eslint-utils | 3.0.0 | indirect |
| npm | eslint-visitor-keys | 1.3.0 | indirect |
| npm | eslint-visitor-keys | 2.1.0 | indirect |
| npm | espree | 7.3.1 | indirect |
| npm | esprima | 4.0.1 | indirect |
| npm | esquery | 1.5.0 | indirect |
| npm | esrecurse | 4.3.0 | indirect |
| npm | estraverse | 4.3.0 | indirect |
| npm | estraverse | 5.3.0 | indirect |
| npm | estree-walker | 1.0.1 | indirect |
| npm | esutils | 2.0.3 | indirect |
| npm | fast-deep-equal | 3.1.3 | indirect |
| npm | fast-glob | 3.3.2 | indirect |
| npm | fast-json-stable-stringify | 2.1.0 | indirect |
| npm | fast-levenshtein | 2.0.6 | indirect |
| npm | fastq | 1.15.0 | indirect |
| npm | file-entry-cache | 6.0.1 | indirect |
| npm | fill-range | 7.0.1 | indirect |
| npm | flat-cache | 3.2.0 | indirect |
| npm | flatted | 3.2.9 | indirect |
| npm | fs.realpath | 1.0.0 | indirect |
| npm | fsevents | 2.3.3 | indirect |
| npm | function-bind | 1.1.2 | indirect |
| npm | functional-red-black-tree | 1.0.1 | indirect |
| npm | glob | 7.2.3 | indirect |
| npm | glob-parent | 5.1.2 | indirect |
| npm | globals | 13.23.0 | indirect |
| npm | globby | 11.1.0 | indirect |
| npm | has-flag | 3.0.0 | indirect |
| npm | has-flag | 4.0.0 | indirect |
| npm | hasown | 2.0.0 | indirect |
| npm | ignore | 4.0.6 | indirect |
| npm | ignore | 5.3.0 | indirect |
| npm | import-fresh | 3.3.0 | indirect |
| npm | imurmurhash | 0.1.4 | indirect |
| npm | inflight | 1.0.6 | indirect |
| npm | inherits | 2.0.4 | indirect |
| npm | is-builtin-module | 3.2.1 | indirect |
| npm | is-core-module | 2.13.1 | indirect |
| npm | is-extglob | 2.1.1 | indirect |
| npm | is-fullwidth-code-point | 3.0.0 | indirect |
| npm | is-glob | 4.0.3 | indirect |
| npm | is-module | 1.0.0 | indirect |
| npm | is-number | 7.0.0 | indirect |
| npm | isexe | 2.0.0 | indirect |
| npm | jest-worker | 26.6.2 | indirect |
| npm | js-tokens | 4.0.0 | indirect |
| npm | js-yaml | 3.14.1 | indirect |
| npm | json-buffer | 3.0.1 | indirect |
| npm | json-schema-traverse | 0.4.1 | indirect |
| npm | json-schema-traverse | 1.0.0 | indirect |
| npm | json-stable-stringify-without-jsonify | 1.0.1 | indirect |
| npm | keyv | 4.5.4 | indirect |
| npm | levn | 0.4.1 | indirect |
| npm | lodash.merge | 4.6.2 | indirect |
| npm | lodash.truncate | 4.4.2 | indirect |
| npm | lru-cache | 6.0.0 | indirect |
| npm | merge-stream | 2.0.0 | indirect |
| npm | merge2 | 1.4.1 | indirect |
| npm | micromatch | 4.0.5 | indirect |
| npm | minimatch | 3.1.2 | indirect |
| npm | ms | 2.1.2 | indirect |
| npm | natural-compare | 1.4.0 | indirect |
| npm | once | 1.4.0 | indirect |
| npm | optionator | 0.9.3 | indirect |
| npm | parent-module | 1.0.1 | indirect |
| npm | path-is-absolute | 1.0.1 | indirect |
| npm | path-key | 3.1.1 | indirect |
| npm | path-parse | 1.0.7 | indirect |
| npm | path-type | 4.0.0 | indirect |
| npm | picomatch | 2.3.1 | indirect |
| npm | prelude-ls | 1.2.1 | indirect |
| npm | progress | 2.0.3 | indirect |
| npm | punycode | 2.3.1 | indirect |
| npm | queue-microtask | 1.2.3 | indirect |
| npm | randombytes | 2.1.0 | indirect |
| npm | regexpp | 3.2.0 | indirect |
| npm | require-from-string | 2.0.2 | indirect |
| npm | resolve | 1.22.8 | indirect |
| npm | resolve-from | 4.0.0 | indirect |
| npm | reusify | 1.0.4 | indirect |
| npm | rimraf | 3.0.2 | indirect |
| npm | rollup | 2.79.1 | indirect |
| npm | rollup-plugin-terser | 7.0.2 | indirect |
| npm | run-parallel | 1.2.0 | indirect |
| npm | safe-buffer | 5.2.1 | indirect |
| npm | semver | 7.5.4 | indirect |
| npm | serialize-javascript | 4.0.0 | indirect |
| npm | shebang-command | 2.0.0 | indirect |
| npm | shebang-regex | 3.0.0 | indirect |
| npm | slash | 3.0.0 | indirect |
| npm | slice-ansi | 4.0.0 | indirect |
| npm | source-map | 0.6.1 | indirect |
| npm | source-map-support | 0.5.21 | indirect |
| npm | sprintf-js | 1.0.3 | indirect |
| npm | string-width | 4.2.3 | indirect |
| npm | strip-ansi | 6.0.1 | indirect |
| npm | strip-json-comments | 3.1.1 | indirect |
| npm | supports-color | 5.5.0 | indirect |
| npm | supports-color | 7.2.0 | indirect |
| npm | supports-preserve-symlinks-flag | 1.0.0 | indirect |
| npm | table | 6.8.1 | indirect |
| npm | terser | 5.24.0 | indirect |
| npm | text-table | 0.2.0 | indirect |
| npm | to-regex-range | 5.0.1 | indirect |
| npm | tslib | 1.14.1 | indirect |
| npm | tslib | 2.6.2 | indirect |
| npm | tsutils | 3.21.0 | indirect |
| npm | type-check | 0.4.0 | indirect |
| npm | type-fest | 0.20.2 | indirect |
| npm | typescript | 4.9.5 | indirect |
| npm | undici-types | 5.26.5 | indirect |
| npm | uri-js | 4.4.1 | indirect |
| npm | v8-compile-cache | 2.4.0 | indirect |
| npm | which | 2.0.2 | indirect |
| npm | wrappy | 1.0.2 | indirect |
| npm | yallist | 4.0.0 | indirect |
Installing npm:roughjs@4.6.6 pulls in 4 packages, direct and transitive: 0 carry known advisories, of which 0 are direct dependencies.
No known advisories affect the assessed dependencies.
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.31.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.