This package provides highly powerful `@searchBy` and `@sortBy` directives for lighthouse-php.
LastDragon-ru/lara-asp-graphql erreicht einen Gesundheitsindex von 8 von 100 und liegt damit im Bereich Kritisch. Am stärksten schneidet es bei Vitality (75/100) ab, am schwächsten bei Security (7/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
Metriken werden auf einer standardisierten Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr gewichtetes Mittel, kalibriert auf die Verteilung des öffentlichen Registers, sodass die Stufen Perzentilbedeutung tragen; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze Gefährdet von 34.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Der gewichtete Gesamtwert 43 wird auf der veröffentlichten Indexskala auf 39 kalibriert (Register-Kalibrierung 2026-08-02). Die Richtlinie für Hochrisikojurisdiktionen wendet einen Multiplikator von 20 % auf die gewichtete Gesamtgesundheit an und begrenzt sie auf die Obergrenze Gefährdet von 34.
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| Packagist | lastdragon-ru/lara-asp-graphql | 11.1.0 | 4.178 | 73 | vor 48 Tagen | phpstreamlaravelgraphqllaravel-packagelighthouselighthouse-phpsearchbysortby |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 11.1/36 | Commit-Rhythmus — 16/52 Wochen mit Commits |
| 16.8/18 | Commit-Volumen — 73 Commits im letzten Jahr |
| 7/10 | OpenSSF Scorecard: Maintained — 9 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 7 |
| commits_last_year | 73 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 16 |
| 16.2/27 | Liefert Releases aus — 73 Versions-Tags (keine GitHub-Releases) |
| 36/36 | Release-Aktualität — letztes Release vor 48 Tagen |
| 19.8/27 | Release-Rhythmus — ein Release etwa alle 46,3 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
| releases_count | 73 |
| latest_release_tag | 11.1.0 |
| releases_from_tags | ja |
| days_since_latest_release | 48 |
| mean_days_between_releases | 46,3 |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 9.8/60 | Stars — 5 Stars |
| 2.5/25 | Forks — 3 Forks |
| 0/15 | Watcher — 2 Watcher |
| forks | 3 |
| stars | 5 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
| has_readme | ja |
| has_license | ja |
| readme_badges | — |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| readme_badge_services | — |
| has_pull_request_template | nein |
| 48.3/80 | Downloads pro Monat — 4.178 Downloads/Monat über packagist |
| 2/20 | Abhängige in der Registry — 1 Pakete hängen davon ab |
| packages | lastdragon-ru/lara-asp-graphql |
| dependents | 1 |
| ecosystems | packagist |
| total_downloads | 126.173 |
| monthly_downloads | 4.178 |
| unverified_packages_excluded | — |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 0/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 100 % der Commits |
| 1.4/13.5 | Breite der Beitragenden — 1 Beitragende |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
| 0/42 | Issue-Lösungsquote — keine Issues oder keine Daten |
| 0/30 | PR-Annahme — keine entschiedenen Pull Requests oder keine Daten |
| 0/13 | Newcomer PR acceptance — kein PR eines Erstbeitragenden in 30 Tagen entschieden |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 0 |
| open_issues | 0 |
| closed_issues | 0 |
| prs_merged_7d | — |
| prs_decided_7d | — |
| prs_merged_30d | — |
| prs_decided_30d | — |
| issue_closed_ratio | — |
| closed_unmerged_prs | 0 |
| first_time_authors_30d | — |
| first_time_prs_merged_30d | — |
| first_time_prs_decided_30d | — |
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 6.9/25 | Reichweite des Inhabers — 8 Follower von LastDragon-ru |
| 23.2/25 | Kontohistorie — 34 öffentliche Repos, Kontoalter ca. 14 Jahre |
| followers | 8 |
| owner_type | User |
| is_verified | — |
| owner_login | LastDragon-ru |
| public_repos | 34 |
| account_age_days | 5.300 |
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf packagist |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 48 Tagen |
| 20/20 | Versionshistorie — 73 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | lastdragon-ru/lara-asp-graphql |
| ecosystems | packagist |
| any_deprecated | nein |
| min_days_since_publish | 48 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 0/24 | CI-Workflows |
| 24/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — keine Daten |
| has_ci | nein |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | nein |
| has_precommit_config | nein |
| 30/30 | README |
| 25/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://github.com/LastDragon-ru/php-packages |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 3 Topics |
| 0/10 | Wiki |
| topics | graphql, laravel, lighthouse |
| has_wiki | nein |
| homepage | https://github.com/LastDragon-ru/php-packages |
| docs_site | https://github.com/LastDragon-ru/php-packages |
| has_readme | ja |
| has_docs_dir | ja |
| has_description | ja |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
Grundlage sind selbst veröffentlichte öffentliche Profilstandorte. Dieses Governance-Signal bestimmt weder Nationalität, Staatsangehörigkeit, Absicht, Sanktionsstatus noch persönliche Vertrauenswürdigkeit.
So wird Jurisdiktionsexposition bewertet| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — keine Daten |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 0/10 | Dangerous-Workflow — keine Daten |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 5.2/7.5 | Maintained — 9 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 7 |
| 0/5 | Packaging — keine Daten |
| 0/5 | Pinned-Dependencies — keine Daten |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — keine Daten |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 3,4 |
| high_risk_jurisdiction_cap | 34 |
| high_risk_jurisdiction_multiplier | 20 |
| security_posture_after_multiplier | 7 |
| security_posture_before_jurisdiction | 34 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Trägt ein bewusst kleines Gewicht (4 %): Agenten-Tooling ist ein echtes Pflegesignal, doch ein Repository ohne jedes Signal kann weiterhin 100/100 erreichen.
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
| has_llms_txt | nein |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 0/11 | Statische Typprüfung |
| 0/10 | Reproduzierbare Umgebung |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 0/8 | Automatisierte Wartung — keine Daten |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — keine Daten |
| has_nix | nein |
| has_tests | ja |
| lockfiles | — |
| has_dockerfile | nein |
| typed_language | nein |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 0/45 | Typprüfbarer Code — PHP ohne Typprüfungs-Konfiguration |
| 54.8/55 | Handhabbare Dateigrößen — 1/355 Quelldateien über 60 KB |
| primary_language | PHP |
| largest_source_bytes | 70.984 |
| source_files_sampled | 355 |
| oversized_source_files | 1 |
| 40/40 | API-Schema (OpenAPI/GraphQL/proto) — src/Package/schema.graphql, src/Printer/PrinterTest/export/CodeInput.graphql, src/Printer/PrinterTest/export/CodeUnion.graphql, src/Printer/PrinterTest/export/InputObjectTypeDefinition.graphql, src/Printer/PrinterTest/export/SchemaType.graphql, src/Printer/PrinterTest/export/UnionTypeDefinitionNode.graphql, src/Printer/PrinterTest/print/DefaultSettings.graphql, src/Printer/PrinterTest/print/GraphQLSettings.graphql, src/Printer/PrinterTest/print/PrinterSettings-DirectiveDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings-Everything.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoDirectivesDefinitions.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoNormalization.graphql, src/Printer/PrinterTest/print/PrinterSettings-TypeDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings.graphql, src/Printer/PrinterTest/schema.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.expected.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.schema.graphql, src/SearchBy/Directives/DirectiveTest/Example.expected.graphql, src/SearchBy/Directives/DirectiveTest/Example.schema.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SearchBy/Directives/DirectiveTest/Query.expected.graphql, src/SearchBy/Directives/DirectiveTest/Query.schema.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SearchBy/Directives/DirectiveTest/Scout.expected.graphql, src/SearchBy/Directives/DirectiveTest/Scout.schema.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SortBy/Directives/DirectiveTest/Example.expected.graphql, src/SortBy/Directives/DirectiveTest/Example.schema.graphql, src/SortBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SortBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SortBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SortBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SortBy/Directives/DirectiveTest/Query.expected.graphql, src/SortBy/Directives/DirectiveTest/Query.schema.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SortBy/Directives/DirectiveTest/Scout.expected.graphql, src/SortBy/Directives/DirectiveTest/Scout.schema.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/Stream/Directives/DirectiveTest/schema-expected.graphql, src/Stream/Directives/DirectiveTest/schema.graphql, src/Stream/Directives/DirectiveTest/scout-expected.graphql, src/Stream/Directives/DirectiveTest/scout.graphql |
| 0/20 | MCP-Server — für diese Art von Software nicht anwendbar |
| 40/40 | Lauffähige Beispiele — examples |
| example_dirs | examples |
| has_mcp_signal | nein |
| api_schema_files | src/Package/schema.graphql, src/Printer/PrinterTest/export/CodeInput.graphql, src/Printer/PrinterTest/export/CodeUnion.graphql, src/Printer/PrinterTest/export/InputObjectTypeDefinition.graphql, src/Printer/PrinterTest/export/SchemaType.graphql, src/Printer/PrinterTest/export/UnionTypeDefinitionNode.graphql, src/Printer/PrinterTest/print/DefaultSettings.graphql, src/Printer/PrinterTest/print/GraphQLSettings.graphql, src/Printer/PrinterTest/print/PrinterSettings-DirectiveDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings-Everything.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoDirectivesDefinitions.graphql, src/Printer/PrinterTest/print/PrinterSettings-NoNormalization.graphql, src/Printer/PrinterTest/print/PrinterSettings-TypeDefinitionFilter.graphql, src/Printer/PrinterTest/print/PrinterSettings.graphql, src/Printer/PrinterTest/schema.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SearchBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.expected.graphql, src/SearchBy/Directives/DirectiveTest/CustomComplexOperator.schema.graphql, src/SearchBy/Directives/DirectiveTest/Example.expected.graphql, src/SearchBy/Directives/DirectiveTest/Example.schema.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SearchBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SearchBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SearchBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SearchBy/Directives/DirectiveTest/Query.expected.graphql, src/SearchBy/Directives/DirectiveTest/Query.schema.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SearchBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SearchBy/Directives/DirectiveTest/Scout.expected.graphql, src/SearchBy/Directives/DirectiveTest/Scout.schema.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SearchBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.expected.graphql, src/SortBy/Directives/DirectiveTest/AllowedDirectives.schema.graphql, src/SortBy/Directives/DirectiveTest/Example.expected.graphql, src/SortBy/Directives/DirectiveTest/Example.schema.graphql, src/SortBy/Directives/DirectiveTest/Explicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Explicit.schema.graphql, src/SortBy/Directives/DirectiveTest/Ignored.expected.graphql, src/SortBy/Directives/DirectiveTest/Ignored.schema.graphql, src/SortBy/Directives/DirectiveTest/Implicit.expected.graphql, src/SortBy/Directives/DirectiveTest/Implicit.schema.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.expected.graphql, src/SortBy/Directives/DirectiveTest/InterfaceUpdate.schema.graphql, src/SortBy/Directives/DirectiveTest/Query.expected.graphql, src/SortBy/Directives/DirectiveTest/Query.schema.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.expected.graphql, src/SortBy/Directives/DirectiveTest/ScalarOperators.schema.graphql, src/SortBy/Directives/DirectiveTest/Scout.expected.graphql, src/SortBy/Directives/DirectiveTest/Scout.schema.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.expected.graphql, src/SortBy/Directives/DirectiveTest/TypeRegistry.schema.graphql, src/Stream/Directives/DirectiveTest/schema-expected.graphql, src/Stream/Directives/DirectiveTest/schema.graphql, src/Stream/Directives/DirectiveTest/scout-expected.graphql, src/Stream/Directives/DirectiveTest/scout.graphql |
| interfaces_expected_of | — |
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| k. A. | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| k. A. | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 7 | Maintained | 9 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 7 |
| k. A. | Packaging | packaging workflow not detected |
| k. A. | Pinned-Dependencies | no dependencies found |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| k. A. | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| Packagist | illuminate/collections | ^13.10.0 | composer.json |
| Packagist | illuminate/contracts | ^13.10.0 | composer.json |
| Packagist | illuminate/database | ^13.10.0 | composer.json |
| Packagist | illuminate/support | ^13.10.0 | composer.json |
| Packagist | nuwave/lighthouse | ^6.66.0 | composer.json |
| Packagist | lastdragon-ru/lara-asp-core | self.version | composer.json |
| Packagist | lastdragon-ru/lara-asp-eloquent | self.version | composer.json |
| Packagist | lastdragon-ru/lara-asp-serializer | self.version | composer.json |
| Packagist | lastdragon-ru/graphql-printer | self.version | composer.json |
| Packagist | symfony/polyfill-php85 | ^1.36.0 | composer.json |
| Packagist | webonyx/graphql-php | ^15.32.3 | composer.json |
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 11 direkte und 12 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| Packagist | illuminate/collections | — | direkt |
| Packagist | illuminate/contracts | — | direkt |
| Packagist | illuminate/database | — | direkt |
| Packagist | illuminate/support | — | direkt |
| Packagist | lastdragon-ru/graphql-printer | — | direkt |
| Packagist | lastdragon-ru/lara-asp-core | — | direkt |
| Packagist | lastdragon-ru/lara-asp-eloquent | — | direkt |
| Packagist | lastdragon-ru/lara-asp-serializer | — | direkt |
| Packagist | nuwave/lighthouse | — | direkt |
| Packagist | symfony/polyfill-php85 | — | direkt |
| Packagist | webonyx/graphql-php | — | direkt |
| Packagist | composer/semver | — | indirekt |
| Packagist | ext-filter | — | indirekt |
| Packagist | ext-mbstring | — | indirekt |
| Packagist | laravel/scout | — | indirekt |
| Packagist | lastdragon-ru/lara-asp-graphql-testing | — | indirekt |
| Packagist | lastdragon-ru/lara-asp-testing | — | indirekt |
| Packagist | lastdragon-ru/phpunit-extensions | — | indirekt |
| Packagist | lastdragon-ru/phpunit-graphql | — | indirekt |
| Packagist | mockery/mockery | — | indirekt |
| Packagist | orchestra/testbench | — | indirekt |
| Packagist | php | — | indirekt |
| Packagist | phpunit/phpunit | — | indirekt |
Stimmt etwas in diesem Bericht nicht, oder gibt es Gedanken dazu? Falsche Messungen, übersehene Tools, Ideen, Fragen — alles ist willkommen. Jede Nachricht wird gelesen und beantwortet.
Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v2.10.0, Schema v0.15.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — Packagist.