Öffentliches RegisterExzellent
Software-GesundheitsberichtSchema 0.34.0 · Metriken 2.10.0 · 2026-10-20 08:54 UTC
vertesia / composableai
Vertesia AI SDK and tools
vertesia/composableai erreicht einen Gesundheitsindex von 89 von 100 und liegt damit im Bereich Exzellent. Am stärksten schneidet es bei Vitality (95/100) ab, am schwächsten bei Community & Adoption (41/100). Zuletzt heute aktualisiert. 3 Mitwirkende tragen den Großteil der jüngsten Arbeit.
89
gesamt / 100Software-Gesundheitsindex
Metriken werden auf einer standardisierten Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr gewichtetes Mittel, kalibriert auf die Verteilung des öffentlichen Registers, sodass die Stufen Perzentilbedeutung tragen; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze Gefährdet von 34.
89
Außergewöhnlich93-100Die Spitzengruppe des Registers (≈ obere 5 %); erfüllt im Wesentlichen alle geprüften Kriterien
Exzellent80-92Durchgehend stark; geringfügige Lücken
Gut65-79Gesund; Lücken sind begrenzt und beherrschbar
Mittel50-64Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Schwach35-49Wesentliche Schwächen in mehreren Bereichen
Gefährdet20-34Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-19Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
Bewertungsprofil
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Der gewichtete Gesamtwert 75 wird auf der veröffentlichten Indexskala auf 89 kalibriert (Register-Kalibrierung 2026-08-02).
Eigentümerschaft
VertesiaOrganisation
18 Follower13 öffentliche Reposseit Aug. 2023
Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.
Paket-Ökosysteme
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | @vertesia/ui | 1.5.1 | 3.559 | 99 | vor 20 Tagen | vertesiauireactcomponentshooks |
| npm | @vertesia/cli | 1.5.1 | 2.347 | 117 | vor 20 Tagen | llmcodegenerationinteractionvertesiapromptaicli |
| npm | @vertesia/jst | 1.5.1 | 3.601 | 40 | vor 20 Tagen | vertesiatemplatehandlebarsjstjavascriptprompt |
| npm | @vertesia/json | 1.5.1 | 3.577 | 118 | vor 20 Tagen | vertesiajsonutilitieswalkervisitortraversetypescript |
| npm | @vertesia/client | 1.5.1 | 10.727 | 119 | vor 20 Tagen | vertesiaclientapisdkllmaitypescript |
| npm | @vertesia/common | 1.5.1 | 10.578 | 120 | vor 20 Tagen | vertesiacommontypesllmaitypescript |
| npm | @vertesia/fusion-ux | 1.5.1 | 3.480 | 57 | vor 20 Tagen | vertesiafusionuidynamicmodel-generatedreact |
| npm | @vertesia/rich-text | 1.5.1 | 3.379 | 26 | vor 20 Tagen | vertesiamarkdownrich-texttiptap |
Metriken nach Kategorie
Vitalität
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
95
Entwicklungsaktivität
100Außergewöhnlich
Wie die Bewertung erfolgt
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 36/36 | Commit-Rhythmus — 52/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 1.972 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Verwendete Eingangsdaten
| commits_last_year | 1.972 |
| human_commit_share | 0,59 |
| days_since_last_push | 0 |
| active_weeks_last_year | 52 |
Release-Disziplin
88Exzellent
Wie die Bewertung erfolgt
| 16.2/27 | Liefert Releases aus — 19 Versions-Tags (keine GitHub-Releases) |
| 36/36 | Release-Aktualität — letztes Release vor 20 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 24,7 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
Verwendete Eingangsdaten
| releases_count | 19 |
| latest_release_tag | v1.5.1 |
| releases_from_tags | ja |
| days_since_latest_release | 20 |
| mean_days_between_releases | 24,7 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.
Community & Verbreitung
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
41
Popularität & Verbreitung
10Kritisch
Wie die Bewertung erfolgt
| 9.8/60 | Stars — 5 Stars |
| 0/25 | Forks — 2 Forks |
| 0/15 | Watcher — 1 Watcher |
Verwendete Eingangsdaten
| forks | 2 |
| stars | 5 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community-Gesundheit
50Mittel
Wie die Bewertung erfolgt
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (Apache-2.0) |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
Verwendete Eingangsdaten
| has_readme | ja |
| has_license | ja |
| readme_badges | 3 |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| readme_badge_services | github.com, shields.io |
| has_pull_request_template | nein |
Wie die Bewertung erfolgt
| 61.5/80 | Downloads pro Monat — 41.248 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
Verwendete Eingangsdaten
| packages | @vertesia/ui, @vertesia/cli, @vertesia/jst, @vertesia/json, @vertesia/client, @vertesia/common, @vertesia/fusion-ux, @vertesia/rich-text |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 41.248 |
| unverified_packages_excluded | — |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.
Nachhaltigkeit & Governance
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
80
Wie die Bewertung erfolgt
| 36/54 | Bus-Faktor — 3 Beitragende decken die Hälfte aller Commits ab |
| 16.9/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 25 % der Commits |
| 13.5/13.5 | Breite der Beitragenden — 13 Beitragende |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
Verwendete Eingangsdaten
| bus_factor | 3 |
| contributors_sampled | 13 |
| top_contributor_share | 0,247 |
Reaktionsfähigkeit bei Issues & PRs
96Außergewöhnlich
Wie die Bewertung erfolgt
| 42/42 | Issue-Lösungsquote — 100 % der Issues geschlossen |
| 26.4/30 | PR-Annahme — 2.234/2.543 entschiedene PRs gemergt |
| 0/13 | Newcomer PR acceptance — kein PR eines Erstbeitragenden in 30 Tagen entschieden |
| 15/15 | OpenSSF Scorecard: Code-Review — all changesets reviewed |
Verwendete Eingangsdaten
| merged_prs | 2.234 |
| open_issues | 0 |
| closed_issues | 19 |
| prs_merged_7d | 35 |
| prs_decided_7d | 35 |
| prs_merged_30d | 35 |
| prs_decided_30d | 35 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 309 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Newcomer PR acceptance. Die verbleibenden Gewichte wurden renormalisiert.
Eigentümerschaft & Trägerschaft
54Mittel
Wie die Bewertung erfolgt
| 30/30 | Organisatorische Trägerschaft — im Besitz einer Organisation |
| 0/20 | Verifizierte Domain |
| 9.2/25 | Reichweite des Inhabers — 18 Follower von vertesia |
| 14.6/25 | Kontohistorie — 13 öffentliche Repos, Kontoalter ca. 3 Jahre |
Verwendete Eingangsdaten
| followers | 18 |
| owner_type | Organization |
| is_verified | nein |
| owner_login | vertesia |
| public_repos | 13 |
| account_age_days | 1.147 |
Paketpflege
100Außergewöhnlich
Wie die Bewertung erfolgt
| 25/25 | Veröffentlicht & auflösbar — 8 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 20 Tagen |
| 20/20 | Versionshistorie — 120 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
Verwendete Eingangsdaten
| packages | @vertesia/ui, @vertesia/cli, @vertesia/jst, @vertesia/json, @vertesia/client, @vertesia/common, @vertesia/fusion-ux, @vertesia/rich-text |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 20 |
Engineering-Qualität
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
76
Engineering-Praktiken
84Exzellent
Wie die Bewertung erfolgt
| 24/24 | CI-Workflows — 15 Workflow(s) |
| 24/24 | Tests vorhanden |
| 16/16 | Linter-Konfiguration — biome.json |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 30 out of 30 merged PRs checked by a CI test -- score normalized to 10 |
Verwendete Eingangsdaten
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | ja |
| has_precommit_config | nein |
Dokumentation
65Gut
Wie die Bewertung erfolgt
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://docs.vertesiahq.com/ |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 1 Topics |
| 0/10 | Wiki |
Verwendete Eingangsdaten
| topics | product |
| has_wiki | nein |
| homepage | https://docs.vertesiahq.com/ |
| docs_site | https://docs.vertesiahq.com/ |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sicherheit
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
74
Sicherheitslage
71Gut
Wie die Bewertung erfolgt
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 3.8/7.5 | Branch-Protection — branch protection is not maximal on development and all release branches |
| 2.5/2.5 | CI-Tests — 30 out of 30 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 7.5/7.5 | Code-Review — all changesets reviewed |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 0/10 | Dangerous-Workflow — dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — keine Daten |
| 4.5/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 9 |
| 5/5 | SAST — SAST tool is run on all commits |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 7.5/7.5 | Token-Permissions — GitHub workflow tokens follow principle of least privilege |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Verwendete Eingangsdaten
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 7,1 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Packaging, Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.
Abhängigkeits-Advisories
85Exzellent
Wie die Bewertung erfolgt
| 35/35 | Direkte Abhängigkeiten ohne bekannte Advisories — keine direkte Abhängigkeit trägt ein bekanntes Advisory |
| 10.2/25 | Indirekte Abhängigkeiten ohne bekannte Advisories — 3 betroffen: @grpc/grpc-js 1.9.16 (high 7.4), dompurify 3.4.8 (low), katex 0.16.47 (low) |
| 40/40 | Keine offenen Advisories — 1 Paket(e) mit Advisory seit über 90 Tagen unbehandelt; ältestes vor 126 Tagen veröffentlicht |
Verwendete Eingangsdaten
| source | osv |
| advisories | 8 |
| affected_packages | 3 |
| assessed_packages | 586 |
| unassessed_packages | 0 |
| affected_by_severity | high 1, low 2 |
| direct_affected_packages | 0 |
Abgeglichen wurde die Laufzeit-Abhängigkeitshülle von npm:@vertesia/ui@1.5.1 — das, was die Installation des veröffentlichten Pakets nach sich zieht — mit 586 Paketen. Erreichbarkeit wird nicht analysiert.
AI Readiness
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Trägt ein bewusst kleines Gewicht (4 %): Agenten-Tooling ist ein echtes Pflegesignal, doch ein Repository ohne jedes Signal kann weiterhin 100/100 erreichen.
88
AI-Agentenkontext & Leitlinien
100Außergewöhnlich
Wie die Bewertung erfolgt
| 45/45 | Agentenanweisungen — AGENTS.md, CLAUDE.md, templates/plugin-template/AGENTS.md, templates/plugin-template/CLAUDE.md |
| 15/15 | Maschinenlesbare Doku (llms.txt) — llms.txt vorhanden |
| 40/40 | Lesbare Commit-Historie — 59 von 59 menschlichen Commits benennen ihre Absicht (strukturierter Betreff oder erläuternder Text) |
Verwendete Eingangsdaten
| has_llms_txt | ja |
| llms_txt_url | — |
| legible_history_share | 1 |
| agent_instruction_files | AGENTS.md, CLAUDE.md, templates/plugin-template/AGENTS.md, templates/plugin-template/CLAUDE.md |
| agent_instruction_max_bytes | 12.155 |
Wie die Bewertung erfolgt
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 11/11 | Lint-/Format-Konfiguration — biome.json |
| 11/11 | Statische Typprüfung — libraries/jst/tsconfig.json, libraries/koa-stack/body/tsconfig.json, libraries/koa-stack/router/tsconfig.json, libraries/koa-stack/server/tsconfig.json, libraries/koa-stack/tests/tsconfig.json, packages/api-fetch-client/test/tsconfig.json, packages/api-fetch-client/tsconfig.json, packages/appgen-docs/tsconfig.json, packages/build-tools/tsconfig.json, packages/cli/tsconfig.json, packages/client/tsconfig.json, packages/common/tsconfig.json, packages/converters/tsconfig.json, packages/create-plugin/tsconfig.json, packages/fusion-ux/tsconfig.json, packages/json/tsconfig.json, packages/plugin-builder/tsconfig.json, packages/rich-text/tsconfig.json, packages/studio-utils/tsconfig.json, packages/tools-admin-ui/tsconfig.json, packages/tools-sdk/tsconfig.json, packages/ui/src/__tests__/tsconfig.json, packages/ui/tsconfig.json, packages/workflow/tsconfig.json, templates/plugin-template/codegen/tsconfig.json, templates/plugin-template/tsconfig.json, tools/environment-configuration/tsconfig.json |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 6/10 | Belegte Agentenpraxis — 3 der letzten 100 Commits von Agenten verfasst oder ihnen zugeschrieben |
| 0/8 | Automatisierte Wartung — keine automatisierten Abhängigkeits-Updates beobachtet |
| 9/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 9 |
Verwendete Eingangsdaten
| has_nix | nein |
| has_tests | ja |
| lockfiles | pnpm-lock.yaml |
| has_dockerfile | nein |
| typed_language | ja |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | ja |
| typecheck_configs | libraries/jst/tsconfig.json, libraries/koa-stack/body/tsconfig.json, libraries/koa-stack/router/tsconfig.json, libraries/koa-stack/server/tsconfig.json, libraries/koa-stack/tests/tsconfig.json, packages/api-fetch-client/test/tsconfig.json, packages/api-fetch-client/tsconfig.json, packages/appgen-docs/tsconfig.json, packages/build-tools/tsconfig.json, packages/cli/tsconfig.json, packages/client/tsconfig.json, packages/common/tsconfig.json, packages/converters/tsconfig.json, packages/create-plugin/tsconfig.json, packages/fusion-ux/tsconfig.json, packages/json/tsconfig.json, packages/plugin-builder/tsconfig.json, packages/rich-text/tsconfig.json, packages/studio-utils/tsconfig.json, packages/tools-admin-ui/tsconfig.json, packages/tools-sdk/tsconfig.json, packages/ui/src/__tests__/tsconfig.json, packages/ui/tsconfig.json, packages/workflow/tsconfig.json, templates/plugin-template/codegen/tsconfig.json, templates/plugin-template/tsconfig.json, tools/environment-configuration/tsconfig.json |
| agent_commit_share | 0,03 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
AI-Code-Lesbarkeit für Modelle
100Außergewöhnlich
Wie die Bewertung erfolgt
| 45/45 | Typprüfbarer Code — TypeScript (statisch typisiert) |
| 54.6/55 | Handhabbare Dateigrößen — 12/1.602 Quelldateien über 60 KB |
Verwendete Eingangsdaten
| primary_language | TypeScript |
| largest_source_bytes | 556.411 |
| source_files_sampled | 1.602 |
| oversized_source_files | 12 |
Maschinenlesbare AI-Schnittstellen
100Außergewöhnlich
Wie die Bewertung erfolgt
| 0/40 | API-Schema (OpenAPI/GraphQL/proto) — für diese Art von Software nicht anwendbar |
| 0/20 | MCP-Server — für diese Art von Software nicht anwendbar |
| 40/40 | Lauffähige Beispiele — examples |
Verwendete Eingangsdaten
| example_dirs | examples |
| has_mcp_signal | nein |
| api_schema_files | — |
| interfaces_expected_of | — |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): API-Schema (OpenAPI/GraphQL/proto), MCP-Server. Die verbleibenden Gewichte wurden renormalisiert.
Eckdaten
5GitHub-Sterne
13Mitwirkende
1.972Commits, letzte 12 Monate
0Tage seit letztem Push
19Releases
3Bus-Faktor
0offene Issues
npmPaket-Ökosysteme
Warnungen zur Datenerhebung
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
Weitere Details
Stern- und Fork-Verlauf 0 ★ / 2 ⇿
0Sterne
2Forks
17Releases
Wann jeder Stern und Fork hinzugefügt wurde, von GitHub erfasst und nach Tagen gruppiert. Das kumulierte Wachstum steht direkt über den täglichen Zugängen, aus denen es besteht, sodass beide gegeneinander lesbar sind: stetiger organischer Zuwachs sieht ganz anders aus als ein abrupter, kurzlebiger Ausschlag. Wo dieser Unterschied messbar ist, wird er als Wachstumsauthentizität ausgewiesen.
Major 1Minor 6Patch 10
Jeder Punkt umfasst 2 Tage.
OpenSSF Scorecard 7.1 / 10
7.1Gesamtwert
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 5 | Branch-Protection | branch protection is not maximal on development and all release branches |
| 10 | CI-Tests | 30 out of 30 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 10 | Code-Review | all changesets reviewed |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 0 | Dangerous-Workflow | dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| k. A. | Packaging | packaging workflow not detected |
| 9 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 9 |
| 10 | SAST | SAST tool is run on all commits |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| 10 | Token-Permissions | GitHub workflow tokens follow principle of least privilege |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Direkte Abhängigkeiten 156
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| npm | @types/node | catalog: | libraries/jst/package.json |
| npm | acorn | 8.19.0 | libraries/jst/package.json |
| npm | acorn-walk | 8.3.5 | libraries/jst/package.json |
| npm | dayjs | ^1.11.23 | libraries/jst/package.json |
| npm | papaparse | ^5.7.0 | libraries/jst/package.json |
| npm | eventsource-parser | ^4.1.1 | packages/api-fetch-client/package.json |
| npm | @llumiverse/common | workspace:* | packages/build-tools/package.json |
| npm | @vertesia/common | workspace:* | packages/build-tools/package.json |
| npm | @vertesia/studio-utils | workspace:* | packages/build-tools/package.json |
| npm | ajv | ^8.20.0 | packages/build-tools/package.json |
| npm | es-module-lexer | ^3.0.3 | packages/build-tools/package.json |
| npm | esbuild | ^0.28.2 | packages/build-tools/package.json |
| npm | js-yaml | ^5.4.3 | packages/build-tools/package.json |
| npm | zod | catalog: | packages/build-tools/package.json |
| npm | @llumiverse/common | workspace:* | packages/cli/package.json |
| npm | @vertesia/client | workspace:* | packages/cli/package.json |
| npm | @vertesia/common | workspace:* | packages/cli/package.json |
| npm | @vertesia/workflow | workspace:* | packages/cli/package.json |
| npm | ansi-colors | ^4.1.3 | packages/cli/package.json |
| npm | ansi-escapes | ^7.3.0 | packages/cli/package.json |
| npm | boxen | ^9.0.0 | packages/cli/package.json |
| npm | chalk | ^6.0.1 | packages/cli/package.json |
| npm | cli-spinners | ^3.4.0 | packages/cli/package.json |
| npm | cli-table3 | ^0.6.5 | packages/cli/package.json |
| npm | commander | ^15.0.0 | packages/cli/package.json |
| npm | enquirer | ^2.4.1 | packages/cli/package.json |
| npm | figures | ^6.1.0 | packages/cli/package.json |
| npm | glob | ^13.0.6 | packages/cli/package.json |
| npm | gradient-string | ^3.0.0 | packages/cli/package.json |
| npm | jsonwebtoken | ^9.0.3 | packages/cli/package.json |
| npm | log-symbols | ^7.0.1 | packages/cli/package.json |
| npm | log-update | ^8.0.0 | packages/cli/package.json |
| npm | mime | ^4.1.0 | packages/cli/package.json |
| npm | open | ^11.0.4 | packages/cli/package.json |
| npm | ora | ^9.4.1 | packages/cli/package.json |
| npm | readline | ^1.3.0 | packages/cli/package.json |
| npm | seedrandom | ^3.0.5 | packages/cli/package.json |
| npm | signal-exit | ^4.1.0 | packages/cli/package.json |
| npm | typescript | catalog: | packages/cli/package.json |
| npm | typescript-legacy | catalog: | packages/cli/package.json |
| npm | @llumiverse/common | workspace:* | packages/client/package.json |
| npm | @vertesia/api-fetch-client | workspace:* | packages/client/package.json |
| npm | @vertesia/common | workspace:* | packages/client/package.json |
| npm | eventsource | ^5.1.2 | packages/client/package.json |
| npm | @llumiverse/common | workspace:* | packages/common/package.json |
| npm | ajv | ^8.20.0 | packages/common/package.json |
| npm | ajv-formats | ^3.0.1 | packages/common/package.json |
| npm | zod | catalog: | packages/common/package.json |
| npm | sharp | ^0.35.5 | packages/converters/package.json |
| npm | tmp | ^0.2.7 | packages/converters/package.json |
| npm | chalk | ^6.0.1 | packages/create-plugin/package.json |
| npm | commander | ^15.0.0 | packages/create-plugin/package.json |
| npm | degit | ^3.10.0 | packages/create-plugin/package.json |
| npm | prompts | ^2.4.2 | packages/create-plugin/package.json |
| npm | @vertesia/common | workspace:* | packages/fusion-ux/package.json |
| npm | ajv | ^8.20.0 | packages/fusion-ux/package.json |
| npm | react | catalog: | packages/fusion-ux/package.json |
| npm | @adobe/css-tools | ^4.5.0 | packages/plugin-builder/package.json |
| npm | @types/node | catalog: | packages/plugin-builder/package.json |
| npm | @tiptap/core | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/extension-code-block | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/extension-image | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/extension-link | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/extension-table | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/markdown | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/pm | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/react | ^3.31.4 | packages/rich-text/package.json |
| npm | @tiptap/starter-kit | ^3.31.4 | packages/rich-text/package.json |
| npm | marked | ^18.1.0 | packages/rich-text/package.json |
| npm | react | catalog: | packages/rich-text/package.json |
| npm | react-dom | catalog: | packages/rich-text/package.json |
| npm | @llumiverse/common | workspace:* | packages/studio-utils/package.json |
| npm | @vertesia/common | workspace:* | packages/studio-utils/package.json |
| npm | @vertesia/jst | workspace:* | packages/studio-utils/package.json |
| npm | handlebars | ^4.7.10 | packages/studio-utils/package.json |
| npm | @vertesia/common | workspace:* | packages/tools-admin-ui/package.json |
| npm | @vertesia/ui | workspace:* | packages/tools-admin-ui/package.json |
| npm | lucide-react | ^1.55.0 | packages/tools-admin-ui/package.json |
| npm | @llumiverse/common | workspace:* | packages/tools-sdk/package.json |
| npm | @vertesia/client | workspace:* | packages/tools-sdk/package.json |
| npm | @vertesia/common | workspace:* | packages/tools-sdk/package.json |
| npm | jose | ^6.2.12 | packages/tools-sdk/package.json |
| npm | zod | catalog: | packages/tools-sdk/package.json |
| npm | @floating-ui/dom | ^1.8.0 | packages/ui/package.json |
| npm | @floating-ui/react | ^0.27.20 | packages/ui/package.json |
| npm | @monaco-editor/react | ^4.7.0 | packages/ui/package.json |
| npm | @radix-ui/react-checkbox | ^1.4.0 | packages/ui/package.json |
| npm | @radix-ui/react-collapsible | ^1.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-dialog | ^1.3.0 | packages/ui/package.json |
| npm | @radix-ui/react-direction | ^1.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-dismissable-layer | ^1.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-dropdown-menu | ^2.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-focus-guards | ^1.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-focus-scope | ^1.3.0 | packages/ui/package.json |
| npm | @radix-ui/react-label | ^2.1.17 | packages/ui/package.json |
| npm | @radix-ui/react-popover | ^1.3.0 | packages/ui/package.json |
| npm | @radix-ui/react-portal | ^1.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-radio-group | ^1.5.0 | packages/ui/package.json |
| npm | @radix-ui/react-separator | ^1.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-slider | ^1.6.0 | packages/ui/package.json |
| npm | @radix-ui/react-slot | ^1.5.0 | packages/ui/package.json |
| npm | @radix-ui/react-switch | ^1.4.0 | packages/ui/package.json |
| npm | @radix-ui/react-tabs | ^1.2.0 | packages/ui/package.json |
| npm | @radix-ui/react-tooltip | ^1.4.0 | packages/ui/package.json |
| npm | @vertesia/client | workspace:* | packages/ui/package.json |
| npm | @vertesia/common | workspace:* | packages/ui/package.json |
| npm | @vertesia/fusion-ux | workspace:* | packages/ui/package.json |
| npm | @vertesia/json | workspace:* | packages/ui/package.json |
| npm | @vertesia/rich-text | workspace:* | packages/ui/package.json |
| npm | ajv | ^8.20.0 | packages/ui/package.json |
| npm | ajv-formats | ^3.0.1 | packages/ui/package.json |
| npm | aria-hidden | ^1.2.6 | packages/ui/package.json |
| npm | class-variance-authority | ^0.7.1 | packages/ui/package.json |
| npm | clsx | ^2.1.1 | packages/ui/package.json |
| npm | cmdk | ^1.1.1 | packages/ui/package.json |
| npm | dayjs | ^1.11.23 | packages/ui/package.json |
| npm | debounce | ^3.0.0 | packages/ui/package.json |
| npm | dompurify | ^3.4.16 | packages/ui/package.json |
| npm | fast-xml-parser | ^5.11.2 | packages/ui/package.json |
| npm | firebase | ^12.19.0 | packages/ui/package.json |
| npm | framer-motion | ^14.1.0 | packages/ui/package.json |
| npm | i18next | ^26.4.2 | packages/ui/package.json |
| npm | jwt-decode | ^4.0.0 | packages/ui/package.json |
| npm | katex | ^0.19.0 | packages/ui/package.json |
| npm | lodash-es | ^4.18.1 | packages/ui/package.json |
| npm | lucide-react | ^1.55.0 | packages/ui/package.json |
| npm | mermaid | ^12.1.0 | packages/ui/package.json |
| npm | monaco-editor | ^0.57.0 | packages/ui/package.json |
| npm | motion | ^14.1.0 | packages/ui/package.json |
| npm | papaparse | ^5.7.0 | packages/ui/package.json |
| npm | react | catalog: | packages/ui/package.json |
| npm | react-calendar | ^6.0.1 | packages/ui/package.json |
| npm | react-date-picker | ^12.1.0 | packages/ui/package.json |
| npm | react-dom | catalog: | packages/ui/package.json |
| npm | react-error-boundary | ^6.1.6 | packages/ui/package.json |
| npm | react-i18next | ^17.0.16 | packages/ui/package.json |
| npm | react-markdown | ^10.1.0 | packages/ui/package.json |
| npm | react-pdf | ^11.0.0 | packages/ui/package.json |
| npm | react-remove-scroll | ^2.7.2 | packages/ui/package.json |
| npm | react-remove-scroll-bar | ^2.3.8 | packages/ui/package.json |
| npm | react-resizable-panels | ^4.14.4 | packages/ui/package.json |
| npm | react-style-singleton | ^2.2.3 | packages/ui/package.json |
| npm | react-vega | ^8.0.0 | packages/ui/package.json |
| npm | rehype-katex | ^7.0.1 | packages/ui/package.json |
| npm | remark-definition-list | ^2.0.1 | packages/ui/package.json |
| npm | remark-directive | ^4.0.0 | packages/ui/package.json |
| npm | remark-gfm | ^4.0.1 | packages/ui/package.json |
| npm | remark-github-blockquote-alert | ^2.1.0 | packages/ui/package.json |
| npm | remark-math | ^6.0.0 | packages/ui/package.json |
| npm | remark-supersub | ^1.0.0 | packages/ui/package.json |
| npm | tailwind-merge | ^3.7.0 | packages/ui/package.json |
| npm | ts-md5 | ^2.0.1 | packages/ui/package.json |
| npm | unist-util-visit | ^5.1.0 | packages/ui/package.json |
| npm | vega | ^6.4.0 | packages/ui/package.json |
| npm | vega-embed | ^7.3.0 | packages/ui/package.json |
| npm | vega-lite | ^6.4.3 | packages/ui/package.json |
Alle Abhängigkeiten 313
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 130 direkte und 183 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| npm | @adobe/css-tools | ^4.5.0 | direkt |
| npm | @floating-ui/dom | ^1.8.0 | direkt |
| npm | @floating-ui/react | ^0.27.20 | direkt |
| npm | @llumiverse/common | 1.5.1 | direkt |
| npm | @monaco-editor/react | ^4.7.0 | direkt |
| npm | @radix-ui/react-checkbox | ^1.4.0 | direkt |
| npm | @radix-ui/react-collapsible | ^1.2.0 | direkt |
| npm | @radix-ui/react-dialog | ^1.3.0 | direkt |
| npm | @radix-ui/react-direction | ^1.2.0 | direkt |
| npm | @radix-ui/react-dismissable-layer | ^1.2.0 | direkt |
| npm | @radix-ui/react-dropdown-menu | ^2.2.0 | direkt |
| npm | @radix-ui/react-focus-guards | ^1.2.0 | direkt |
| npm | @radix-ui/react-focus-scope | ^1.3.0 | direkt |
| npm | @radix-ui/react-label | ^2.1.17 | direkt |
| npm | @radix-ui/react-popover | ^1.3.0 | direkt |
| npm | @radix-ui/react-portal | ^1.2.0 | direkt |
| npm | @radix-ui/react-radio-group | ^1.5.0 | direkt |
| npm | @radix-ui/react-separator | ^1.2.0 | direkt |
| npm | @radix-ui/react-slider | ^1.6.0 | direkt |
| npm | @radix-ui/react-slot | ^1.5.0 | direkt |
| npm | @radix-ui/react-switch | ^1.4.0 | direkt |
| npm | @radix-ui/react-tabs | ^1.2.0 | direkt |
| npm | @radix-ui/react-tooltip | ^1.4.0 | direkt |
| npm | @tiptap/core | ^3.31.4 | direkt |
| npm | @tiptap/extension-code-block | ^3.31.4 | direkt |
| npm | @tiptap/extension-image | ^3.31.4 | direkt |
| npm | @tiptap/extension-link | ^3.31.4 | direkt |
| npm | @tiptap/extension-table | ^3.31.4 | direkt |
| npm | @tiptap/markdown | ^3.31.4 | direkt |
| npm | @tiptap/pm | ^3.31.4 | direkt |
| npm | @tiptap/react | ^3.31.4 | direkt |
| npm | @tiptap/starter-kit | ^3.31.4 | direkt |
| npm | @types/node | 24.19.1 | direkt |
| npm | @types/node | catalog: | direkt |
| npm | @vertesia/api-fetch-client | 1.5.1 | direkt |
| npm | @vertesia/client | 1.5.1 | direkt |
| npm | @vertesia/common | 1.5.1 | direkt |
| npm | acorn | 8.19.0 | direkt |
| npm | acorn-walk | 8.3.5 | direkt |
| npm | ajv | 8.20.0 | direkt |
| npm | ajv | ^8.20.0 | direkt |
| npm | ajv-formats | 3.0.1 | direkt |
| npm | ajv-formats | ^3.0.1 | direkt |
| npm | ansi-colors | ^4.1.3 | direkt |
| npm | ansi-escapes | ^7.3.0 | direkt |
| npm | aria-hidden | ^1.2.6 | direkt |
| npm | boxen | ^9.0.0 | direkt |
| npm | chalk | ^6.0.1 | direkt |
| npm | class-variance-authority | ^0.7.1 | direkt |
| npm | cli-spinners | ^3.4.0 | direkt |
| npm | cli-table3 | ^0.6.5 | direkt |
| npm | clsx | ^2.1.1 | direkt |
| npm | cmdk | ^1.1.1 | direkt |
| npm | commander | 15.0.0 | direkt |
| npm | commander | ^15.0.0 | direkt |
| npm | dayjs | ^1.11.23 | direkt |
| npm | debounce | ^3.0.0 | direkt |
| npm | degit | ^3.10.0 | direkt |
| npm | dompurify | ^3.4.16 | direkt |
| npm | enquirer | ^2.4.1 | direkt |
| npm | es-module-lexer | ^3.0.3 | direkt |
| npm | esbuild | ^0.28.2 | direkt |
| npm | eventsource | 5.1.1 | direkt |
| npm | eventsource | ^5.1.2 | direkt |
| npm | eventsource-parser | 4.1.1 | direkt |
| npm | eventsource-parser | ^4.1.1 | direkt |
| npm | fast-xml-parser | ^5.11.2 | direkt |
| npm | figures | ^6.1.0 | direkt |
| npm | firebase | ^12.19.0 | direkt |
| npm | framer-motion | ^14.1.0 | direkt |
| npm | glob | ^13.0.6 | direkt |
| npm | gradient-string | ^3.0.0 | direkt |
| npm | handlebars | ^4.7.10 | direkt |
| npm | i18next | ^26.4.2 | direkt |
| npm | jose | ^6.2.12 | direkt |
| npm | js-yaml | ^5.4.3 | direkt |
| npm | jsonwebtoken | ^9.0.3 | direkt |
| npm | jwt-decode | ^4.0.0 | direkt |
| npm | katex | ^0.19.0 | direkt |
| npm | lodash-es | ^4.18.1 | direkt |
| npm | log-symbols | ^7.0.1 | direkt |
| npm | log-update | ^8.0.0 | direkt |
| npm | lucide-react | ^1.55.0 | direkt |
| npm | marked | ^18.1.0 | direkt |
| npm | mermaid | ^12.1.0 | direkt |
| npm | mime | ^4.1.0 | direkt |
| npm | monaco-editor | ^0.57.0 | direkt |
| npm | motion | ^14.1.0 | direkt |
| npm | open | ^11.0.4 | direkt |
| npm | ora | ^9.4.1 | direkt |
| npm | papaparse | ^5.7.0 | direkt |
| npm | prompts | ^2.4.2 | direkt |
| npm | react | 19.3.0 | direkt |
| npm | react | catalog: | direkt |
| npm | react-calendar | ^6.0.1 | direkt |
| npm | react-date-picker | ^12.1.0 | direkt |
| npm | react-dom | catalog: | direkt |
| npm | react-error-boundary | ^6.1.6 | direkt |
| npm | react-i18next | ^17.0.16 | direkt |
| npm | react-markdown | ^10.1.0 | direkt |
| npm | react-pdf | ^11.0.0 | direkt |
| npm | react-remove-scroll | ^2.7.2 | direkt |
| npm | react-remove-scroll-bar | ^2.3.8 | direkt |
| npm | react-resizable-panels | ^4.14.4 | direkt |
| npm | react-style-singleton | ^2.2.3 | direkt |
| npm | react-vega | ^8.0.0 | direkt |
| npm | readline | ^1.3.0 | direkt |
| npm | rehype-katex | ^7.0.1 | direkt |
| npm | remark-definition-list | ^2.0.1 | direkt |
| npm | remark-directive | ^4.0.0 | direkt |
| npm | remark-gfm | ^4.0.1 | direkt |
| npm | remark-github-blockquote-alert | ^2.1.0 | direkt |
| npm | remark-math | ^6.0.0 | direkt |
| npm | remark-supersub | ^1.0.0 | direkt |
| npm | seedrandom | ^3.0.5 | direkt |
| npm | sharp | ^0.35.5 | direkt |
| npm | signal-exit | ^4.1.0 | direkt |
| npm | tailwind-merge | ^3.7.0 | direkt |
| npm | tmp | ^0.2.7 | direkt |
| npm | ts-md5 | ^2.0.1 | direkt |
| npm | typescript | 7.0.2 | direkt |
| npm | typescript | ^7.0.2 | direkt |
| npm | typescript | catalog: | direkt |
| npm | typescript-legacy | catalog: | direkt |
| npm | unist-util-visit | ^5.1.0 | direkt |
| npm | vega | ^6.4.0 | direkt |
| npm | vega-embed | ^7.3.0 | direkt |
| npm | vega-lite | ^6.4.3 | direkt |
| npm | zod | 4.6.5 | direkt |
| npm | zod | catalog: | direkt |
| npm | @aws-sdk/client-iam | 3.1149.0 | indirekt |
| npm | @aws-sdk/client-s3 | ^3.1147.0 | indirekt |
| npm | @aws-sdk/client-textract | ^3.1147.0 | indirekt |
| npm | @aws-sdk/core | 3.978.2 | indirekt |
| npm | @aws-sdk/credential-provider-env | 3.972.73 | indirekt |
| npm | @aws-sdk/credential-provider-http | 3.972.75 | indirekt |
| npm | @aws-sdk/credential-provider-ini | 3.973.18 | indirekt |
| npm | @aws-sdk/credential-provider-login | 3.972.80 | indirekt |
| npm | @aws-sdk/credential-provider-node | 3.972.85 | indirekt |
| npm | @aws-sdk/credential-provider-process | 3.972.73 | indirekt |
| npm | @aws-sdk/credential-provider-sso | 3.973.17 | indirekt |
| npm | @aws-sdk/credential-provider-web-identity | 3.972.79 | indirekt |
| npm | @aws-sdk/credential-providers | ^3.1147.0 | indirekt |
| npm | @aws-sdk/nested-clients | 3.997.47 | indirekt |
| npm | @aws-sdk/signature-v4-multi-region | 3.996.48 | indirekt |
| npm | @aws-sdk/token-providers | 3.1149.0 | indirekt |
| npm | @aws-sdk/types | 3.974.6 | indirekt |
| npm | @aws-sdk/xml-builder | 3.972.41 | indirekt |
| npm | @aws/lambda-invoke-store | 0.3.0 | indirekt |
| npm | @biomejs/biome | 2.5.15 | indirekt |
| npm | @biomejs/cli-darwin-arm64 | 2.5.15 | indirekt |
| npm | @biomejs/cli-darwin-x64 | 2.5.15 | indirekt |
| npm | @biomejs/cli-linux-arm64 | 2.5.15 | indirekt |
| npm | @biomejs/cli-linux-arm64-musl | 2.5.15 | indirekt |
| npm | @biomejs/cli-linux-x64 | 2.5.15 | indirekt |
| npm | @biomejs/cli-linux-x64-musl | 2.5.15 | indirekt |
| npm | @biomejs/cli-win32-arm64 | 2.5.15 | indirekt |
| npm | @biomejs/cli-win32-x64 | 2.5.15 | indirekt |
| npm | @hono/node-server | ^2.1.3 | indirekt |
| npm | @hono/vite-dev-server | ^0.26.1 | indirekt |
| npm | @napi-rs/keyring | ^2.1.0 | indirekt |
| npm | @playwright/test | ^1.63.0 | indirekt |
| npm | @pnpm/exe.android-arm64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.android-x64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.darwin-arm64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.darwin-x64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.freebsd-x64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.linux-arm64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.linux-arm64-musl | 12.12.1 | indirekt |
| npm | @pnpm/exe.linux-ppc64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.linux-riscv64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.linux-s390x | 12.12.1 | indirekt |
| npm | @pnpm/exe.linux-x64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.linux-x64-musl | 12.12.1 | indirekt |
| npm | @pnpm/exe.win32-arm64 | 12.12.1 | indirekt |
| npm | @pnpm/exe.win32-x64 | 12.12.1 | indirekt |
| npm | @smithy/core | 3.35.0 | indirekt |
| npm | @smithy/core | 3.35.2 | indirekt |
| npm | @smithy/credential-provider-imds | 4.5.2 | indirekt |
| npm | @smithy/fetch-http-handler | 5.8.0 | indirekt |
| npm | @smithy/node-http-handler | 4.12.1 | indirekt |
| npm | @smithy/signature-v4 | 5.7.4 | indirekt |
| npm | @smithy/types | 4.19.0 | indirekt |
| npm | @smithy/types | ^4.19.0 | indirekt |
| npm | @tailwindcss/forms | ^0.5.11 | indirekt |
| npm | @tailwindcss/vite | ^4.3.3 | indirekt |
| npm | @temporalio/activity | ^1.24.0 | indirekt |
| npm | @temporalio/proto | ^1.24.0 | indirekt |
| npm | @temporalio/testing | ^1.24.0 | indirekt |
| npm | @temporalio/worker | ^1.24.0 | indirekt |
| npm | @temporalio/workflow | ^1.24.0 | indirekt |
| npm | @testing-library/react | ^16.3.3 | indirekt |
| npm | @testing-library/user-event | ^14.6.7 | indirekt |
| npm | @tsconfig/node-lts | 24.0.1 | indirekt |
| npm | @types/bun | 1.4.2 | indirekt |
| npm | @types/degit | ^2.8.6 | indirekt |
| npm | @types/estree | ^1.0.9 | indirekt |
| npm | @types/formidable | ^3.5.1 | indirekt |
| npm | @types/hast | ^3.0.5 | indirekt |
| npm | @types/inflation | ^2.0.4 | indirekt |
| npm | @types/js-yaml | ^4.0.9 | indirekt |
| npm | @types/jsonwebtoken | ^9.0.10 | indirekt |
| npm | @types/koa | ^3.0.3 | indirekt |
| npm | @types/koa-compose | ^3.2.9 | indirekt |
| npm | @types/koa-send | ^4.1.6 | indirekt |
| npm | @types/lodash-es | ^4.17.12 | indirekt |
| npm | @types/mocha | ^10.0.10 | indirekt |
| npm | @types/papaparse | ^5.5.2 | indirekt |
| npm | @types/prompts | ^2.4.9 | indirekt |
| npm | @types/qs | ^6.15.1 | indirekt |
| npm | @types/react | catalog: | indirekt |
| npm | @types/react-dom | catalog: | indirekt |
| npm | @types/statuses | ^2.0.6 | indirekt |
| npm | @types/supertest | ^7.2.1 | indirekt |
| npm | @types/tmp | ^0.2.6 | indirekt |
| npm | @typescript/typescript-aix-ppc64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-darwin-arm64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-darwin-x64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-freebsd-arm64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-freebsd-x64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-arm | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-arm64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-loong64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-mips64el | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-ppc64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-riscv64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-s390x | 7.0.2 | indirekt |
| npm | @typescript/typescript-linux-x64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-netbsd-arm64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-netbsd-x64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-openbsd-arm64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-openbsd-x64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-sunos-x64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-win32-arm64 | 7.0.2 | indirekt |
| npm | @typescript/typescript-win32-x64 | 7.0.2 | indirekt |
| npm | @vercel/node | 23.0.1 | indirekt |
| npm | @vitejs/plugin-basic-ssl | ^2.3.0 | indirekt |
| npm | @vitejs/plugin-react | ^6.1.2 | indirekt |
| npm | agent-base | 7.1.4 | indirekt |
| npm | axe-core | ^4.14.0 | indirekt |
| npm | base64-js | 1.5.1 | indirekt |
| npm | bignumber.js | 9.3.1 | indirekt |
| npm | bowser | 2.14.1 | indirekt |
| npm | buffer-equal-constant-time | 1.0.1 | indirekt |
| npm | bun-types | 1.4.2 | indirekt |
| npm | concurrently | ^10.0.5 | indirekt |
| npm | culori | ^4.0.2 | indirekt |
| npm | data-uri-to-buffer | 4.0.1 | indirekt |
| npm | debug | 4.4.3 | indirekt |
| npm | dotenv | 18.0.7 | indirekt |
| npm | dotenv | ^18.0.6 | indirekt |
| npm | ecdsa-sig-formatter | 1.0.11 | indirekt |
| npm | extend | 3.0.2 | indirekt |
| npm | fast-deep-equal | 3.1.3 | indirekt |
| npm | fast-deep-equal | ^3.1.3 | indirekt |
| npm | fast-uri | 4.2.1 | indirekt |
| npm | fetch-blob | 3.2.0 | indirekt |
| npm | formdata-polyfill | 4.0.10 | indirekt |
| npm | formidable | ^3.5.4 | indirekt |
| npm | gaxios | 7.1.4 | indirekt |
| npm | gaxios | 8.3.1 | indirekt |
| npm | gcp-metadata | 9.0.3 | indirekt |
| npm | globals | 17.13.0 | indirekt |
| npm | globals | ^17.13.0 | indirekt |
| npm | google-auth-library | 11.3.1 | indirekt |
| npm | google-logging-utils | 2.0.1 | indirekt |
| npm | hono | ^4.13.13 | indirekt |
| npm | html-parse-stringify | ^4.0.1 | indirekt |
| npm | https-proxy-agent | 7.0.6 | indirekt |
| npm | i18next-cli | ^1.74.8 | indirekt |
| npm | inflation | ^2.1.0 | indirekt |
| npm | jsdom | ^30.1.2 | indirekt |
| npm | json-bigint | 1.0.0 | indirekt |
| npm | json-schema-traverse | 1.0.0 | indirekt |
| npm | jwa | 2.0.1 | indirekt |
| npm | jws | 4.0.1 | indirekt |
| npm | koa | ^3.2.1 | indirekt |
| npm | koa-compose | ^4.1.0 | indirekt |
| npm | koa-send | ^5.0.1 | indirekt |
| npm | mocha | ^12.0.3 | indirekt |
| npm | ms | 2.1.3 | indirekt |
| npm | ms | 3.0.0-canary.202508261828 | indirekt |
| npm | node-domexception | 1.0.0 | indirekt |
| npm | node-fetch | 3.3.2 | indirekt |
| npm | node-web-stream-adapters | ^0.2.1 | indirekt |
| npm | p-limit | ^7.3.3 | indirekt |
| npm | path-to-regexp | ^8.4.2 | indirekt |
| npm | pnpm | 12.12.1 | indirekt |
| npm | qs | ^6.16.0 | indirekt |
| npm | raw-body | ^4.0.0 | indirekt |
| npm | require-from-string | 2.0.2 | indirekt |
| npm | rimraf | ^6.1.3 | indirekt |
| npm | rolldown | catalog: | indirekt |
| npm | safe-buffer | 5.2.1 | indirekt |
| npm | statuses | ^2.0.2 | indirekt |
| npm | supertest | ^7.3.1 | indirekt |
| npm | tailwindcss | ^4.3.3 | indirekt |
| npm | tiktoken | ^1.0.22 | indirekt |
| npm | tmp-promise | ^3.0.3 | indirekt |
| npm | tslib | 2.8.1 | indirekt |
| npm | tslib | ^2.8.1 | indirekt |
| npm | tsx | ^4.23.15 | indirekt |
| npm | undici | ^7.30.0 | indirekt |
| npm | undici-types | 7.24.6 | indirekt |
| npm | use-sync-external-store | ^1.7.0 | indirekt |
| npm | vite | catalog: | indirekt |
| npm | vite-plugin-serve-static | ^2.2.1 | indirekt |
| npm | vitest | catalog: | indirekt |
| npm | vitest-axe | ^0.1.0 | indirekt |
| npm | wcag-contrast | ^3.0.0 | indirekt |
| npm | web-streams-polyfill | 3.3.3 | indirekt |
| npm | workerd | 1.20261007.1 | indirekt |
| npm | yaml | ^2.9.1 | indirekt |
Abhängigkeits-Advisories 3
Die Installation von npm:@vertesia/ui@1.5.1 zieht 586 Pakete nach sich, direkt und transitiv: 3 tragen bekannte Advisories, davon 0 direkte Abhängigkeiten.
| Paket | Version | Beziehung | Schweregrad | Advisories | Behoben in |
|---|---|---|---|---|---|
| @grpc/grpc-js | 1.9.16 | indirekt | hoch | 2 | 1.14.5 |
| dompurify | 3.4.8 | indirekt | niedrig | 5 | 3.4.16 |
| katex | 0.16.47 | indirekt | niedrig | 1 | 0.18.2 |
Ein Advisory bedeutet, dass die im Abhängigkeitsgraphen erfasste Version in den betroffenen Bereich eines Advisories fällt. Erreichbarkeit wird nicht analysiert, und der Graph enthält Entwicklungs- und Test-Pins — ein Fund kann das Werkzeug betreffen und nicht die ausgelieferte Software.
JSON-Rohbericht maschinenlesbar
Feedback
Stimmt etwas in diesem Bericht nicht, oder gibt es Gedanken dazu? Falsche Messungen, übersehene Tools, Ideen, Fragen — alles ist willkommen. Jede Nachricht wird gelesen und beantwortet.
Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v2.10.0, Schema v0.34.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm.