Use passkeys in your filament app
MarcelWeidum/filament-passkeys holds a health index of 66 out of 100, placing it in the Moderate band. It scores highest on Vitality (92/100) and lowest on AI Readiness (19/100). It was last updated today. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| Packagist | marcelweidum/filament-passkeys | v4.0.5 | 7,226 | 29 | 11 days ago | laravelfilamentfilamentphpmarcelweidumfilament-passkeys |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 0 days ago |
| 21.5/36 | Commit cadence — 31/52 weeks with commits |
| 18/18 | Commit volume — 149 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 149 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 31 |
| 27/27 | Ships releases — 29 releases published |
| 36/36 | Release recency — latest release 11 days ago |
| 27/27 | Release cadence — a release every ~9 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 29 |
| latest_release_tag | v4.0.5 |
| releases_from_tags | no |
| days_since_latest_release | 11 |
| mean_days_between_releases | 9 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 29.5/60 | Stars — 67 stars |
| 9.8/25 | Forks — 16 forks |
| 0/15 | Watchers — 2 watchers |
| forks | 16 |
| stars | 67 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 18/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
| 51.5/80 | Monthly downloads — 7,226 downloads/month across packagist |
| 2/20 | Registry dependents — 1 packages depend on it |
| packages | marcelweidum/filament-passkeys |
| dependents | 1 |
| ecosystems | packagist |
| total_downloads | 54,357 |
| monthly_downloads | 7,226 |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 7/22.5 | Commit distribution — top contributor authored 69% of commits |
| 12.2/13.5 | Contributor breadth — 9 contributors |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 9 |
| top_contributor_share | 0.689 |
| 46.8/46.8 | Issue resolution — 100% of issues closed |
| 37.5/38.3 | PR acceptance — 50/51 decided PRs merged |
| 7.5/15 | OpenSSF Scorecard: Code-Review — Found 1/2 approved changesets -- score normalized to 5 |
| merged_prs | 50 |
| open_issues | 0 |
| closed_issues | 20 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 1 |
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 10.5/25 | Owner reach — 28 followers of MarcelWeidum |
| 24/25 | Track record — 43 public repos, account ~11 yr old |
| followers | 28 |
| owner_type | User |
| is_verified | — |
| owner_login | MarcelWeidum |
| public_repos | 43 |
| account_age_days | 4,284 |
| 25/25 | Published & resolvable — 1 package(s) on packagist |
| 35/35 | Publish recency — latest publish 11 days ago |
| 20/20 | Version history — 29 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | marcelweidum/filament-passkeys |
| ecosystems | packagist |
| any_deprecated | no |
| min_days_since_publish | 11 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 2 workflow(s) |
| 0/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 6.4/6.4 | .editorconfig |
| 16/20 | OpenSSF Scorecard: CI-Tests — 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| has_ci | yes |
| has_tests | no |
| has_editorconfig | yes |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 10/10 | Topics — 17 topics |
| 0/10 | Wiki |
| topics | filament, filament-4, filament-plugin, filamentphp, filamentphp-4, filamentphp-plugin, livewire, passkey, passkeys, php, plugin, filament-passkey, filament-passkeys, filamentphp-passkey, filamentphp-passkeys, spatie-passkey, spatie-passkeys |
| has_wiki | no |
| homepage | — |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — no data |
| 2/2.5 | CI-Tests — 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 3.8/7.5 | Code-Review — Found 1/2 approved changesets -- score normalized to 5 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 0/10 | Dangerous-Workflow — no data |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — no data |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — no data |
| 6.8/7.5 | Vulnerabilities — 1 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 6 |
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 0/25 | Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
| source | osv |
| advisories | 1 |
| affected_packages | 1 |
| assessed_packages | 302 |
| unassessed_packages | 6 |
| affected_by_severity | high 1 |
| direct_affected_packages | 0 |
How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 0/40 | Legible commit history — no data |
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | One-command bootstrap |
| 0/22 | Automated tests |
| 0/11 | Lint / format config |
| 0/11 | Static type checking |
| 10/10 | Reproducible environment — lockfile |
| 0/10 | Demonstrated agent practice — no data |
| 5/8 | Automated maintenance — dependency automation configured, none observed in the sampled commits |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — no data |
| has_nix | no |
| has_tests | no |
| lockfiles | package-lock.json |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 0/45 | Type-checkable code — PHP without a type-check config |
| 55/55 | Manageable file sizes — 0/16 source files over 60KB |
| primary_language | PHP |
| largest_source_bytes | 3,714 |
| source_files_sampled | 16 |
| oversized_source_files | 0 |
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/a | Branch-Protection | internal error: error during GetBranch(2.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 8 | CI-Tests | 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 5 | Code-Review | Found 1/2 approved changesets -- score normalized to 5 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| n/a | Dangerous-Workflow | no workflows found |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| n/a | Packaging | packaging workflow not detected |
| n/a | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| n/a | Token-Permissions | No tokens found |
| 9 | Vulnerabilities | 1 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| Packagist | filament/filament | ^5.0 | composer.json |
| Packagist | laravel/passkeys | ^0.2.0 | composer.json |
| Packagist | spatie/laravel-package-tools | ^1.15.0 | composer.json |
| npm | @laravel/passkeys | ^0.1.0 | package.json |
| npm | @tailwindcss/cli | ^4.1.11 | package.json |
Full resolved dependency set from the GitHub dependency graph: 5 direct and 303 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | @laravel/passkeys | 0.1.0 | direct |
| npm | @tailwindcss/cli | 4.1.11 | direct |
| Packagist | filament/filament | — | direct |
| Packagist | laravel/passkeys | — | direct |
| Packagist | spatie/laravel-package-tools | — | direct |
| npm | @ampproject/remapping | 2.3.0 | indirect |
| npm | @awcodes/filament-plugin-purge | 1.1.2 | indirect |
| npm | @emnapi/core | 1.4.3 | indirect |
| npm | @emnapi/runtime | 1.4.3 | indirect |
| npm | @emnapi/wasi-threads | 1.0.2 | indirect |
| npm | @esbuild/aix-ppc64 | 0.28.1 | indirect |
| npm | @esbuild/android-arm | 0.28.1 | indirect |
| npm | @esbuild/android-arm64 | 0.28.1 | indirect |
| npm | @esbuild/android-x64 | 0.28.1 | indirect |
| npm | @esbuild/darwin-arm64 | 0.28.1 | indirect |
| npm | @esbuild/darwin-x64 | 0.28.1 | indirect |
| npm | @esbuild/freebsd-arm64 | 0.28.1 | indirect |
| npm | @esbuild/freebsd-x64 | 0.28.1 | indirect |
| npm | @esbuild/linux-arm | 0.28.1 | indirect |
| npm | @esbuild/linux-arm64 | 0.28.1 | indirect |
| npm | @esbuild/linux-ia32 | 0.28.1 | indirect |
| npm | @esbuild/linux-loong64 | 0.28.1 | indirect |
| npm | @esbuild/linux-mips64el | 0.28.1 | indirect |
| npm | @esbuild/linux-ppc64 | 0.28.1 | indirect |
| npm | @esbuild/linux-riscv64 | 0.28.1 | indirect |
| npm | @esbuild/linux-s390x | 0.28.1 | indirect |
| npm | @esbuild/linux-x64 | 0.28.1 | indirect |
| npm | @esbuild/netbsd-arm64 | 0.28.1 | indirect |
| npm | @esbuild/netbsd-x64 | 0.28.1 | indirect |
| npm | @esbuild/openbsd-arm64 | 0.28.1 | indirect |
| npm | @esbuild/openbsd-x64 | 0.28.1 | indirect |
| npm | @esbuild/openharmony-arm64 | 0.28.1 | indirect |
| npm | @esbuild/sunos-x64 | 0.28.1 | indirect |
| npm | @esbuild/win32-arm64 | 0.28.1 | indirect |
| npm | @esbuild/win32-ia32 | 0.28.1 | indirect |
| npm | @esbuild/win32-x64 | 0.28.1 | indirect |
| npm | @isaacs/fs-minipass | 4.0.1 | indirect |
| npm | @jridgewell/gen-mapping | 0.3.13 | indirect |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirect |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirect |
| npm | @jridgewell/trace-mapping | 0.3.30 | indirect |
| npm | @napi-rs/wasm-runtime | 0.2.11 | indirect |
| npm | @parcel/watcher | 2.5.1 | indirect |
| npm | @parcel/watcher-android-arm64 | 2.5.1 | indirect |
| npm | @parcel/watcher-darwin-arm64 | 2.5.1 | indirect |
| npm | @parcel/watcher-darwin-x64 | 2.5.1 | indirect |
| npm | @parcel/watcher-freebsd-x64 | 2.5.1 | indirect |
| npm | @parcel/watcher-linux-arm-glibc | 2.5.1 | indirect |
| npm | @parcel/watcher-linux-arm-musl | 2.5.1 | indirect |
| npm | @parcel/watcher-linux-arm64-glibc | 2.5.1 | indirect |
| npm | @parcel/watcher-linux-arm64-musl | 2.5.1 | indirect |
| npm | @parcel/watcher-linux-x64-glibc | 2.5.1 | indirect |
| npm | @parcel/watcher-linux-x64-musl | 2.5.1 | indirect |
| npm | @parcel/watcher-win32-arm64 | 2.5.1 | indirect |
| npm | @parcel/watcher-win32-ia32 | 2.5.1 | indirect |
| npm | @parcel/watcher-win32-x64 | 2.5.1 | indirect |
| npm | @simplewebauthn/browser | 13.1.2 | indirect |
| npm | @tailwindcss/forms | 0.5.10 | indirect |
| npm | @tailwindcss/node | 4.1.11 | indirect |
| npm | @tailwindcss/oxide | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-android-arm64 | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-darwin-arm64 | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-darwin-x64 | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-freebsd-x64 | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-linux-arm-gnueabihf | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-linux-arm64-gnu | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-linux-arm64-musl | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-linux-x64-gnu | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-linux-x64-musl | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-wasm32-wasi | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-win32-arm64-msvc | 4.1.11 | indirect |
| npm | @tailwindcss/oxide-win32-x64-msvc | 4.1.11 | indirect |
| npm | @tailwindcss/typography | 0.5.16 | indirect |
| npm | @tybys/wasm-util | 0.9.0 | indirect |
| npm | agent-base | 6.0.2 | indirect |
| npm | ansi-regex | 6.1.0 | indirect |
| npm | ansi-styles | 3.2.1 | indirect |
| npm | array-buffer-byte-length | 1.0.2 | indirect |
| npm | arraybuffer.prototype.slice | 1.0.4 | indirect |
| npm | async-function | 1.0.0 | indirect |
| npm | asynckit | 0.4.0 | indirect |
| npm | autoprefixer | 10.4.21 | indirect |
| npm | available-typed-arrays | 1.0.7 | indirect |
| npm | axios | 1.18.1 | indirect |
| npm | balanced-match | 1.0.2 | indirect |
| npm | base64-js | 1.5.1 | indirect |
| npm | bl | 5.1.0 | indirect |
| npm | brace-expansion | 1.1.14 | indirect |
| npm | braces | 3.0.3 | indirect |
| npm | browserslist | 4.25.2 | indirect |
| npm | buffer | 6.0.3 | indirect |
| npm | call-bind | 1.0.8 | indirect |
| npm | call-bind-apply-helpers | 1.0.2 | indirect |
| npm | call-bound | 1.0.4 | indirect |
| npm | caniuse-lite | 1.0.30001734 | indirect |
| npm | chalk | 2.4.2 | indirect |
| npm | chalk | 5.5.0 | indirect |
| npm | chownr | 3.0.0 | indirect |
| npm | cli-cursor | 4.0.0 | indirect |
| npm | cli-spinners | 2.9.2 | indirect |
| npm | clone | 1.0.4 | indirect |
| npm | color-convert | 1.9.3 | indirect |
| npm | color-name | 1.1.3 | indirect |
| npm | combined-stream | 1.0.8 | indirect |
| npm | concat-map | 0.0.1 | indirect |
| npm | cross-spawn | 6.0.6 | indirect |
| npm | css-tree | 2.3.1 | indirect |
| npm | cssesc | 3.0.0 | indirect |
| npm | data-view-buffer | 1.0.2 | indirect |
| npm | data-view-byte-length | 1.0.2 | indirect |
| npm | data-view-byte-offset | 1.0.1 | indirect |
| npm | debug | 4.4.3 | indirect |
| npm | defaults | 1.0.4 | indirect |
| npm | define-data-property | 1.1.4 | indirect |
| npm | define-properties | 1.2.1 | indirect |
| npm | delayed-stream | 1.0.0 | indirect |
| npm | detect-libc | 1.0.3 | indirect |
| npm | detect-libc | 2.0.4 | indirect |
| npm | dunder-proto | 1.0.1 | indirect |
| npm | electron-to-chromium | 1.5.200 | indirect |
| npm | enhanced-resolve | 5.18.3 | indirect |
| npm | error-ex | 1.3.2 | indirect |
| npm | es-abstract | 1.24.0 | indirect |
| npm | es-define-property | 1.0.1 | indirect |
| npm | es-errors | 1.3.0 | indirect |
| npm | es-object-atoms | 1.1.1 | indirect |
| npm | es-set-tostringtag | 2.1.0 | indirect |
| npm | es-to-primitive | 1.3.0 | indirect |
| npm | esbuild | 0.28.1 | indirect |
| npm | escalade | 3.2.0 | indirect |
| npm | escape-string-regexp | 1.0.5 | indirect |
| npm | fill-range | 7.1.1 | indirect |
| npm | follow-redirects | 1.16.0 | indirect |
| npm | for-each | 0.3.5 | indirect |
| npm | form-data | 4.0.6 | indirect |
| npm | fraction.js | 4.3.7 | indirect |
| npm | function-bind | 1.1.2 | indirect |
| npm | function.prototype.name | 1.1.8 | indirect |
| npm | functions-have-names | 1.2.3 | indirect |
| npm | get-intrinsic | 1.3.0 | indirect |
| npm | get-proto | 1.0.1 | indirect |
| npm | get-symbol-description | 1.1.0 | indirect |
| npm | globalthis | 1.0.4 | indirect |
| npm | gopd | 1.2.0 | indirect |
| npm | graceful-fs | 4.2.11 | indirect |
| npm | has-bigints | 1.1.0 | indirect |
| npm | has-flag | 3.0.0 | indirect |
| npm | has-property-descriptors | 1.0.2 | indirect |
| npm | has-proto | 1.2.0 | indirect |
| npm | has-symbols | 1.1.0 | indirect |
| npm | has-tostringtag | 1.0.2 | indirect |
| npm | hasown | 2.0.4 | indirect |
| npm | hosted-git-info | 2.8.9 | indirect |
| npm | https-proxy-agent | 5.0.1 | indirect |
| npm | ieee754 | 1.2.1 | indirect |
| npm | inherits | 2.0.4 | indirect |
| npm | internal-slot | 1.1.0 | indirect |
| npm | is-array-buffer | 3.0.5 | indirect |
| npm | is-arrayish | 0.2.1 | indirect |
| npm | is-async-function | 2.1.1 | indirect |
| npm | is-bigint | 1.1.0 | indirect |
| npm | is-boolean-object | 1.2.2 | indirect |
| npm | is-callable | 1.2.7 | indirect |
| npm | is-core-module | 2.16.1 | indirect |
| npm | is-data-view | 1.0.2 | indirect |
| npm | is-date-object | 1.1.0 | indirect |
| npm | is-extglob | 2.1.1 | indirect |
| npm | is-finalizationregistry | 1.1.1 | indirect |
| npm | is-generator-function | 1.1.0 | indirect |
| npm | is-glob | 4.0.3 | indirect |
| npm | is-interactive | 2.0.0 | indirect |
| npm | is-map | 2.0.3 | indirect |
| npm | is-negative-zero | 2.0.3 | indirect |
| npm | is-number | 7.0.0 | indirect |
| npm | is-number-object | 1.1.1 | indirect |
| npm | is-regex | 1.2.1 | indirect |
| npm | is-set | 2.0.3 | indirect |
| npm | is-shared-array-buffer | 1.0.4 | indirect |
| npm | is-string | 1.1.1 | indirect |
| npm | is-symbol | 1.1.1 | indirect |
| npm | is-typed-array | 1.1.15 | indirect |
| npm | is-unicode-supported | 1.3.0 | indirect |
| npm | is-weakmap | 2.0.2 | indirect |
| npm | is-weakref | 1.1.1 | indirect |
| npm | is-weakset | 2.0.4 | indirect |
| npm | isarray | 2.0.5 | indirect |
| npm | isexe | 2.0.0 | indirect |
| npm | jiti | 2.5.1 | indirect |
| npm | json-parse-better-errors | 1.0.2 | indirect |
| npm | lightningcss | 1.30.1 | indirect |
| npm | lightningcss-darwin-arm64 | 1.30.1 | indirect |
| npm | lightningcss-darwin-x64 | 1.30.1 | indirect |
| npm | lightningcss-freebsd-x64 | 1.30.1 | indirect |
| npm | lightningcss-linux-arm-gnueabihf | 1.30.1 | indirect |
| npm | lightningcss-linux-arm64-gnu | 1.30.1 | indirect |
| npm | lightningcss-linux-arm64-musl | 1.30.1 | indirect |
| npm | lightningcss-linux-x64-gnu | 1.30.1 | indirect |
| npm | lightningcss-linux-x64-musl | 1.30.1 | indirect |
| npm | lightningcss-win32-arm64-msvc | 1.30.1 | indirect |
| npm | lightningcss-win32-x64-msvc | 1.30.1 | indirect |
| npm | load-json-file | 4.0.0 | indirect |
| npm | lodash.castarray | 4.4.0 | indirect |
| npm | lodash.isplainobject | 4.0.6 | indirect |
| npm | lodash.merge | 4.6.2 | indirect |
| npm | log-symbols | 5.1.0 | indirect |
| npm | magic-string | 0.30.17 | indirect |
| npm | math-intrinsics | 1.1.0 | indirect |
| npm | mdn-data | 2.0.30 | indirect |
| npm | memorystream | 0.3.1 | indirect |
| npm | micromatch | 4.0.8 | indirect |
| npm | mime-db | 1.52.0 | indirect |
| npm | mime-types | 2.1.35 | indirect |
| npm | mimic-fn | 2.1.0 | indirect |
| npm | mini-svg-data-uri | 1.4.4 | indirect |
| npm | minimatch | 3.1.5 | indirect |
| npm | minipass | 7.1.2 | indirect |
| npm | minizlib | 3.1.0 | indirect |
| npm | mri | 1.2.0 | indirect |
| npm | ms | 2.1.3 | indirect |
| npm | nanoid | 3.3.11 | indirect |
| npm | nice-try | 1.0.5 | indirect |
| npm | node-addon-api | 7.1.1 | indirect |
| npm | node-releases | 2.0.19 | indirect |
| npm | normalize-package-data | 2.5.0 | indirect |
| npm | normalize-range | 0.1.2 | indirect |
| npm | npm-run-all | 4.1.5 | indirect |
| npm | object-inspect | 1.13.4 | indirect |
| npm | object-keys | 1.1.1 | indirect |
| npm | object.assign | 4.1.7 | indirect |
| npm | onetime | 5.1.2 | indirect |
| npm | ora | 6.3.1 | indirect |
| npm | own-keys | 1.0.1 | indirect |
| npm | parse-json | 4.0.0 | indirect |
| npm | path-key | 2.0.1 | indirect |
| npm | path-parse | 1.0.7 | indirect |
| npm | path-type | 3.0.0 | indirect |
| npm | picocolors | 1.1.1 | indirect |
| npm | picomatch | 2.3.2 | indirect |
| npm | pidtree | 0.3.1 | indirect |
| npm | pify | 3.0.0 | indirect |
| npm | possible-typed-array-names | 1.1.0 | indirect |
| npm | postcss | 8.5.13 | indirect |
| npm | postcss-selector-parser | 6.0.10 | indirect |
| npm | postcss-value-parser | 4.2.0 | indirect |
| npm | prettier | 2.8.8 | indirect |
| npm | prettier-plugin-tailwindcss | 0.1.13 | indirect |
| npm | proxy-from-env | 2.1.0 | indirect |
| npm | read-pkg | 3.0.0 | indirect |
| npm | readable-stream | 3.6.2 | indirect |
| npm | reflect.getprototypeof | 1.0.10 | indirect |
| npm | regexp.prototype.flags | 1.5.4 | indirect |
| npm | resolve | 1.22.10 | indirect |
| npm | restore-cursor | 4.0.0 | indirect |
| npm | safe-array-concat | 1.1.3 | indirect |
| npm | safe-buffer | 5.2.1 | indirect |
| npm | safe-push-apply | 1.0.0 | indirect |
| npm | safe-regex-test | 1.1.0 | indirect |
| npm | semver | 5.7.2 | indirect |
| npm | set-function-length | 1.2.2 | indirect |
| npm | set-function-name | 2.0.2 | indirect |
| npm | set-proto | 1.0.0 | indirect |
| npm | shebang-command | 1.2.0 | indirect |
| npm | shebang-regex | 1.0.0 | indirect |
| npm | shell-quote | 1.8.4 | indirect |
| npm | side-channel | 1.1.0 | indirect |
| npm | side-channel-list | 1.0.0 | indirect |
| npm | side-channel-map | 1.0.1 | indirect |
| npm | side-channel-weakmap | 1.0.2 | indirect |
| npm | signal-exit | 3.0.7 | indirect |
| npm | source-map-js | 1.2.1 | indirect |
| npm | spdx-correct | 3.2.0 | indirect |
| npm | spdx-exceptions | 2.5.0 | indirect |
| npm | spdx-expression-parse | 3.0.1 | indirect |
| npm | spdx-license-ids | 3.0.22 | indirect |
| npm | stdin-discarder | 0.1.0 | indirect |
| npm | stop-iteration-iterator | 1.1.0 | indirect |
| npm | string.prototype.padend | 3.1.6 | indirect |
| npm | string.prototype.trim | 1.2.10 | indirect |
| npm | string.prototype.trimend | 1.0.9 | indirect |
| npm | string.prototype.trimstart | 1.0.8 | indirect |
| npm | string_decoder | 1.3.0 | indirect |
| npm | strip-ansi | 7.1.0 | indirect |
| npm | strip-bom | 3.0.0 | indirect |
| npm | supports-color | 5.5.0 | indirect |
| npm | supports-preserve-symlinks-flag | 1.0.0 | indirect |
| npm | tailwindcss | 4.1.11 | indirect |
| npm | tapable | 2.2.2 | indirect |
| npm | tar | 7.5.16 | indirect |
| npm | to-regex-range | 5.0.1 | indirect |
| npm | tslib | 2.8.0 | indirect |
| npm | typed-array-buffer | 1.0.3 | indirect |
| npm | typed-array-byte-length | 1.0.3 | indirect |
| npm | typed-array-byte-offset | 1.0.4 | indirect |
| npm | typed-array-length | 1.0.7 | indirect |
| npm | unbox-primitive | 1.1.0 | indirect |
| npm | update-browserslist-db | 1.1.3 | indirect |
| npm | util-deprecate | 1.0.2 | indirect |
| npm | validate-npm-package-license | 3.0.4 | indirect |
| npm | wcwidth | 1.0.1 | indirect |
| npm | which | 1.3.1 | indirect |
| npm | which-boxed-primitive | 1.1.1 | indirect |
| npm | which-builtin-type | 1.2.1 | indirect |
| npm | which-collection | 1.0.2 | indirect |
| npm | which-typed-array | 1.1.19 | indirect |
| npm | yallist | 5.0.0 | indirect |
| Packagist | laravel/pint | — | indirect |
| Packagist | php | — | indirect |
| Packagist | spatie/laravel-ray | — | indirect |
This repository publishes no package the index resolves, so its own dependency graph was assessed — 302 packages, which also include development and test pins that never ship: 1 carry known advisories, of which 0 are direct. 6 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list.
| Package | Version | Relation | Severity | Advisories | Fixed in |
|---|---|---|---|---|---|
| brace-expansion | 1.1.14 | indirect | high | 1 | 5.0.7 |
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
{
"data": {
"repo": {
"topics": [
"filament",
"filament-4",
"filament-plugin",
"filamentphp",
"filamentphp-4",
"filamentphp-plugin",
"livewire",
"passkey",
"passkeys",
"php",
"plugin",
"filament-passkey",
"filament-passkeys",
"filamentphp-passkey",
"filamentphp-passkeys",
"spatie-passkey",
"spatie-passkeys"
],
"is_fork": false,
"size_kb": 4706,
"has_wiki": false,
"homepage": null,
"languages": {
"CSS": 59,
"PHP": 16150,
"Blade": 3482,
"JavaScript": 1849
},
"pushed_at": "2026-07-20T18:21:25Z",
"created_at": "2025-08-11T18:25:07Z",
"owner_type": "User",
"updated_at": "2026-07-20T18:22:34Z",
"description": "Use passkeys in your filament app",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "4.x",
"license_spdx_raw": "MIT",
"primary_language": "PHP",
"significant_languages": [
"PHP",
"Blade"
]
},
"owner": {
"blog": null,
"name": "Marcel",
"type": "User",
"login": "MarcelWeidum",
"company": null,
"location": "Netherlands",
"followers": 28,
"avatar_url": "https://avatars.githubusercontent.com/u/9413586?v=4",
"created_at": "2014-10-27T08:32:06Z",
"is_verified": null,
"public_repos": 43,
"account_age_days": 4284
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 29,
"commits_last_year": 149,
"latest_release_at": "2026-07-09T16:46:04Z",
"latest_release_tag": "v4.0.5",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 31,
"days_since_latest_release": 11,
"mean_days_between_releases": 9
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 71,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "marcelweidum/filament-passkeys",
"exists": true,
"license": "MIT",
"keywords": [
"laravel",
"filament",
"filamentphp",
"MarcelWeidum",
"filament-passkeys"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/marcelweidum/filament-passkeys",
"is_deprecated": false,
"latest_version": "v4.0.5",
"repository_url": "https://github.com/MarcelWeidum/filament-passkeys",
"versions_count": 29,
"total_downloads": 54357,
"dependents_count": 1,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 7226,
"first_published_at": null,
"latest_published_at": "2026-07-09T16:45:39Z",
"latest_version_yanked": null,
"days_since_latest_publish": 11
}
]
},
"popularity": {
"forks": 16,
"stars": 67,
"watchers": 2,
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 3714,
"source_files_sampled": 16,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json",
"package.json"
],
"advisories": {
"error": null,
"scope": "repository_graph",
"source": "osv",
"findings": [
{
"name": "brace-expansion",
"direct": false,
"version": "1.1.14",
"severity": "high",
"ecosystem": "npm",
"cvss_score": 7.5,
"advisory_ids": [
"GHSA-3jxr-9vmj-r5cp"
],
"fixed_version": "5.0.7",
"advisory_count": 1,
"oldest_advisory_days": 0
}
],
"collected": true,
"truncated": false,
"by_severity": {
"high": 1
},
"advisory_count": 1,
"affected_count": 1,
"assessed_count": 302,
"assessed_package": null,
"unassessed_count": 6,
"direct_affected_count": 0
},
"ecosystems": [
"npm",
"packagist"
],
"dependencies": [
{
"name": "filament/filament",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^5.0"
},
{
"name": "laravel/passkeys",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^0.2.0"
},
{
"name": "spatie/laravel-package-tools",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^1.15.0"
},
{
"name": "@laravel/passkeys",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^0.1.0"
},
{
"name": "@tailwindcss/cli",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^4.1.11"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "@laravel/passkeys",
"direct": true,
"version": "0.1.0",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/cli",
"direct": true,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "filament/filament",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "laravel/passkeys",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-package-tools",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "@ampproject/remapping",
"direct": false,
"version": "2.3.0",
"ecosystem": "npm"
},
{
"name": "@awcodes/filament-plugin-purge",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "@emnapi/core",
"direct": false,
"version": "1.4.3",
"ecosystem": "npm"
},
{
"name": "@emnapi/runtime",
"direct": false,
"version": "1.4.3",
"ecosystem": "npm"
},
{
"name": "@emnapi/wasi-threads",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "@esbuild/aix-ppc64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-arm",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/darwin-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/darwin-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/freebsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/freebsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-arm",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-ia32",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-loong64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-mips64el",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-ppc64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-riscv64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-s390x",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/netbsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/netbsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openbsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openbsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openharmony-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/sunos-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-ia32",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@isaacs/fs-minipass",
"direct": false,
"version": "4.0.1",
"ecosystem": "npm"
},
{
"name": "@jridgewell/gen-mapping",
"direct": false,
"version": "0.3.13",
"ecosystem": "npm"
},
{
"name": "@jridgewell/resolve-uri",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "@jridgewell/sourcemap-codec",
"direct": false,
"version": "1.5.5",
"ecosystem": "npm"
},
{
"name": "@jridgewell/trace-mapping",
"direct": false,
"version": "0.3.30",
"ecosystem": "npm"
},
{
"name": "@napi-rs/wasm-runtime",
"direct": false,
"version": "0.2.11",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-android-arm64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-darwin-arm64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-darwin-x64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-freebsd-x64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm-glibc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm-musl",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm64-glibc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm64-musl",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-x64-glibc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-x64-musl",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-win32-arm64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-win32-ia32",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-win32-x64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@simplewebauthn/browser",
"direct": false,
"version": "13.1.2",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/forms",
"direct": false,
"version": "0.5.10",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/node",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-android-arm64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-darwin-arm64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-darwin-x64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-freebsd-x64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-arm-gnueabihf",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-arm64-gnu",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-arm64-musl",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-x64-gnu",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-x64-musl",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-wasm32-wasi",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-win32-arm64-msvc",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-win32-x64-msvc",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/typography",
"direct": false,
"version": "0.5.16",
"ecosystem": "npm"
},
{
"name": "@tybys/wasm-util",
"direct": false,
"version": "0.9.0",
"ecosystem": "npm"
},
{
"name": "agent-base",
"direct": false,
"version": "6.0.2",
"ecosystem": "npm"
},
{
"name": "ansi-regex",
"direct": false,
"version": "6.1.0",
"ecosystem": "npm"
},
{
"name": "ansi-styles",
"direct": false,
"version": "3.2.1",
"ecosystem": "npm"
},
{
"name": "array-buffer-byte-length",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "arraybuffer.prototype.slice",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "async-function",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "asynckit",
"direct": false,
"version": "0.4.0",
"ecosystem": "npm"
},
{
"name": "autoprefixer",
"direct": false,
"version": "10.4.21",
"ecosystem": "npm"
},
{
"name": "available-typed-arrays",
"direct": false,
"version": "1.0.7",
"ecosystem": "npm"
},
{
"name": "axios",
"direct": false,
"version": "1.18.1",
"ecosystem": "npm"
},
{
"name": "balanced-match",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "base64-js",
"direct": false,
"version": "1.5.1",
"ecosystem": "npm"
},
{
"name": "bl",
"direct": false,
"version": "5.1.0",
"ecosystem": "npm"
},
{
"name": "brace-expansion",
"direct": false,
"version": "1.1.14",
"ecosystem": "npm"
},
{
"name": "braces",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "browserslist",
"direct": false,
"version": "4.25.2",
"ecosystem": "npm"
},
{
"name": "buffer",
"direct": false,
"version": "6.0.3",
"ecosystem": "npm"
},
{
"name": "call-bind",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "call-bind-apply-helpers",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "call-bound",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "caniuse-lite",
"direct": false,
"version": "1.0.30001734",
"ecosystem": "npm"
},
{
"name": "chalk",
"direct": false,
"version": "2.4.2",
"ecosystem": "npm"
},
{
"name": "chalk",
"direct": false,
"version": "5.5.0",
"ecosystem": "npm"
},
{
"name": "chownr",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "cli-cursor",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "cli-spinners",
"direct": false,
"version": "2.9.2",
"ecosystem": "npm"
},
{
"name": "clone",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "color-convert",
"direct": false,
"version": "1.9.3",
"ecosystem": "npm"
},
{
"name": "color-name",
"direct": false,
"version": "1.1.3",
"ecosystem": "npm"
},
{
"name": "combined-stream",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "concat-map",
"direct": false,
"version": "0.0.1",
"ecosystem": "npm"
},
{
"name": "cross-spawn",
"direct": false,
"version": "6.0.6",
"ecosystem": "npm"
},
{
"name": "css-tree",
"direct": false,
"version": "2.3.1",
"ecosystem": "npm"
},
{
"name": "cssesc",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "data-view-buffer",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "data-view-byte-length",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "data-view-byte-offset",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "debug",
"direct": false,
"version": "4.4.3",
"ecosystem": "npm"
},
{
"name": "defaults",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "define-data-property",
"direct": false,
"version": "1.1.4",
"ecosystem": "npm"
},
{
"name": "define-properties",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "delayed-stream",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "detect-libc",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "detect-libc",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "dunder-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "electron-to-chromium",
"direct": false,
"version": "1.5.200",
"ecosystem": "npm"
},
{
"name": "enhanced-resolve",
"direct": false,
"version": "5.18.3",
"ecosystem": "npm"
},
{
"name": "error-ex",
"direct": false,
"version": "1.3.2",
"ecosystem": "npm"
},
{
"name": "es-abstract",
"direct": false,
"version": "1.24.0",
"ecosystem": "npm"
},
{
"name": "es-define-property",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "es-errors",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "es-object-atoms",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "es-set-tostringtag",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "es-to-primitive",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "esbuild",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "escalade",
"direct": false,
"version": "3.2.0",
"ecosystem": "npm"
},
{
"name": "escape-string-regexp",
"direct": false,
"version": "1.0.5",
"ecosystem": "npm"
},
{
"name": "fill-range",
"direct": false,
"version": "7.1.1",
"ecosystem": "npm"
},
{
"name": "follow-redirects",
"direct": false,
"version": "1.16.0",
"ecosystem": "npm"
},
{
"name": "for-each",
"direct": false,
"version": "0.3.5",
"ecosystem": "npm"
},
{
"name": "form-data",
"direct": false,
"version": "4.0.6",
"ecosystem": "npm"
},
{
"name": "fraction.js",
"direct": false,
"version": "4.3.7",
"ecosystem": "npm"
},
{
"name": "function-bind",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "function.prototype.name",
"direct": false,
"version": "1.1.8",
"ecosystem": "npm"
},
{
"name": "functions-have-names",
"direct": false,
"version": "1.2.3",
"ecosystem": "npm"
},
{
"name": "get-intrinsic",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "get-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "get-symbol-description",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "globalthis",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "gopd",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "graceful-fs",
"direct": false,
"version": "4.2.11",
"ecosystem": "npm"
},
{
"name": "has-bigints",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "has-flag",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "has-property-descriptors",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "has-proto",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "has-symbols",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "has-tostringtag",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "hasown",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "hosted-git-info",
"direct": false,
"version": "2.8.9",
"ecosystem": "npm"
},
{
"name": "https-proxy-agent",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "ieee754",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "inherits",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "internal-slot",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-array-buffer",
"direct": false,
"version": "3.0.5",
"ecosystem": "npm"
},
{
"name": "is-arrayish",
"direct": false,
"version": "0.2.1",
"ecosystem": "npm"
},
{
"name": "is-async-function",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "is-bigint",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-boolean-object",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "is-callable",
"direct": false,
"version": "1.2.7",
"ecosystem": "npm"
},
{
"name": "is-core-module",
"direct": false,
"version": "2.16.1",
"ecosystem": "npm"
},
{
"name": "is-data-view",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "is-date-object",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-extglob",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "is-finalizationregistry",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-generator-function",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-glob",
"direct": false,
"version": "4.0.3",
"ecosystem": "npm"
},
{
"name": "is-interactive",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "is-map",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "is-negative-zero",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "is-number",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "is-number-object",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-regex",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "is-set",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "is-shared-array-buffer",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "is-string",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-symbol",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-typed-array",
"direct": false,
"version": "1.1.15",
"ecosystem": "npm"
},
{
"name": "is-unicode-supported",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "is-weakmap",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "is-weakref",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-weakset",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "isarray",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "isexe",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "jiti",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "json-parse-better-errors",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "lightningcss",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-arm64",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-x64",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-freebsd-x64",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm-gnueabihf",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-gnu",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-musl",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-gnu",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-musl",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-arm64-msvc",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-x64-msvc",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "load-json-file",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "lodash.castarray",
"direct": false,
"version": "4.4.0",
"ecosystem": "npm"
},
{
"name": "lodash.isplainobject",
"direct": false,
"version": "4.0.6",
"ecosystem": "npm"
},
{
"name": "lodash.merge",
"direct": false,
"version": "4.6.2",
"ecosystem": "npm"
},
{
"name": "log-symbols",
"direct": false,
"version": "5.1.0",
"ecosystem": "npm"
},
{
"name": "magic-string",
"direct": false,
"version": "0.30.17",
"ecosystem": "npm"
},
{
"name": "math-intrinsics",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "mdn-data",
"direct": false,
"version": "2.0.30",
"ecosystem": "npm"
},
{
"name": "memorystream",
"direct": false,
"version": "0.3.1",
"ecosystem": "npm"
},
{
"name": "micromatch",
"direct": false,
"version": "4.0.8",
"ecosystem": "npm"
},
{
"name": "mime-db",
"direct": false,
"version": "1.52.0",
"ecosystem": "npm"
},
{
"name": "mime-types",
"direct": false,
"version": "2.1.35",
"ecosystem": "npm"
},
{
"name": "mimic-fn",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "mini-svg-data-uri",
"direct": false,
"version": "1.4.4",
"ecosystem": "npm"
},
{
"name": "minimatch",
"direct": false,
"version": "3.1.5",
"ecosystem": "npm"
},
{
"name": "minipass",
"direct": false,
"version": "7.1.2",
"ecosystem": "npm"
},
{
"name": "minizlib",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "mri",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "ms",
"direct": false,
"version": "2.1.3",
"ecosystem": "npm"
},
{
"name": "nanoid",
"direct": false,
"version": "3.3.11",
"ecosystem": "npm"
},
{
"name": "nice-try",
"direct": false,
"version": "1.0.5",
"ecosystem": "npm"
},
{
"name": "node-addon-api",
"direct": false,
"version": "7.1.1",
"ecosystem": "npm"
},
{
"name": "node-releases",
"direct": false,
"version": "2.0.19",
"ecosystem": "npm"
},
{
"name": "normalize-package-data",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "normalize-range",
"direct": false,
"version": "0.1.2",
"ecosystem": "npm"
},
{
"name": "npm-run-all",
"direct": false,
"version": "4.1.5",
"ecosystem": "npm"
},
{
"name": "object-inspect",
"direct": false,
"version": "1.13.4",
"ecosystem": "npm"
},
{
"name": "object-keys",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "object.assign",
"direct": false,
"version": "4.1.7",
"ecosystem": "npm"
},
{
"name": "onetime",
"direct": false,
"version": "5.1.2",
"ecosystem": "npm"
},
{
"name": "ora",
"direct": false,
"version": "6.3.1",
"ecosystem": "npm"
},
{
"name": "own-keys",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "parse-json",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "path-key",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "path-parse",
"direct": false,
"version": "1.0.7",
"ecosystem": "npm"
},
{
"name": "path-type",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "picocolors",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "picomatch",
"direct": false,
"version": "2.3.2",
"ecosystem": "npm"
},
{
"name": "pidtree",
"direct": false,
"version": "0.3.1",
"ecosystem": "npm"
},
{
"name": "pify",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "possible-typed-array-names",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "postcss",
"direct": false,
"version": "8.5.13",
"ecosystem": "npm"
},
{
"name": "postcss-selector-parser",
"direct": false,
"version": "6.0.10",
"ecosystem": "npm"
},
{
"name": "postcss-value-parser",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "prettier",
"direct": false,
"version": "2.8.8",
"ecosystem": "npm"
},
{
"name": "prettier-plugin-tailwindcss",
"direct": false,
"version": "0.1.13",
"ecosystem": "npm"
},
{
"name": "proxy-from-env",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "read-pkg",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "readable-stream",
"direct": false,
"version": "3.6.2",
"ecosystem": "npm"
},
{
"name": "reflect.getprototypeof",
"direct": false,
"version": "1.0.10",
"ecosystem": "npm"
},
{
"name": "regexp.prototype.flags",
"direct": false,
"version": "1.5.4",
"ecosystem": "npm"
},
{
"name": "resolve",
"direct": false,
"version": "1.22.10",
"ecosystem": "npm"
},
{
"name": "restore-cursor",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "safe-array-concat",
"direct": false,
"version": "1.1.3",
"ecosystem": "npm"
},
{
"name": "safe-buffer",
"direct": false,
"version": "5.2.1",
"ecosystem": "npm"
},
{
"name": "safe-push-apply",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "safe-regex-test",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "semver",
"direct": false,
"version": "5.7.2",
"ecosystem": "npm"
},
{
"name": "set-function-length",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "set-function-name",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "set-proto",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "shebang-command",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "shebang-regex",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "shell-quote",
"direct": false,
"version": "1.8.4",
"ecosystem": "npm"
},
{
"name": "side-channel",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "side-channel-list",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "side-channel-map",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "side-channel-weakmap",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "signal-exit",
"direct": false,
"version": "3.0.7",
"ecosystem": "npm"
},
{
"name": "source-map-js",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "spdx-correct",
"direct": false,
"version": "3.2.0",
"ecosystem": "npm"
},
{
"name": "spdx-exceptions",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "spdx-expression-parse",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "spdx-license-ids",
"direct": false,
"version": "3.0.22",
"ecosystem": "npm"
},
{
"name": "stdin-discarder",
"direct": false,
"version": "0.1.0",
"ecosystem": "npm"
},
{
"name": "stop-iteration-iterator",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "string.prototype.padend",
"direct": false,
"version": "3.1.6",
"ecosystem": "npm"
},
{
"name": "string.prototype.trim",
"direct": false,
"version": "1.2.10",
"ecosystem": "npm"
},
{
"name": "string.prototype.trimend",
"direct": false,
"version": "1.0.9",
"ecosystem": "npm"
},
{
"name": "string.prototype.trimstart",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "string_decoder",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "strip-ansi",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "strip-bom",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "supports-color",
"direct": false,
"version": "5.5.0",
"ecosystem": "npm"
},
{
"name": "supports-preserve-symlinks-flag",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "tailwindcss",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "tapable",
"direct": false,
"version": "2.2.2",
"ecosystem": "npm"
},
{
"name": "tar",
"direct": false,
"version": "7.5.16",
"ecosystem": "npm"
},
{
"name": "to-regex-range",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "tslib",
"direct": false,
"version": "2.8.0",
"ecosystem": "npm"
},
{
"name": "typed-array-buffer",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "typed-array-byte-length",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "typed-array-byte-offset",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "typed-array-length",
"direct": false,
"version": "1.0.7",
"ecosystem": "npm"
},
{
"name": "unbox-primitive",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "update-browserslist-db",
"direct": false,
"version": "1.1.3",
"ecosystem": "npm"
},
{
"name": "util-deprecate",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "validate-npm-package-license",
"direct": false,
"version": "3.0.4",
"ecosystem": "npm"
},
{
"name": "wcwidth",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "which",
"direct": false,
"version": "1.3.1",
"ecosystem": "npm"
},
{
"name": "which-boxed-primitive",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "which-builtin-type",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "which-collection",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "which-typed-array",
"direct": false,
"version": "1.1.19",
"ecosystem": "npm"
},
{
"name": "yallist",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "laravel/pint",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "php",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-ray",
"direct": false,
"version": null,
"ecosystem": "packagist"
}
],
"collected": true,
"truncated": false,
"total_count": 308,
"direct_count": 5,
"indirect_count": 303
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 50,
"open_issues": 0,
"closed_ratio": 1,
"closed_issues": 20,
"closed_unmerged_prs": 1
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "MarcelWeidum",
"commits": 104,
"avatar_url": "https://avatars.githubusercontent.com/u/9413586?v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 23,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 14,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
},
{
"type": "User",
"login": "DSpeichert",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/1254971?v=4"
},
{
"type": "User",
"login": "webard",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/855788?v=4"
},
{
"type": "User",
"login": "hamza200411",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/132139779?v=4"
},
{
"type": "User",
"login": "MACscr",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/1404944?v=4"
},
{
"type": "User",
"login": "rmartinoscar",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/40749467?v=4"
},
{
"type": "User",
"login": "MrSleeps",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/9741713?v=4"
}
],
"contributors_sampled": 9,
"top_contributor_share": 0.689
},
"quality_signals": {
"has_ci": true,
"has_tests": false,
"ci_workflows": [
"dependabot-auto-merge.yml",
"fix-php-code-style-issues.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during GetBranch(2.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 8,
"reason": "8 out of 10 merged PRs checked by a CI test -- score normalized to 8",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 5,
"reason": "Found 1/2 approved changesets -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 9,
"reason": "1 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "c2108e0eb5abb44d4a1131e9dfc59a7cf1d5c425",
"ran_at": "2026-07-20T21:38:46Z",
"aggregate_score": 6,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/MarcelWeidum/filament-passkeys",
"host": "github.com",
"name": "filament-passkeys",
"owner": "MarcelWeidum"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 66,
"inputs": {
"security": 68,
"vitality": 92,
"community": 54,
"governance": 65,
"engineering": 48
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 92,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 86,
"inputs": {
"commits_last_year": 149,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 31
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "31/52 weeks with commits",
"points": 21.5,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 31
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "149 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 149
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 100,
"inputs": {
"releases_count": 29,
"latest_release_tag": "v4.0.5",
"releases_from_tags": false,
"days_since_latest_release": 11,
"mean_days_between_releases": 9
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "29 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 29
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 11 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 11
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~9 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 9
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 54,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 39,
"inputs": {
"forks": 16,
"stars": 67,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "67 stars",
"points": 29.5,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 67
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "16 forks",
"points": 9.8,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 16
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 70,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"packages": [
"marcelweidum/filament-passkeys"
],
"dependents": 1,
"ecosystems": "packagist",
"total_downloads": 54357,
"monthly_downloads": 7226
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "7,226 downloads/month across packagist",
"points": 51.5,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 7226,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "1 packages depend on it",
"points": 2,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 1
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 65,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 28,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 9,
"top_contributor_share": 0.689
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 69% of commits",
"points": 7,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 69
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "9 contributors",
"points": 12.2,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 9
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "excellent",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 92,
"inputs": {
"merged_prs": 50,
"open_issues": 0,
"closed_issues": 20,
"issue_closed_ratio": 1,
"closed_unmerged_prs": 1
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "100% of issues closed",
"points": 46.8,
"status": "met",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 100
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "50/51 decided PRs merged",
"points": 37.5,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 50,
"decided": 51
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 1/2 approved changesets -- score normalized to 5",
"points": 7.5,
"status": "partial",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 56,
"inputs": {
"followers": 28,
"owner_type": "User",
"is_verified": null,
"owner_login": "MarcelWeidum",
"public_repos": 43,
"account_age_days": 4284
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "28 followers of MarcelWeidum",
"points": 10.5,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 28,
"login": "MarcelWeidum"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "43 public repos, account ~11 yr old",
"points": 24,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 43
}
},
{
"code": "account_age_years",
"params": {
"years": 11
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"marcelweidum/filament-passkeys"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 11
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 11 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 11
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "29 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 29
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "at_risk",
"name": "Engineering Quality",
"value": 48,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "at_risk",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 46,
"inputs": {
"has_ci": true,
"has_tests": false,
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "2 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 2
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 6.4,
"status": "met",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "8 out of 10 merged PRs checked by a CI test -- score normalized to 8",
"points": 16,
"status": "partial",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"topics": [
"filament",
"filament-4",
"filament-plugin",
"filamentphp",
"filamentphp-4",
"filamentphp-plugin",
"livewire",
"passkey",
"passkeys",
"php",
"plugin",
"filament-passkey",
"filament-passkeys",
"filamentphp-passkey",
"filamentphp-passkeys",
"spatie-passkey",
"spatie-passkeys"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "17 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 17
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 68,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 12,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 6,
"scorecard_aggregate": 6
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during GetBranch(2.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "8 out of 10 merged PRs checked by a CI test -- score normalized to 8",
"points": 2,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 1/2 approved changesets -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "1 existing vulnerabilities detected",
"points": 6.8,
"status": "partial",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "dependency_advisories",
"band": "excellent",
"name": "Dependency advisories",
"note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 302 resolved dependencies against OSV; 6 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"indirect_dependencies_free_of_known_advisories",
"no_advisories_left_outstanding"
]
}
},
{
"code": "weights_renormalized",
"params": {}
},
{
"code": "advisories_scope_repository",
"params": {
"assessed": 302
}
},
{
"code": "advisories_unassessed",
"params": {
"count": 6
}
},
{
"code": "advisories_repo_graph_caveat",
"params": {}
},
{
"code": "advisories_reachability",
"params": {}
}
],
"value": 100,
"inputs": {
"source": "osv",
"advisories": 1,
"affected_packages": 1,
"assessed_packages": 302,
"unassessed_packages": 6,
"affected_by_severity": "high 1",
"direct_affected_packages": 0
},
"components": [
{
"key": "direct_dependencies_free_of_known_advisories",
"name": "Direct dependencies free of known advisories",
"detail": "no direct dependency carries a known advisory",
"points": 35,
"status": "met",
"details": [
{
"code": "no_direct_advisories",
"params": {}
}
],
"max_points": 35
},
{
"key": "indirect_dependencies_free_of_known_advisories",
"name": "Indirect dependencies free of known advisories",
"detail": "transitive set not separable from development and test dependencies in this scope",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_scope_not_separable",
"params": {}
}
],
"max_points": 25
},
{
"key": "no_advisories_left_outstanding",
"name": "No advisories left outstanding",
"detail": "no advisory carries a publication date",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_no_publication_date",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "malicious_dependencies",
"band": "excellent",
"name": "Malicious dependencies",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"source": "osv",
"meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
"packages": [],
"red_flag": false,
"assessed_packages": 302,
"malicious_packages": 0,
"direct_malicious_packages": 0,
"withdrawn_malicious_packages": 0,
"installable_malicious_packages": 0
},
"components": [
{
"key": "no_dependency_reported_as_a_malicious_package",
"name": "No dependency reported as a malicious package",
"detail": "no dependency is reported as a malicious package",
"points": 100,
"status": "met",
"details": [
{
"code": "no_malicious_dependencies",
"params": {}
}
],
"max_points": 100
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 9
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 19,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "critical",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice",
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 19,
"inputs": {
"has_nix": false,
"has_tests": false,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "PHP",
"largest_source_bytes": 3714,
"source_files_sampled": 16,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "PHP without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "PHP"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/16 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 16,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-20T21:39:04.569448Z",
"schema_version": "0.16.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/m/MarcelWeidum/filament-passkeys.svg",
"full_name": "MarcelWeidum/filament-passkeys",
"license_state": "standard",
"license_spdx": "MIT"
}Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.16.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — Packagist.