This package provides highly powerful `@searchBy` and `@sortBy` directives for lighthouse-php.
LastDragon-ru/lara-asp-graphql holds a health index of 8 out of 100, placing it in the Critical band. It scores highest on Vitality (75/100) and lowest on Security (7/100). It was last updated today. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 43 is calibrated to 39 on the published index scale (record calibration 2026-08-02). High-Risk Jurisdiction Policy applies a 20% multiplier to weighted overall health and gives it an At Risk ceiling of 34.
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| Packagist | lastdragon-ru/lara-asp-graphql | 11.1.0 | 4,178 | 73 | 48 days ago | phpstreamlaravelgraphqllaravel-packagelighthouselighthouse-phpsearchbysortby |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 0 days ago |
| 11.1/36 | Commit cadence — 16/52 weeks with commits |
| 16.8/18 | Commit volume — 73 commits in the last year |
| 7/10 | OpenSSF Scorecard: Maintained — 9 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 7 |
| commits_last_year | 73 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 16 |
| 16.2/27 | Ships releases — 73 version tags (no GitHub releases) |
| 36/36 | Release recency — latest release 48 days ago |
| 19.8/27 | Release cadence — a release every ~46.3 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 73 |
| latest_release_tag | 11.1.0 |
| releases_from_tags | yes |
| days_since_latest_release | 48 |
| mean_days_between_releases | 46.3 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 9.8/60 | Stars — 5 stars |
| 2.5/25 | Forks — 3 forks |
| 0/15 | Watchers — 2 watchers |
| forks | 3 |
| stars | 5 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | — |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | — |
| has_pull_request_template | no |
| 48.3/80 | Monthly downloads — 4,178 downloads/month across packagist |
| 2/20 | Registry dependents — 1 packages depend on it |
| packages | lastdragon-ru/lara-asp-graphql |
| dependents | 1 |
| ecosystems | packagist |
| total_downloads | 126,173 |
| monthly_downloads | 4,178 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0/22.5 | Commit distribution — top contributor authored 100% of commits |
| 1.4/13.5 | Contributor breadth — 1 contributors |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
| 0/42 | Issue resolution — no issues or no data |
| 0/30 | PR acceptance — no decided pull requests or no data |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 0 |
| open_issues | 0 |
| closed_issues | 0 |
| prs_merged_7d | — |
| prs_decided_7d | — |
| prs_merged_30d | — |
| prs_decided_30d | — |
| issue_closed_ratio | — |
| closed_unmerged_prs | 0 |
| first_time_authors_30d | — |
| first_time_prs_merged_30d | — |
| first_time_prs_decided_30d | — |
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 6.9/25 | Owner reach — 8 followers of LastDragon-ru |
| 23.2/25 | Track record — 34 public repos, account ~14 yr old |
| followers | 8 |
| owner_type | User |
| is_verified | — |
| owner_login | LastDragon-ru |
| public_repos | 34 |
| account_age_days | 5,300 |
| 25/25 | Published & resolvable — 1 package(s) on packagist |
| 35/35 | Publish recency — latest publish 48 days ago |
| 20/20 | Version history — 73 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | lastdragon-ru/lara-asp-graphql |
| ecosystems | packagist |
| any_deprecated | no |
| min_days_since_publish | 48 |
Are baseline engineering and documentation practices in place?
| 0/24 | CI workflows |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
| has_ci | no |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 25/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://github.com/LastDragon-ru/php-packages |
| 10/10 | Repository description |
| 10/10 | Topics — 3 topics |
| 0/10 | Wiki |
| topics | graphql, laravel, lighthouse |
| has_wiki | no |
| homepage | https://github.com/LastDragon-ru/php-packages |
| docs_site | https://github.com/LastDragon-ru/php-packages |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
Based on self-published public profile locations. This governance signal does not determine nationality, citizenship, intent, sanctions status, or individual trustworthiness.
How jurisdiction exposure is assessed| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 0/10 | Dangerous-Workflow — no data |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 5.2/7.5 | Maintained — 9 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 7 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — no data |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — no data |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 3.4 |
| high_risk_jurisdiction_cap | 34 |
| high_risk_jurisdiction_multiplier | 20 |
| security_posture_after_multiplier | 7 |
| security_posture_before_jurisdiction | 34 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 0/40 | Legible commit history — no data |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 0/11 | Static type checking |
| 0/10 | Reproducible environment |
| 0/10 | Demonstrated agent practice — no data |
| 0/8 | Automated maintenance — no data |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — no data |
| has_nix | no |
| has_tests | yes |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 0/45 | Type-checkable code — PHP without a type-check config |
| 54.8/55 | Manageable file sizes — 1/355 source files over 60KB |
| primary_language | PHP |
| largest_source_bytes | 70,984 |
| source_files_sampled | 355 |
| oversized_source_files | 1 |
| 40/40 | API schema (OpenAPI/GraphQL/proto) — src/Package/schema.graphql, src/Printer/PrinterTest/export/CodeInput.graphql, src/Printer/PrinterTest/export/CodeUnion.graphql, src/Printer/PrinterTest/export/InputObjectTypeDefinition.graphql, src/Printer/PrinterTest/export/SchemaType.graphql, src/Printer/PrinterTest/export/UnionTypeDefinitionNode.graphql, src/Printer/PrinterTest/print/DefaultSettings.graphql, src/Printer/PrinterTest/print/GraphQLSettings.graphql, src/Printer/PrinterTest/print/PrinterSettings-DirectiveDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings-Everything.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoDirectivesDefinitions.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoNormalization.graphql, src/Printer/PrinterTest/print/PrinterSettings-TypeDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings.graphql, src/Printer/PrinterTest/schema.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.expected.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.schema.graphql, src/SearchBy/Directives/DirectiveTest/Example.expected.graphql, src/SearchBy/Directives/DirectiveTest/Example.schema.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SearchBy/Directives/DirectiveTest/Query.expected.graphql, src/SearchBy/Directives/DirectiveTest/Query.schema.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SearchBy/Directives/DirectiveTest/Scout.expected.graphql, src/SearchBy/Directives/DirectiveTest/Scout.schema.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SortBy/Directives/DirectiveTest/Example.expected.graphql, src/SortBy/Directives/DirectiveTest/Example.schema.graphql, src/SortBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SortBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SortBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SortBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SortBy/Directives/DirectiveTest/Query.expected.graphql, src/SortBy/Directives/DirectiveTest/Query.schema.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SortBy/Directives/DirectiveTest/Scout.expected.graphql, src/SortBy/Directives/DirectiveTest/Scout.schema.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/Stream/Directives/DirectiveTest/schema-expected.graphql, src/Stream/Directives/DirectiveTest/schema.graphql, src/Stream/Directives/DirectiveTest/scout-expected.graphql, src/Stream/Directives/DirectiveTest/scout.graphql |
| 0/20 | MCP server — not applicable to this kind of software |
| 40/40 | Runnable examples — examples |
| example_dirs | examples |
| has_mcp_signal | no |
| api_schema_files | src/Package/schema.graphql, src/Printer/PrinterTest/export/CodeInput.graphql, src/Printer/PrinterTest/export/CodeUnion.graphql, src/Printer/PrinterTest/export/InputObjectTypeDefinition.graphql, src/Printer/PrinterTest/export/SchemaType.graphql, src/Printer/PrinterTest/export/UnionTypeDefinitionNode.graphql, src/Printer/PrinterTest/print/DefaultSettings.graphql, src/Printer/PrinterTest/print/GraphQLSettings.graphql, src/Printer/PrinterTest/print/PrinterSettings-DirectiveDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings-Everything.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoDirectivesDefinitions.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoNormalization.graphql, src/Printer/PrinterTest/print/PrinterSettings-TypeDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings.graphql, src/Printer/PrinterTest/schema.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.expected.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.schema.graphql, src/SearchBy/Directives/DirectiveTest/Example.expected.graphql, src/SearchBy/Directives/DirectiveTest/Example.schema.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SearchBy/Directives/DirectiveTest/Query.expected.graphql, src/SearchBy/Directives/DirectiveTest/Query.schema.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SearchBy/Directives/DirectiveTest/Scout.expected.graphql, src/SearchBy/Directives/DirectiveTest/Scout.schema.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SortBy/Directives/DirectiveTest/Example.expected.graphql, src/SortBy/Directives/DirectiveTest/Example.schema.graphql, src/SortBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SortBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SortBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SortBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SortBy/Directives/DirectiveTest/Query.expected.graphql, src/SortBy/Directives/DirectiveTest/Query.schema.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SortBy/Directives/DirectiveTest/Scout.expected.graphql, src/SortBy/Directives/DirectiveTest/Scout.schema.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/Stream/Directives/DirectiveTest/schema-expected.graphql, src/Stream/Directives/DirectiveTest/schema.graphql, src/Stream/Directives/DirectiveTest/scout-expected.graphql, src/Stream/Directives/DirectiveTest/scout.graphql |
| interfaces_expected_of | — |
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| n/a | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 7 | Maintained | 9 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 7 |
| n/a | Packaging | packaging workflow not detected |
| n/a | Pinned-Dependencies | no dependencies found |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| n/a | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| Packagist | illuminate/collections | ^13.10.0 | composer.json |
| Packagist | illuminate/contracts | ^13.10.0 | composer.json |
| Packagist | illuminate/database | ^13.10.0 | composer.json |
| Packagist | illuminate/support | ^13.10.0 | composer.json |
| Packagist | nuwave/lighthouse | ^6.66.0 | composer.json |
| Packagist | lastdragon-ru/lara-asp-core | self.version | composer.json |
| Packagist | lastdragon-ru/lara-asp-eloquent | self.version | composer.json |
| Packagist | lastdragon-ru/lara-asp-serializer | self.version | composer.json |
| Packagist | lastdragon-ru/graphql-printer | self.version | composer.json |
| Packagist | symfony/polyfill-php85 | ^1.36.0 | composer.json |
| Packagist | webonyx/graphql-php | ^15.32.3 | composer.json |
Full resolved dependency set from the GitHub dependency graph: 11 direct and 12 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| Packagist | illuminate/collections | — | direct |
| Packagist | illuminate/contracts | — | direct |
| Packagist | illuminate/database | — | direct |
| Packagist | illuminate/support | — | direct |
| Packagist | lastdragon-ru/graphql-printer | — | direct |
| Packagist | lastdragon-ru/lara-asp-core | — | direct |
| Packagist | lastdragon-ru/lara-asp-eloquent | — | direct |
| Packagist | lastdragon-ru/lara-asp-serializer | — | direct |
| Packagist | nuwave/lighthouse | — | direct |
| Packagist | symfony/polyfill-php85 | — | direct |
| Packagist | webonyx/graphql-php | — | direct |
| Packagist | composer/semver | — | indirect |
| Packagist | ext-filter | — | indirect |
| Packagist | ext-mbstring | — | indirect |
| Packagist | laravel/scout | — | indirect |
| Packagist | lastdragon-ru/lara-asp-graphql-testing | — | indirect |
| Packagist | lastdragon-ru/lara-asp-testing | — | indirect |
| Packagist | lastdragon-ru/phpunit-extensions | — | indirect |
| Packagist | lastdragon-ru/phpunit-graphql | — | indirect |
| Packagist | mockery/mockery | — | indirect |
| Packagist | orchestra/testbench | — | indirect |
| Packagist | php | — | indirect |
| Packagist | phpunit/phpunit | — | indirect |
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.15.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — Packagist.