Public recordModerate
Software health reportschema 0.34.0 · metrics 2.10.0 · 2026-09-05 14:51 UTC
volcanicminds / volcanic-backend
The volcanic (minds) backend
volcanicminds/volcanic-backend holds a health index of 59 out of 100, placing it in the Moderate band. It scores highest on Engineering Quality (88/100) and lowest on Community & Adoption (30/100). It was last updated 52 days ago. A single contributor accounts for most of its recent work.
59
overall / 100Software health index
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
59
Exceptional93-100The record's top tier (≈ top 5%); essentially all checked criteria met
Excellent80-92Strong across the board; minor gaps
Good65-79Healthy; gaps are limited and manageable
Moderate50-64Acceptable with notable gaps; review recommended
Weak35-49Material weaknesses across several areas
At Risk20-34Significant weaknesses; adoption warrants caution
Critical1-19Severe problems (abandoned, single-maintainer, no hygiene)
Score profile
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 56 is calibrated to 59 on the published index scale (record calibration 2026-08-02).
Ownership
Volcanic MindsOrganization
1 follower15 public repossince Aug 2022
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
Package ecosystems
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | @volcanicminds/backend | 4.0.3 | 1,028 | 131 | 52 days ago | volcanicopen-sourceapiframeworkbackendhttphttpsfastifyswaggerhelmetjsontypescriptjavascriptrestrestfulpinorate-limitjest |
Metrics by category
Vitality
Is the project alive — is code being written and are releases shipping?
65
Development activity
60Moderate
How it's scored
| 18/36 | Push recency — last push 52 days ago |
| 14.5/36 | Commit cadence — 21/52 weeks with commits |
| 18/18 | Commit volume — 209 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Inputs used
| commits_last_year | 209 |
| human_commit_share | 0.96 |
| days_since_last_push | 52 |
| active_weeks_last_year | 21 |
Release discipline
72Good
How it's scored
| 16.2/27 | Ships releases — 1 version tags (no GitHub releases) |
| 36/36 | Release recency — latest release 60 days ago |
| 12.6/27 | Release cadence — cadence unknown (single release) |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
Inputs used
| releases_count | 1 |
| latest_release_tag | v3.6.2 |
| releases_from_tags | yes |
| days_since_latest_release | 60 |
| mean_days_between_releases | — |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.
Community & Adoption
Does the project have users, downloads, attention, and a welcoming setup for contributors?
30
Popularity & adoption
1Critical
How it's scored
| 0/60 | Stars — 1 stars |
| 0/25 | Forks — 0 forks |
| 0/15 | Watchers — 1 watchers |
Inputs used
| forks | 0 |
| stars | 1 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community health
50Moderate
How it's scored
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
Inputs used
| has_readme | yes |
| has_license | yes |
| readme_badges | 5 |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | github.com, shields.io |
| has_pull_request_template | no |
Ecosystem adoption (downloads)
50Moderate
How it's scored
| 40.2/80 | Monthly downloads — 1,028 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
Inputs used
| packages | @volcanicminds/backend |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 1,028 |
| unverified_packages_excluded | — |
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.
Sustainability & Governance
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
45
Maintainer resilience (bus factor)
21At Risk
How it's scored
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0.4/22.5 | Commit distribution — top contributor authored 98% of commits |
| 5.4/13.5 | Contributor breadth — 4 contributors |
| 6/10 | OpenSSF Scorecard: Contributors — project has 2 contributing companies or organizations -- score normalized to 6 |
Inputs used
| bus_factor | 1 |
| contributors_sampled | 4 |
| top_contributor_share | 0.983 |
Issue & PR responsiveness
25At Risk
How it's scored
| 0/42 | Issue resolution — no issues or no data |
| 11.1/30 | PR acceptance — 10/27 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Inputs used
| merged_prs | 10 |
| open_issues | 0 |
| closed_issues | 0 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 0 |
| prs_decided_30d | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 17 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
Excluded from scoring (no data or not applicable): Issue resolution, Newcomer PR acceptance. Remaining weights renormalized.
Ownership & stewardship
49Weak
How it's scored
| 30/30 | Ownership backing — organization-owned |
| 0/20 | Verified domain |
| 2.2/25 | Owner reach — 1 followers of volcanicminds |
| 16.9/25 | Track record — 15 public repos, account ~4 yr old |
Inputs used
| followers | 1 |
| owner_type | Organization |
| is_verified | no |
| owner_login | volcanicminds |
| public_repos | 15 |
| account_age_days | 1,494 |
Package maintenance
100Exceptional
How it's scored
| 25/25 | Published & resolvable — 1 package(s) on npm |
| 35/35 | Publish recency — latest publish 52 days ago |
| 20/20 | Version history — 131 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
Inputs used
| packages | @volcanicminds/backend |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 52 |
Engineering Quality
Are baseline engineering and documentation practices in place?
88
Engineering practices
80Excellent
How it's scored
| 24/24 | CI workflows — 1 workflow(s) |
| 24/24 | Tests present |
| 16/16 | Linter config — eslint.config.js |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
Inputs used
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | yes |
| has_precommit_config | no |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.
Documentation
100Exceptional
How it's scored
| 30/30 | README |
| 25/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://volcanicminds.github.io/volcanic-backend/ |
| 10/10 | Repository description |
| 10/10 | Topics — 6 topics |
| 10/10 | Wiki |
Inputs used
| topics | apollo, backend, fastify, graphql, nodejs, swagger |
| has_wiki | yes |
| homepage | https://volcanicminds.github.io/volcanic-backend/ |
| docs_site | https://volcanicminds.github.io/volcanic-backend/ |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Security
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
45
Security posture
37Weak
How it's scored
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 1.5/2.5 | Contributors — project has 2 contributing companies or organizations -- score normalized to 6 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 1/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 30 existing vulnerabilities detected |
Inputs used
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 3.7 |
Excluded from scoring (no data or not applicable): CI-Tests, Signed-Releases. Remaining weights renormalized.
Dependency advisories
79Good
How it's scored
| 14/35 | Direct dependencies free of known advisories — 1 affected: @fastify/static 9.3.0 (high 7.5) |
| 25/25 | Indirect dependencies free of known advisories — no indirect dependency carries a known advisory |
| 40/40 | No advisories left outstanding — no advisory has been public longer than 90 days |
Inputs used
| source | osv |
| advisories | 2 |
| affected_packages | 1 |
| assessed_packages | 169 |
| unassessed_packages | 0 |
| affected_by_severity | high 1 |
| direct_affected_packages | 1 |
Matched the npm:@volcanicminds/backend@4.0.3 runtime dependency closure — what installing the published package pulls in — 169 packages. Reachability is not analyzed.
AI Readiness
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
84
Agent context & guidance
100Exceptional
How it's scored
| 45/45 | Agent instructions — CLAUDE.md |
| 15/15 | Machine-readable docs (llms.txt) — llms.txt present |
| 40/40 | Legible commit history — 85 of 96 human commits state their intent (structured subject or explanatory body) |
Inputs used
| has_llms_txt | yes |
| llms_txt_url | — |
| legible_history_share | 0.885 |
| agent_instruction_files | CLAUDE.md |
| agent_instruction_max_bytes | 7,371 |
How it's scored
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 11/11 | Lint / format config — eslint.config.js |
| 11/11 | Static type checking — tsconfig.json |
| 10/10 | Reproducible environment — Dockerfile, lockfile |
| 10/10 | Demonstrated agent practice — 60 of the last 100 commits agent-authored or agent-credited |
| 0/8 | Automated maintenance — no automated dependency updates observed |
| 2/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
Inputs used
| has_nix | no |
| has_tests | yes |
| lockfiles | package-lock.json |
| has_dockerfile | yes |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | yes |
| typecheck_configs | tsconfig.json |
| agent_commit_share | 0.6 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Code legibility for models
100Exceptional
How it's scored
| 45/45 | Type-checkable code — TypeScript (statically typed) |
| 55/55 | Manageable file sizes — 0/179 source files over 60KB |
Inputs used
| primary_language | TypeScript |
| largest_source_bytes | 28,034 |
| source_files_sampled | 179 |
| oversized_source_files | 0 |
Key facts
1GitHub stars
4contributors
209commits, last 12 months
52days since last push
1releases
1bus factor
0open issues
npmpackage ecosystems
Data collection warnings
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
More detail
OpenSSF Scorecard 3.7 / 10
3.7aggregate
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 6 | Contributors | project has 2 contributing companies or organizations -- score normalized to 6 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 2 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 2 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 30 existing vulnerabilities detected |
Direct dependencies 25
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| npm | @fastify/compress | ^8.3.0 | package.json |
| npm | @fastify/cookie | ^11.0.2 | package.json |
| npm | @fastify/cors | ^11.2.0 | package.json |
| npm | @fastify/helmet | ^13.0.2 | package.json |
| npm | @fastify/jwt | ^10.1.0 | package.json |
| npm | @fastify/multipart | ^9.3.0 | package.json |
| npm | @fastify/rate-limit | ^10.3.0 | package.json |
| npm | @fastify/schedule | ^6.0.0 | package.json |
| npm | @fastify/static | ^9.1.3 | package.json |
| npm | @fastify/swagger | ^9.6.1 | package.json |
| npm | @fastify/swagger-ui | ^5.2.3 | package.json |
| npm | dayjs | ^1.11.19 | package.json |
| npm | dotenv | ^17.2.3 | package.json |
| npm | fastify | ^5.6.2 | package.json |
| npm | fastify-raw-body | ^5.0.0 | package.json |
| npm | glob | ^13.0.0 | package.json |
| npm | i18n | ^0.15.3 | package.json |
| npm | lodash | ^4.17.21 | package.json |
| npm | nanoid | ^5.1.6 | package.json |
| npm | object-sizeof | ^2.6.5 | package.json |
| npm | pino | ^10.1.0 | package.json |
| npm | pino-pretty | ^13.1.3 | package.json |
| npm | root-require | ^0.3.1 | package.json |
| npm | semver | ^7.7.3 | package.json |
| npm | toad-scheduler | ^3.1.0 | package.json |
All dependencies 645
Full resolved dependency set from the GitHub dependency graph: 28 direct and 617 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | @fastify/compress | 8.3.0 | direct |
| npm | @fastify/cookie | 11.0.2 | direct |
| npm | @fastify/cors | 11.2.0 | direct |
| npm | @fastify/helmet | 13.0.2 | direct |
| npm | @fastify/jwt | 10.1.0 | direct |
| npm | @fastify/multipart | 9.3.0 | direct |
| npm | @fastify/rate-limit | 10.3.0 | direct |
| npm | @fastify/schedule | 6.0.0 | direct |
| npm | @fastify/static | 9.1.3 | direct |
| npm | @fastify/swagger | 9.6.1 | direct |
| npm | @fastify/swagger-ui | 5.2.6 | direct |
| npm | dayjs | 1.11.21 | direct |
| npm | dotenv | 16.6.1 | direct |
| npm | dotenv | 17.2.3 | direct |
| npm | fastify | 5.8.5 | direct |
| npm | fastify-raw-body | 5.0.0 | direct |
| npm | glob | 10.5.0 | direct |
| npm | glob | 13.0.0 | direct |
| npm | glob | 7.1.6 | direct |
| npm | i18n | 0.15.3 | direct |
| npm | lodash | 4.18.1 | direct |
| npm | nanoid | 5.1.6 | direct |
| npm | object-sizeof | 2.6.5 | direct |
| npm | pino | 10.1.0 | direct |
| npm | pino-pretty | 13.1.3 | direct |
| npm | root-require | 0.3.1 | direct |
| npm | semver | 7.8.5 | direct |
| npm | toad-scheduler | 3.1.0 | direct |
| npm | @assemblyscript/loader | 0.19.23 | indirect |
| npm | @babel/code-frame | 7.27.1 | indirect |
| npm | @babel/helper-validator-identifier | 7.28.5 | indirect |
| npm | @colors/colors | 1.5.0 | indirect |
| npm | @cspotcode/source-map-support | 0.8.1 | indirect |
| npm | @electric-sql/pglite | 0.5.3 | indirect |
| npm | @electric-sql/pglite-pgvector | 0.0.4 | indirect |
| npm | @epic-web/invariant | 1.0.0 | indirect |
| npm | @esbuild/aix-ppc64 | 0.27.2 | indirect |
| npm | @esbuild/android-arm | 0.27.2 | indirect |
| npm | @esbuild/android-arm64 | 0.27.2 | indirect |
| npm | @esbuild/android-x64 | 0.27.2 | indirect |
| npm | @esbuild/darwin-arm64 | 0.27.2 | indirect |
| npm | @esbuild/darwin-x64 | 0.27.2 | indirect |
| npm | @esbuild/freebsd-arm64 | 0.27.2 | indirect |
| npm | @esbuild/freebsd-x64 | 0.27.2 | indirect |
| npm | @esbuild/linux-arm | 0.27.2 | indirect |
| npm | @esbuild/linux-arm64 | 0.27.2 | indirect |
| npm | @esbuild/linux-ia32 | 0.27.2 | indirect |
| npm | @esbuild/linux-loong64 | 0.27.2 | indirect |
| npm | @esbuild/linux-mips64el | 0.27.2 | indirect |
| npm | @esbuild/linux-ppc64 | 0.27.2 | indirect |
| npm | @esbuild/linux-riscv64 | 0.27.2 | indirect |
| npm | @esbuild/linux-s390x | 0.27.2 | indirect |
| npm | @esbuild/linux-x64 | 0.27.2 | indirect |
| npm | @esbuild/netbsd-arm64 | 0.27.2 | indirect |
| npm | @esbuild/netbsd-x64 | 0.27.2 | indirect |
| npm | @esbuild/openbsd-arm64 | 0.27.2 | indirect |
| npm | @esbuild/openbsd-x64 | 0.27.2 | indirect |
| npm | @esbuild/openharmony-arm64 | 0.27.2 | indirect |
| npm | @esbuild/sunos-x64 | 0.27.2 | indirect |
| npm | @esbuild/win32-arm64 | 0.27.2 | indirect |
| npm | @esbuild/win32-ia32 | 0.27.2 | indirect |
| npm | @esbuild/win32-x64 | 0.27.2 | indirect |
| npm | @eslint-community/eslint-utils | 4.9.0 | indirect |
| npm | @eslint-community/regexpp | 4.12.2 | indirect |
| npm | @eslint/config-array | 0.21.1 | indirect |
| npm | @eslint/config-helpers | 0.4.2 | indirect |
| npm | @eslint/core | 0.17.0 | indirect |
| npm | @eslint/eslintrc | 3.3.3 | indirect |
| npm | @eslint/js | 9.39.2 | indirect |
| npm | @eslint/object-schema | 2.1.7 | indirect |
| npm | @eslint/plugin-kit | 0.4.1 | indirect |
| npm | @fastify/accept-negotiator | 2.0.1 | indirect |
| npm | @fastify/ajv-compiler | 4.0.5 | indirect |
| npm | @fastify/busboy | 3.2.0 | indirect |
| npm | @fastify/deepmerge | 3.1.0 | indirect |
| npm | @fastify/error | 4.2.0 | indirect |
| npm | @fastify/fast-json-stringify-compiler | 5.0.3 | indirect |
| npm | @fastify/forwarded | 3.0.1 | indirect |
| npm | @fastify/merge-json-schemas | 0.2.1 | indirect |
| npm | @fastify/proxy-addr | 5.1.0 | indirect |
| npm | @fastify/send | 4.1.0 | indirect |
| npm | @humanfs/core | 0.19.1 | indirect |
| npm | @humanfs/node | 0.16.7 | indirect |
| npm | @humanwhocodes/module-importer | 1.0.1 | indirect |
| npm | @humanwhocodes/retry | 0.4.3 | indirect |
| npm | @isaacs/cliui | 8.0.2 | indirect |
| npm | @jest/diff-sequences | 30.0.1 | indirect |
| npm | @jest/expect-utils | 30.2.0 | indirect |
| npm | @jest/get-type | 30.1.0 | indirect |
| npm | @jest/pattern | 30.0.1 | indirect |
| npm | @jest/schemas | 30.0.5 | indirect |
| npm | @jest/types | 30.2.0 | indirect |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirect |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirect |
| npm | @jridgewell/trace-mapping | 0.3.9 | indirect |
| npm | @lukeed/ms | 2.0.2 | indirect |
| npm | @messageformat/core | 3.4.0 | indirect |
| npm | @messageformat/date-skeleton | 1.1.0 | indirect |
| npm | @messageformat/number-skeleton | 1.2.0 | indirect |
| npm | @messageformat/parser | 5.1.1 | indirect |
| npm | @messageformat/runtime | 3.0.2 | indirect |
| npm | @minimistjs/subarg | 1.0.0 | indirect |
| npm | @pinojs/redact | 0.4.0 | indirect |
| npm | @pkgjs/parseargs | 0.11.0 | indirect |
| npm | @sinclair/typebox | 0.34.41 | indirect |
| npm | @sqltools/formatter | 1.2.5 | indirect |
| npm | @tsconfig/node10 | 1.0.12 | indirect |
| npm | @tsconfig/node12 | 1.0.11 | indirect |
| npm | @tsconfig/node14 | 1.0.3 | indirect |
| npm | @tsconfig/node16 | 1.0.4 | indirect |
| npm | @types/bcrypt | 6.0.0 | indirect |
| npm | @types/estree | 1.0.8 | indirect |
| npm | @types/istanbul-lib-coverage | 2.0.6 | indirect |
| npm | @types/istanbul-lib-report | 3.0.3 | indirect |
| npm | @types/istanbul-reports | 3.0.4 | indirect |
| npm | @types/json-schema | 7.0.15 | indirect |
| npm | @types/mocha | 10.0.10 | indirect |
| npm | @types/node | 24.10.4 | indirect |
| npm | @types/pg | 8.20.0 | indirect |
| npm | @types/pluralize | 0.0.33 | indirect |
| npm | @types/semver | 7.7.1 | indirect |
| npm | @types/stack-utils | 2.0.3 | indirect |
| npm | @types/yargs | 17.0.35 | indirect |
| npm | @types/yargs-parser | 21.0.3 | indirect |
| npm | @typescript-eslint/eslint-plugin | 8.50.0 | indirect |
| npm | @typescript-eslint/parser | 8.50.0 | indirect |
| npm | @typescript-eslint/project-service | 8.50.0 | indirect |
| npm | @typescript-eslint/scope-manager | 8.50.0 | indirect |
| npm | @typescript-eslint/tsconfig-utils | 8.50.0 | indirect |
| npm | @typescript-eslint/type-utils | 8.50.0 | indirect |
| npm | @typescript-eslint/types | 8.50.0 | indirect |
| npm | @typescript-eslint/typescript-estree | 8.50.0 | indirect |
| npm | @typescript-eslint/utils | 8.50.0 | indirect |
| npm | @typescript-eslint/visitor-keys | 8.50.0 | indirect |
| npm | abort-controller | 3.0.0 | indirect |
| npm | abstract-logging | 2.0.1 | indirect |
| npm | acorn | 8.17.0 | indirect |
| npm | acorn-jsx | 5.3.2 | indirect |
| npm | acorn-jsx-walk | 2.0.0 | indirect |
| npm | acorn-loose | 8.5.2 | indirect |
| npm | acorn-walk | 8.3.5 | indirect |
| npm | ajv | 6.15.0 | indirect |
| npm | ajv | 8.20.0 | indirect |
| npm | ajv-formats | 3.0.1 | indirect |
| npm | ansi-colors | 4.1.1 | indirect |
| npm | ansi-regex | 3.0.1 | indirect |
| npm | ansi-regex | 4.1.1 | indirect |
| npm | ansi-regex | 5.0.1 | indirect |
| npm | ansi-regex | 6.2.2 | indirect |
| npm | ansi-styles | 3.2.1 | indirect |
| npm | ansi-styles | 4.3.0 | indirect |
| npm | ansi-styles | 5.2.0 | indirect |
| npm | ansi-styles | 6.2.3 | indirect |
| npm | ansis | 4.3.1 | indirect |
| npm | anymatch | 3.1.3 | indirect |
| npm | app-root-path | 3.1.0 | indirect |
| npm | arg | 4.1.3 | indirect |
| npm | argparse | 1.0.10 | indirect |
| npm | argparse | 2.0.1 | indirect |
| npm | array-buffer-byte-length | 1.0.2 | indirect |
| npm | array.prototype.map | 1.0.8 | indirect |
| npm | arraybuffer.prototype.slice | 1.0.4 | indirect |
| npm | asn1.js | 5.4.1 | indirect |
| npm | async-function | 1.0.0 | indirect |
| npm | asynckit | 0.4.0 | indirect |
| npm | atomic-sleep | 1.0.0 | indirect |
| npm | autocannon | 8.0.0 | indirect |
| npm | available-typed-arrays | 1.0.7 | indirect |
| npm | avvio | 9.1.0 | indirect |
| npm | balanced-match | 1.0.2 | indirect |
| npm | balanced-match | 4.0.4 | indirect |
| npm | base64-js | 1.5.1 | indirect |
| npm | bcrypt | 6.0.0 | indirect |
| npm | binary-extensions | 2.3.0 | indirect |
| npm | bn.js | 4.12.3 | indirect |
| npm | brace-expansion | 1.1.15 | indirect |
| npm | brace-expansion | 2.1.1 | indirect |
| npm | brace-expansion | 5.0.6 | indirect |
| npm | braces | 3.0.3 | indirect |
| npm | browser-stdout | 1.3.1 | indirect |
| npm | buffer | 5.7.1 | indirect |
| npm | buffer | 6.0.3 | indirect |
| npm | buffer-from | 1.1.2 | indirect |
| npm | bytes | 3.1.2 | indirect |
| npm | call-bind | 1.0.9 | indirect |
| npm | call-bind-apply-helpers | 1.0.2 | indirect |
| npm | call-bound | 1.0.4 | indirect |
| npm | callsites | 3.1.0 | indirect |
| npm | camelcase | 5.3.1 | indirect |
| npm | chalk | 4.1.2 | indirect |
| npm | char-spinner | 1.0.1 | indirect |
| npm | chokidar | 3.4.2 | indirect |
| npm | ci-info | 4.3.1 | indirect |
| npm | cli-table3 | 0.6.5 | indirect |
| npm | cliui | 5.0.0 | indirect |
| npm | cliui | 8.0.1 | indirect |
| npm | color-convert | 1.9.3 | indirect |
| npm | color-convert | 2.0.1 | indirect |
| npm | color-name | 1.1.3 | indirect |
| npm | color-name | 1.1.4 | indirect |
| npm | color-support | 1.1.3 | indirect |
| npm | colorette | 2.0.20 | indirect |
| npm | combined-stream | 1.0.8 | indirect |
| npm | commander | 15.0.0 | indirect |
| npm | concat-map | 0.0.1 | indirect |
| npm | content-disposition | 1.1.0 | indirect |
| npm | cookie | 1.1.1 | indirect |
| npm | core-util-is | 1.0.2 | indirect |
| npm | create-require | 1.1.1 | indirect |
| npm | croner | 8.1.2 | indirect |
| npm | cross-argv | 2.0.0 | indirect |
| npm | cross-env | 10.1.0 | indirect |
| npm | cross-spawn | 7.0.6 | indirect |
| npm | data-view-buffer | 1.0.2 | indirect |
| npm | data-view-byte-length | 1.0.2 | indirect |
| npm | data-view-byte-offset | 1.0.1 | indirect |
| npm | dateformat | 4.6.3 | indirect |
| npm | debug | 4.1.1 | indirect |
| npm | debug | 4.4.3 | indirect |
| npm | decamelize | 1.2.0 | indirect |
| npm | dedent | 1.7.2 | indirect |
| npm | deep-is | 0.1.4 | indirect |
| npm | define-data-property | 1.1.4 | indirect |
| npm | define-properties | 1.2.1 | indirect |
| npm | delayed-stream | 1.0.0 | indirect |
| npm | depd | 2.0.0 | indirect |
| npm | dependency-cruiser | 18.0.0 | indirect |
| npm | dequal | 2.0.3 | indirect |
| npm | diff | 4.0.2 | indirect |
| npm | diff | 4.0.4 | indirect |
| npm | dunder-proto | 1.0.1 | indirect |
| npm | duplexify | 3.7.1 | indirect |
| npm | duplexify | 4.1.3 | indirect |
| npm | eastasianwidth | 0.2.0 | indirect |
| npm | ecdsa-sig-formatter | 1.0.11 | indirect |
| npm | emoji-regex | 7.0.3 | indirect |
| npm | emoji-regex | 8.0.0 | indirect |
| npm | emoji-regex | 9.2.2 | indirect |
| npm | end-of-stream | 1.4.5 | indirect |
| npm | enhanced-resolve | 5.24.1 | indirect |
| npm | es-abstract | 1.24.2 | indirect |
| npm | es-abstract-get | 1.0.0 | indirect |
| npm | es-array-method-boxes-properly | 1.0.0 | indirect |
| npm | es-define-property | 1.0.1 | indirect |
| npm | es-errors | 1.3.0 | indirect |
| npm | es-get-iterator | 1.1.3 | indirect |
| npm | es-object-atoms | 1.1.2 | indirect |
| npm | es-set-tostringtag | 2.1.0 | indirect |
| npm | es-to-primitive | 1.3.4 | indirect |
| npm | esbuild | 0.27.2 | indirect |
| npm | escalade | 3.2.0 | indirect |
| npm | escape-html | 1.0.3 | indirect |
| npm | escape-string-regexp | 2.0.0 | indirect |
| npm | escape-string-regexp | 4.0.0 | indirect |
| npm | eslint | 9.39.2 | indirect |
| npm | eslint-scope | 8.4.0 | indirect |
| npm | eslint-visitor-keys | 3.4.3 | indirect |
| npm | eslint-visitor-keys | 4.2.1 | indirect |
| npm | espree | 10.4.0 | indirect |
| npm | esprima | 4.0.1 | indirect |
| npm | esquery | 1.6.0 | indirect |
| npm | esrecurse | 4.3.0 | indirect |
| npm | estraverse | 5.3.0 | indirect |
| npm | esutils | 2.0.3 | indirect |
| npm | event-target-shim | 5.0.1 | indirect |
| npm | events | 3.3.0 | indirect |
| npm | expect | 30.2.0 | indirect |
| npm | fast-copy | 4.0.2 | indirect |
| npm | fast-decode-uri-component | 1.0.1 | indirect |
| npm | fast-deep-equal | 3.1.3 | indirect |
| npm | fast-json-stable-stringify | 2.1.0 | indirect |
| npm | fast-json-stringify | 6.1.1 | indirect |
| npm | fast-jwt | 6.2.4 | indirect |
| npm | fast-levenshtein | 2.0.6 | indirect |
| npm | fast-printf | 1.6.10 | indirect |
| npm | fast-querystring | 1.1.2 | indirect |
| npm | fast-safe-stringify | 2.1.1 | indirect |
| npm | fast-uri | 3.1.2 | indirect |
| npm | fastfall | 1.5.1 | indirect |
| npm | fastify-plugin | 5.1.0 | indirect |
| npm | fastparallel | 2.4.1 | indirect |
| npm | fastq | 1.19.1 | indirect |
| npm | fastseries | 1.7.2 | indirect |
| npm | fdir | 6.5.0 | indirect |
| npm | file-entry-cache | 8.0.0 | indirect |
| npm | fill-range | 7.1.1 | indirect |
| npm | find-my-way | 9.3.0 | indirect |
| npm | find-up | 3.0.0 | indirect |
| npm | find-up | 5.0.0 | indirect |
| npm | flat | 4.1.1 | indirect |
| npm | flat-cache | 4.0.1 | indirect |
| npm | flatted | 3.4.2 | indirect |
| npm | for-each | 0.3.5 | indirect |
| npm | foreground-child | 3.3.1 | indirect |
| npm | form-data | 4.0.6 | indirect |
| npm | fs.realpath | 1.0.0 | indirect |
| npm | fsevents | 2.1.3 | indirect |
| npm | fsevents | 2.3.3 | indirect |
| npm | function-bind | 1.1.2 | indirect |
| npm | function.prototype.name | 1.2.0 | indirect |
| npm | functions-have-names | 1.2.3 | indirect |
| npm | generator-function | 2.0.1 | indirect |
| npm | get-caller-file | 2.0.5 | indirect |
| npm | get-intrinsic | 1.3.0 | indirect |
| npm | get-proto | 1.0.1 | indirect |
| npm | get-symbol-description | 1.1.0 | indirect |
| npm | get-tsconfig | 4.13.0 | indirect |
| npm | glob-parent | 5.1.2 | indirect |
| npm | glob-parent | 6.0.2 | indirect |
| npm | global-directory | 4.0.1 | indirect |
| npm | globals | 14.0.0 | indirect |
| npm | globals | 16.5.0 | indirect |
| npm | globalthis | 1.0.4 | indirect |
| npm | gopd | 1.2.0 | indirect |
| npm | graceful-fs | 4.2.11 | indirect |
| npm | growl | 1.10.5 | indirect |
| npm | has-async-hooks | 1.0.0 | indirect |
| npm | has-bigints | 1.1.0 | indirect |
| npm | has-flag | 4.0.0 | indirect |
| npm | has-property-descriptors | 1.0.2 | indirect |
| npm | has-proto | 1.2.0 | indirect |
| npm | has-symbols | 1.1.0 | indirect |
| npm | has-tostringtag | 1.0.2 | indirect |
| npm | hasown | 2.0.4 | indirect |
| npm | hdr-histogram-js | 3.0.1 | indirect |
| npm | hdr-histogram-percentiles-obj | 3.0.0 | indirect |
| npm | he | 1.2.0 | indirect |
| npm | helmet | 8.1.0 | indirect |
| npm | help-me | 5.0.0 | indirect |
| npm | http-errors | 2.0.1 | indirect |
| npm | http-parser-js | 0.5.10 | indirect |
| npm | hyperid | 3.3.0 | indirect |
| npm | iconv-lite | 0.7.0 | indirect |
| npm | ieee754 | 1.2.1 | indirect |
| npm | ignore | 5.3.2 | indirect |
| npm | ignore | 7.0.5 | indirect |
| npm | import-fresh | 3.3.1 | indirect |
| npm | imurmurhash | 0.1.4 | indirect |
| npm | inflight | 1.0.6 | indirect |
| npm | inherits | 2.0.4 | indirect |
| npm | ini | 4.1.1 | indirect |
| npm | internal-slot | 1.1.0 | indirect |
| npm | interpret | 3.1.1 | indirect |
| npm | ipaddr.js | 2.3.0 | indirect |
| npm | is-arguments | 1.2.0 | indirect |
| npm | is-array-buffer | 3.0.5 | indirect |
| npm | is-async-function | 2.1.1 | indirect |
| npm | is-bigint | 1.1.0 | indirect |
| npm | is-binary-path | 2.1.0 | indirect |
| npm | is-boolean-object | 1.2.2 | indirect |
| npm | is-buffer | 2.0.5 | indirect |
| npm | is-callable | 1.2.7 | indirect |
| npm | is-core-module | 2.16.1 | indirect |
| npm | is-data-view | 1.0.2 | indirect |
| npm | is-date-object | 1.1.0 | indirect |
| npm | is-document.all | 1.0.0 | indirect |
| npm | is-extglob | 2.1.1 | indirect |
| npm | is-finalizationregistry | 1.1.1 | indirect |
| npm | is-fullwidth-code-point | 2.0.0 | indirect |
| npm | is-fullwidth-code-point | 3.0.0 | indirect |
| npm | is-generator-function | 1.1.2 | indirect |
| npm | is-glob | 4.0.3 | indirect |
| npm | is-installed-globally | 1.0.0 | indirect |
| npm | is-map | 2.0.3 | indirect |
| npm | is-negative-zero | 2.0.3 | indirect |
| npm | is-number | 7.0.0 | indirect |
| npm | is-number-object | 1.1.1 | indirect |
| npm | is-path-inside | 4.0.0 | indirect |
| npm | is-plain-obj | 1.1.0 | indirect |
| npm | is-regex | 1.2.1 | indirect |
| npm | is-set | 2.0.3 | indirect |
| npm | is-shared-array-buffer | 1.0.4 | indirect |
| npm | is-string | 1.1.1 | indirect |
| npm | is-symbol | 1.1.1 | indirect |
| npm | is-typed-array | 1.1.15 | indirect |
| npm | is-weakmap | 2.0.2 | indirect |
| npm | is-weakref | 1.1.1 | indirect |
| npm | is-weakset | 2.0.4 | indirect |
| npm | isarray | 1.0.0 | indirect |
| npm | isarray | 2.0.5 | indirect |
| npm | isexe | 2.0.0 | indirect |
| npm | iterate-iterator | 1.0.2 | indirect |
| npm | iterate-value | 1.0.2 | indirect |
| npm | jackspeak | 3.4.3 | indirect |
| npm | jest-diff | 30.2.0 | indirect |
| npm | jest-matcher-utils | 30.2.0 | indirect |
| npm | jest-message-util | 30.2.0 | indirect |
| npm | jest-mock | 30.2.0 | indirect |
| npm | jest-regex-util | 30.0.1 | indirect |
| npm | jest-util | 30.2.0 | indirect |
| npm | joycon | 3.1.1 | indirect |
| npm | js-tokens | 4.0.0 | indirect |
| npm | js-yaml | 3.14.0 | indirect |
| npm | js-yaml | 4.2.0 | indirect |
| npm | json-buffer | 3.0.1 | indirect |
| npm | json-schema-ref-resolver | 3.0.0 | indirect |
| npm | json-schema-resolver | 3.0.0 | indirect |
| npm | json-schema-traverse | 0.4.1 | indirect |
| npm | json-schema-traverse | 1.0.0 | indirect |
| npm | json-stable-stringify-without-jsonify | 1.0.1 | indirect |
| npm | json5 | 2.2.3 | indirect |
| npm | keyv | 4.5.4 | indirect |
| npm | kleur | 3.0.3 | indirect |
| npm | levn | 0.4.1 | indirect |
| npm | light-my-request | 6.6.0 | indirect |
| npm | locate-path | 3.0.0 | indirect |
| npm | locate-path | 6.0.0 | indirect |
| npm | lodash.chunk | 4.2.0 | indirect |
| npm | lodash.clonedeep | 4.5.0 | indirect |
| npm | lodash.flatten | 4.4.0 | indirect |
| npm | lodash.merge | 4.6.2 | indirect |
| npm | log-symbols | 4.0.0 | indirect |
| npm | lru-cache | 10.4.3 | indirect |
| npm | lru-cache | 11.2.2 | indirect |
| npm | make-error | 1.3.6 | indirect |
| npm | make-plural | 7.4.0 | indirect |
| npm | manage-path | 2.0.0 | indirect |
| npm | math-interval-parser | 2.0.1 | indirect |
| npm | math-intrinsics | 1.1.0 | indirect |
| npm | micromatch | 4.0.8 | indirect |
| npm | mime | 3.0.0 | indirect |
| npm | mime-db | 1.52.0 | indirect |
| npm | mime-db | 1.54.0 | indirect |
| npm | mime-types | 2.1.35 | indirect |
| npm | minimalistic-assert | 1.0.1 | indirect |
| npm | minimatch | 10.2.5 | indirect |
| npm | minimatch | 3.0.4 | indirect |
| npm | minimatch | 3.1.5 | indirect |
| npm | minimatch | 9.0.9 | indirect |
| npm | minimist | 1.2.8 | indirect |
| npm | minipass | 7.1.2 | indirect |
| npm | mnemonist | 0.40.4 | indirect |
| npm | mocha | 8.1.3 | indirect |
| npm | moo | 0.5.2 | indirect |
| npm | ms | 2.1.2 | indirect |
| npm | ms | 2.1.3 | indirect |
| npm | mustache | 4.2.0 | indirect |
| npm | natural-compare | 1.4.0 | indirect |
| npm | node-addon-api | 8.8.0 | indirect |
| npm | node-gyp-build | 4.8.4 | indirect |
| npm | normalize-path | 3.0.0 | indirect |
| npm | object-inspect | 1.13.4 | indirect |
| npm | object-keys | 1.1.1 | indirect |
| npm | object.assign | 4.1.0 | indirect |
| npm | object.assign | 4.1.7 | indirect |
| npm | obliterator | 2.0.5 | indirect |
| npm | on-exit-leak-free | 2.1.2 | indirect |
| npm | on-net-listen | 1.1.2 | indirect |
| npm | once | 1.4.0 | indirect |
| npm | openapi-types | 12.1.3 | indirect |
| npm | optionator | 0.9.4 | indirect |
| npm | own-keys | 1.0.1 | indirect |
| npm | p-limit | 2.3.0 | indirect |
| npm | p-limit | 3.1.0 | indirect |
| npm | p-locate | 3.0.0 | indirect |
| npm | p-locate | 5.0.0 | indirect |
| npm | p-try | 2.2.0 | indirect |
| npm | package-json-from-dist | 1.0.1 | indirect |
| npm | packpath | 0.1.0 | indirect |
| npm | pako | 1.0.11 | indirect |
| npm | parent-module | 1.0.1 | indirect |
| npm | path-exists | 3.0.0 | indirect |
| npm | path-exists | 4.0.0 | indirect |
| npm | path-is-absolute | 1.0.1 | indirect |
| npm | path-key | 3.1.1 | indirect |
| npm | path-parse | 1.0.7 | indirect |
| npm | path-scurry | 1.11.1 | indirect |
| npm | path-scurry | 2.0.1 | indirect |
| npm | peek-stream | 1.1.3 | indirect |
| npm | pg | 8.22.0 | indirect |
| npm | pg-cloudflare | 1.4.0 | indirect |
| npm | pg-connection-string | 2.14.0 | indirect |
| npm | pg-int8 | 1.0.1 | indirect |
| npm | pg-pool | 3.14.0 | indirect |
| npm | pg-protocol | 1.15.0 | indirect |
| npm | pg-types | 2.2.0 | indirect |
| npm | pgpass | 1.0.5 | indirect |
| npm | picocolors | 1.1.1 | indirect |
| npm | picomatch | 2.3.2 | indirect |
| npm | picomatch | 4.0.4 | indirect |
| npm | pino-abstract-transport | 2.0.0 | indirect |
| npm | pino-abstract-transport | 3.0.0 | indirect |
| npm | pino-std-serializers | 7.0.0 | indirect |
| npm | pluralize | 8.0.0 | indirect |
| npm | possible-typed-array-names | 1.1.0 | indirect |
| npm | postgres-array | 2.0.0 | indirect |
| npm | postgres-bytea | 1.0.1 | indirect |
| npm | postgres-date | 1.0.7 | indirect |
| npm | postgres-interval | 1.2.0 | indirect |
| npm | prelude-ls | 1.2.1 | indirect |
| npm | pretty-bytes | 5.6.0 | indirect |
| npm | pretty-format | 30.2.0 | indirect |
| npm | process | 0.11.10 | indirect |
| npm | process-nextick-args | 2.0.1 | indirect |
| npm | process-warning | 4.0.1 | indirect |
| npm | process-warning | 5.0.0 | indirect |
| npm | progress | 2.0.3 | indirect |
| npm | promise.allsettled | 1.0.2 | indirect |
| npm | prompts | 2.4.2 | indirect |
| npm | pump | 3.0.3 | indirect |
| npm | pumpify | 2.0.1 | indirect |
| npm | punycode | 2.3.1 | indirect |
| npm | quick-format-unescaped | 4.0.4 | indirect |
| npm | randombytes | 2.1.0 | indirect |
| npm | raw-body | 3.0.2 | indirect |
| npm | react-is | 18.3.1 | indirect |
| npm | readable-stream | 2.3.8 | indirect |
| npm | readable-stream | 3.6.2 | indirect |
| npm | readable-stream | 4.7.0 | indirect |
| npm | readdirp | 3.4.0 | indirect |
| npm | real-require | 0.2.0 | indirect |
| npm | rechoir | 0.8.0 | indirect |
| npm | reflect-metadata | 0.2.2 | indirect |
| npm | reflect.getprototypeof | 1.0.10 | indirect |
| npm | regexp-tree | 0.1.27 | indirect |
| npm | regexp.prototype.flags | 1.5.4 | indirect |
| npm | reinterval | 1.1.0 | indirect |
| npm | require-directory | 2.1.1 | indirect |
| npm | require-from-string | 2.0.2 | indirect |
| npm | require-main-filename | 2.0.0 | indirect |
| npm | resolve | 1.22.11 | indirect |
| npm | resolve-from | 4.0.0 | indirect |
| npm | resolve-pkg-maps | 1.0.0 | indirect |
| npm | ret | 0.5.0 | indirect |
| npm | retimer | 3.0.0 | indirect |
| npm | reusify | 1.1.0 | indirect |
| npm | rfdc | 1.4.1 | indirect |
| npm | safe-array-concat | 1.1.4 | indirect |
| npm | safe-buffer | 5.1.2 | indirect |
| npm | safe-buffer | 5.2.1 | indirect |
| npm | safe-identifier | 0.4.2 | indirect |
| npm | safe-push-apply | 1.0.0 | indirect |
| npm | safe-regex | 2.1.1 | indirect |
| npm | safe-regex-test | 1.1.0 | indirect |
| npm | safe-regex2 | 5.1.1 | indirect |
| npm | safe-stable-stringify | 2.5.0 | indirect |
| npm | safer-buffer | 2.1.2 | indirect |
| npm | secure-json-parse | 2.7.0 | indirect |
| npm | secure-json-parse | 4.1.0 | indirect |
| npm | serialize-javascript | 4.0.0 | indirect |
| npm | set-blocking | 2.0.0 | indirect |
| npm | set-cookie-parser | 2.7.2 | indirect |
| npm | set-function-length | 1.2.2 | indirect |
| npm | set-function-name | 2.0.2 | indirect |
| npm | set-proto | 1.0.0 | indirect |
| npm | setprototypeof | 1.2.0 | indirect |
| npm | sha.js | 2.4.12 | indirect |
| npm | shebang-command | 2.0.0 | indirect |
| npm | shebang-regex | 3.0.0 | indirect |
| npm | side-channel | 1.1.1 | indirect |
| npm | side-channel-list | 1.0.1 | indirect |
| npm | side-channel-map | 1.0.1 | indirect |
| npm | side-channel-weakmap | 1.0.2 | indirect |
| npm | signal-exit | 4.1.0 | indirect |
| npm | sisteransi | 1.0.5 | indirect |
| npm | slash | 3.0.0 | indirect |
| npm | sonic-boom | 4.2.0 | indirect |
| npm | split2 | 4.2.0 | indirect |
| npm | sprintf-js | 1.0.3 | indirect |
| npm | sql-highlight | 6.1.0 | indirect |
| npm | stack-utils | 2.0.6 | indirect |
| npm | statuses | 2.0.2 | indirect |
| npm | steed | 1.1.3 | indirect |
| npm | stop-iteration-iterator | 1.1.0 | indirect |
| npm | stream-shift | 1.0.3 | indirect |
| npm | string-width | 2.1.1 | indirect |
| npm | string-width | 3.1.0 | indirect |
| npm | string-width | 4.2.3 | indirect |
| npm | string-width | 5.1.2 | indirect |
| npm | string.prototype.trim | 1.2.11 | indirect |
| npm | string.prototype.trimend | 1.0.10 | indirect |
| npm | string.prototype.trimstart | 1.0.8 | indirect |
| npm | string_decoder | 1.1.1 | indirect |
| npm | string_decoder | 1.3.0 | indirect |
| npm | strip-ansi | 4.0.0 | indirect |
| npm | strip-ansi | 5.2.0 | indirect |
| npm | strip-ansi | 6.0.1 | indirect |
| npm | strip-ansi | 7.1.2 | indirect |
| npm | strip-bom | 3.0.0 | indirect |
| npm | strip-json-comments | 3.0.1 | indirect |
| npm | strip-json-comments | 3.1.1 | indirect |
| npm | strip-json-comments | 5.0.3 | indirect |
| npm | supports-color | 7.1.0 | indirect |
| npm | supports-color | 7.2.0 | indirect |
| npm | supports-preserve-symlinks-flag | 1.0.0 | indirect |
| npm | tapable | 2.3.3 | indirect |
| npm | thread-stream | 3.1.0 | indirect |
| npm | through2 | 2.0.5 | indirect |
| npm | timestring | 6.0.0 | indirect |
| npm | tinyglobby | 0.2.15 | indirect |
| npm | to-buffer | 1.2.2 | indirect |
| npm | to-regex-range | 5.0.1 | indirect |
| npm | toad-cache | 3.7.0 | indirect |
| npm | toidentifier | 1.0.1 | indirect |
| npm | ts-api-utils | 2.1.0 | indirect |
| npm | ts-node | 10.9.2 | indirect |
| npm | tsconfig-paths | 4.2.0 | indirect |
| npm | tsconfig-paths-webpack-plugin | 4.2.0 | indirect |
| npm | tslib | 2.8.1 | indirect |
| npm | tsx | 4.21.0 | indirect |
| npm | type-check | 0.4.0 | indirect |
| npm | typed-array-buffer | 1.0.3 | indirect |
| npm | typed-array-byte-length | 1.0.3 | indirect |
| npm | typed-array-byte-offset | 1.0.4 | indirect |
| npm | typed-array-length | 1.0.8 | indirect |
| npm | typeorm | 0.3.30 | indirect |
| npm | typeorm-pglite | 0.3.4 | indirect |
| npm | typescript | 5.9.3 | indirect |
| npm | typescript-eslint | 8.50.0 | indirect |
| npm | unbox-primitive | 1.1.0 | indirect |
| npm | undici-types | 7.16.0 | indirect |
| npm | unpipe | 1.0.0 | indirect |
| npm | uri-js | 4.4.1 | indirect |
| npm | util-deprecate | 1.0.2 | indirect |
| npm | uuid | 11.1.1 | indirect |
| npm | uuid | 8.3.2 | indirect |
| npm | uuid-parse | 1.1.0 | indirect |
| npm | v8-compile-cache-lib | 3.0.1 | indirect |
| npm | watskeburt | 6.0.0 | indirect |
| npm | which | 2.0.2 | indirect |
| npm | which-boxed-primitive | 1.1.1 | indirect |
| npm | which-builtin-type | 1.2.1 | indirect |
| npm | which-collection | 1.0.2 | indirect |
| npm | which-module | 2.0.1 | indirect |
| npm | which-typed-array | 1.1.22 | indirect |
| npm | wide-align | 1.1.3 | indirect |
| npm | word-wrap | 1.2.5 | indirect |
| npm | workerpool | 6.0.0 | indirect |
| npm | wrap-ansi | 5.1.0 | indirect |
| npm | wrap-ansi | 7.0.0 | indirect |
| npm | wrap-ansi | 8.1.0 | indirect |
| npm | wrappy | 1.0.2 | indirect |
| npm | xtend | 4.0.2 | indirect |
| npm | y18n | 4.0.3 | indirect |
| npm | y18n | 5.0.8 | indirect |
| npm | yaml | 2.9.0 | indirect |
| npm | yargs | 13.3.2 | indirect |
| npm | yargs | 14.2.3 | indirect |
| npm | yargs | 17.7.2 | indirect |
| npm | yargs-parser | 13.1.2 | indirect |
| npm | yargs-parser | 15.0.3 | indirect |
| npm | yargs-parser | 21.1.1 | indirect |
| npm | yargs-unparser | 1.6.1 | indirect |
| npm | yn | 3.1.1 | indirect |
| npm | yocto-queue | 0.1.0 | indirect |
Dependency advisories 1
Installing npm:@volcanicminds/backend@4.0.3 pulls in 169 packages, direct and transitive: 1 carry known advisories, of which 1 are direct dependencies.
| Package | Version | Relation | Severity | Advisories | Fixed in |
|---|---|---|---|---|---|
| @fastify/static | 9.3.0 | direct | high | 2 | 10.1.2 |
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Raw JSON report machine-readable
Feedback
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.