Use passkeys in your filament app
MarcelWeidum/filament-passkeys erreicht einen Gesundheitsindex von 73 von 100 und liegt damit im Bereich Gut. Am stärksten schneidet es bei Vitality (92/100) ab, am schwächsten bei AI Readiness (19/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
Metriken werden auf einer standardisierten Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr gewichtetes Mittel, kalibriert auf die Verteilung des öffentlichen Registers, sodass die Stufen Perzentilbedeutung tragen; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze Gefährdet von 34.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Der gewichtete Gesamtwert 64 wird auf der veröffentlichten Indexskala auf 73 kalibriert (Register-Kalibrierung 2026-08-02).
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| Packagist | marcelweidum/filament-passkeys | v4.0.5 | 7.226 | 29 | vor 11 Tagen | laravelfilamentfilamentphpmarcelweidumfilament-passkeys |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 21.5/36 | Commit-Rhythmus — 31/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 149 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 149 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 31 |
| 27/27 | Liefert Releases aus — 29 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 11 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 9 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
| releases_count | 29 |
| latest_release_tag | v4.0.5 |
| releases_from_tags | nein |
| days_since_latest_release | 11 |
| mean_days_between_releases | 9 |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 29.5/60 | Stars — 67 Stars |
| 9.8/25 | Forks — 16 Forks |
| 0/15 | Watcher — 2 Watcher |
| forks | 16 |
| stars | 67 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 18/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
| has_readme | ja |
| has_license | ja |
| readme_badges | — |
| has_contributing | ja |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| readme_badge_services | — |
| has_pull_request_template | nein |
| 51.5/80 | Downloads pro Monat — 7.226 Downloads/Monat über packagist |
| 2/20 | Abhängige in der Registry — 1 Pakete hängen davon ab |
| packages | marcelweidum/filament-passkeys |
| dependents | 1 |
| ecosystems | packagist |
| total_downloads | 54.357 |
| monthly_downloads | 7.226 |
| unverified_packages_excluded | — |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 7/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 69 % der Commits |
| 12.2/13.5 | Breite der Beitragenden — 9 Beitragende |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 9 |
| top_contributor_share | 0,689 |
| 42/42 | Issue-Lösungsquote — 100 % der Issues geschlossen |
| 29.4/30 | PR-Annahme — 50/51 entschiedene PRs gemergt |
| 0/13 | Newcomer PR acceptance — kein PR eines Erstbeitragenden in 30 Tagen entschieden |
| 7.5/15 | OpenSSF Scorecard: Code-Review — Found 1/2 approved changesets -- score normalized to 5 |
| merged_prs | 50 |
| open_issues | 0 |
| closed_issues | 20 |
| prs_merged_7d | — |
| prs_decided_7d | — |
| prs_merged_30d | — |
| prs_decided_30d | — |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 1 |
| first_time_authors_30d | — |
| first_time_prs_merged_30d | — |
| first_time_prs_decided_30d | — |
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 10.5/25 | Reichweite des Inhabers — 28 Follower von MarcelWeidum |
| 24/25 | Kontohistorie — 43 öffentliche Repos, Kontoalter ca. 11 Jahre |
| followers | 28 |
| owner_type | User |
| is_verified | — |
| owner_login | MarcelWeidum |
| public_repos | 43 |
| account_age_days | 4.284 |
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf packagist |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 11 Tagen |
| 20/20 | Versionshistorie — 29 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | marcelweidum/filament-passkeys |
| ecosystems | packagist |
| any_deprecated | nein |
| min_days_since_publish | 11 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 24/24 | CI-Workflows — 2 Workflow(s) |
| 0/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 6.4/6.4 | .editorconfig |
| 16/20 | OpenSSF Scorecard: CI-Tests — 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| has_ci | ja |
| has_tests | nein |
| has_editorconfig | ja |
| has_linter_config | nein |
| has_precommit_config | nein |
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 0/15 | Dokumentations-/Homepage-Site |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 17 Topics |
| 0/10 | Wiki |
| topics | filament, filament-4, filament-plugin, filamentphp, filamentphp-4, filamentphp-plugin, livewire, passkey, passkeys, php, plugin, filament-passkey, filament-passkeys, filamentphp-passkey, filamentphp-passkeys, spatie-passkey, spatie-passkeys |
| has_wiki | nein |
| homepage | — |
| docs_site | — |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — keine Daten |
| 2/2.5 | CI-Tests — 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 3.8/7.5 | Code-Review — Found 1/2 approved changesets -- score normalized to 5 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 0/10 | Dangerous-Workflow — keine Daten |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — keine Daten |
| 0/5 | Pinned-Dependencies — keine Daten |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — keine Daten |
| 6.8/7.5 | Vulnerabilities — 1 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 6 |
| 35/35 | Direkte Abhängigkeiten ohne bekannte Advisories — keine direkte Abhängigkeit trägt ein bekanntes Advisory |
| 0/25 | Indirekte Abhängigkeiten ohne bekannte Advisories — transitive Menge in diesem Bereich nicht von Entwicklungs- und Test-Abhängigkeiten trennbar |
| 0/40 | Keine offenen Advisories — kein Advisory trägt ein Veröffentlichungsdatum |
| source | osv |
| advisories | 1 |
| affected_packages | 1 |
| assessed_packages | 302 |
| unassessed_packages | 6 |
| affected_by_severity | high 1 |
| direct_affected_packages | 0 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Trägt ein bewusst kleines Gewicht (4 %): Agenten-Tooling ist ein echtes Pflegesignal, doch ein Repository ohne jedes Signal kann weiterhin 100/100 erreichen.
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
| has_llms_txt | nein |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | Bootstrap mit einem Befehl |
| 0/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 0/11 | Statische Typprüfung |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 5/8 | Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — keine Daten |
| has_nix | nein |
| has_tests | nein |
| lockfiles | package-lock.json |
| has_dockerfile | nein |
| typed_language | nein |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 0/45 | Typprüfbarer Code — PHP ohne Typprüfungs-Konfiguration |
| 55/55 | Handhabbare Dateigrößen — 0/16 Quelldateien über 60 KB |
| primary_language | PHP |
| largest_source_bytes | 3.714 |
| source_files_sampled | 16 |
| oversized_source_files | 0 |
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| k. A. | Branch-Protection | internal error: error during GetBranch(2.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 8 | CI-Tests | 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 5 | Code-Review | Found 1/2 approved changesets -- score normalized to 5 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| k. A. | Dangerous-Workflow | no workflows found |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| k. A. | Packaging | packaging workflow not detected |
| k. A. | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| k. A. | Token-Permissions | No tokens found |
| 9 | Vulnerabilities | 1 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| Packagist | filament/filament | ^5.0 | composer.json |
| Packagist | laravel/passkeys | ^0.2.0 | composer.json |
| Packagist | spatie/laravel-package-tools | ^1.15.0 | composer.json |
| npm | @laravel/passkeys | ^0.1.0 | package.json |
| npm | @tailwindcss/cli | ^4.1.11 | package.json |
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 5 direkte und 303 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| npm | @laravel/passkeys | 0.1.0 | direkt |
| npm | @tailwindcss/cli | 4.1.11 | direkt |
| Packagist | filament/filament | — | direkt |
| Packagist | laravel/passkeys | — | direkt |
| Packagist | spatie/laravel-package-tools | — | direkt |
| npm | @ampproject/remapping | 2.3.0 | indirekt |
| npm | @awcodes/filament-plugin-purge | 1.1.2 | indirekt |
| npm | @emnapi/core | 1.4.3 | indirekt |
| npm | @emnapi/runtime | 1.4.3 | indirekt |
| npm | @emnapi/wasi-threads | 1.0.2 | indirekt |
| npm | @esbuild/aix-ppc64 | 0.28.1 | indirekt |
| npm | @esbuild/android-arm | 0.28.1 | indirekt |
| npm | @esbuild/android-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/android-x64 | 0.28.1 | indirekt |
| npm | @esbuild/darwin-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/darwin-x64 | 0.28.1 | indirekt |
| npm | @esbuild/freebsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/freebsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-arm | 0.28.1 | indirekt |
| npm | @esbuild/linux-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-ia32 | 0.28.1 | indirekt |
| npm | @esbuild/linux-loong64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-mips64el | 0.28.1 | indirekt |
| npm | @esbuild/linux-ppc64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-riscv64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-s390x | 0.28.1 | indirekt |
| npm | @esbuild/linux-x64 | 0.28.1 | indirekt |
| npm | @esbuild/netbsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/netbsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/openbsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/openbsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/openharmony-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/sunos-x64 | 0.28.1 | indirekt |
| npm | @esbuild/win32-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/win32-ia32 | 0.28.1 | indirekt |
| npm | @esbuild/win32-x64 | 0.28.1 | indirekt |
| npm | @isaacs/fs-minipass | 4.0.1 | indirekt |
| npm | @jridgewell/gen-mapping | 0.3.13 | indirekt |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirekt |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirekt |
| npm | @jridgewell/trace-mapping | 0.3.30 | indirekt |
| npm | @napi-rs/wasm-runtime | 0.2.11 | indirekt |
| npm | @parcel/watcher | 2.5.1 | indirekt |
| npm | @parcel/watcher-android-arm64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-darwin-arm64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-darwin-x64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-freebsd-x64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm-glibc | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm-musl | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm64-glibc | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm64-musl | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-x64-glibc | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-x64-musl | 2.5.1 | indirekt |
| npm | @parcel/watcher-win32-arm64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-win32-ia32 | 2.5.1 | indirekt |
| npm | @parcel/watcher-win32-x64 | 2.5.1 | indirekt |
| npm | @simplewebauthn/browser | 13.1.2 | indirekt |
| npm | @tailwindcss/forms | 0.5.10 | indirekt |
| npm | @tailwindcss/node | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-android-arm64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-darwin-arm64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-darwin-x64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-freebsd-x64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-arm-gnueabihf | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-arm64-gnu | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-arm64-musl | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-x64-gnu | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-x64-musl | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-wasm32-wasi | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-win32-arm64-msvc | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-win32-x64-msvc | 4.1.11 | indirekt |
| npm | @tailwindcss/typography | 0.5.16 | indirekt |
| npm | @tybys/wasm-util | 0.9.0 | indirekt |
| npm | agent-base | 6.0.2 | indirekt |
| npm | ansi-regex | 6.1.0 | indirekt |
| npm | ansi-styles | 3.2.1 | indirekt |
| npm | array-buffer-byte-length | 1.0.2 | indirekt |
| npm | arraybuffer.prototype.slice | 1.0.4 | indirekt |
| npm | async-function | 1.0.0 | indirekt |
| npm | asynckit | 0.4.0 | indirekt |
| npm | autoprefixer | 10.4.21 | indirekt |
| npm | available-typed-arrays | 1.0.7 | indirekt |
| npm | axios | 1.18.1 | indirekt |
| npm | balanced-match | 1.0.2 | indirekt |
| npm | base64-js | 1.5.1 | indirekt |
| npm | bl | 5.1.0 | indirekt |
| npm | brace-expansion | 1.1.14 | indirekt |
| npm | braces | 3.0.3 | indirekt |
| npm | browserslist | 4.25.2 | indirekt |
| npm | buffer | 6.0.3 | indirekt |
| npm | call-bind | 1.0.8 | indirekt |
| npm | call-bind-apply-helpers | 1.0.2 | indirekt |
| npm | call-bound | 1.0.4 | indirekt |
| npm | caniuse-lite | 1.0.30001734 | indirekt |
| npm | chalk | 2.4.2 | indirekt |
| npm | chalk | 5.5.0 | indirekt |
| npm | chownr | 3.0.0 | indirekt |
| npm | cli-cursor | 4.0.0 | indirekt |
| npm | cli-spinners | 2.9.2 | indirekt |
| npm | clone | 1.0.4 | indirekt |
| npm | color-convert | 1.9.3 | indirekt |
| npm | color-name | 1.1.3 | indirekt |
| npm | combined-stream | 1.0.8 | indirekt |
| npm | concat-map | 0.0.1 | indirekt |
| npm | cross-spawn | 6.0.6 | indirekt |
| npm | css-tree | 2.3.1 | indirekt |
| npm | cssesc | 3.0.0 | indirekt |
| npm | data-view-buffer | 1.0.2 | indirekt |
| npm | data-view-byte-length | 1.0.2 | indirekt |
| npm | data-view-byte-offset | 1.0.1 | indirekt |
| npm | debug | 4.4.3 | indirekt |
| npm | defaults | 1.0.4 | indirekt |
| npm | define-data-property | 1.1.4 | indirekt |
| npm | define-properties | 1.2.1 | indirekt |
| npm | delayed-stream | 1.0.0 | indirekt |
| npm | detect-libc | 1.0.3 | indirekt |
| npm | detect-libc | 2.0.4 | indirekt |
| npm | dunder-proto | 1.0.1 | indirekt |
| npm | electron-to-chromium | 1.5.200 | indirekt |
| npm | enhanced-resolve | 5.18.3 | indirekt |
| npm | error-ex | 1.3.2 | indirekt |
| npm | es-abstract | 1.24.0 | indirekt |
| npm | es-define-property | 1.0.1 | indirekt |
| npm | es-errors | 1.3.0 | indirekt |
| npm | es-object-atoms | 1.1.1 | indirekt |
| npm | es-set-tostringtag | 2.1.0 | indirekt |
| npm | es-to-primitive | 1.3.0 | indirekt |
| npm | esbuild | 0.28.1 | indirekt |
| npm | escalade | 3.2.0 | indirekt |
| npm | escape-string-regexp | 1.0.5 | indirekt |
| npm | fill-range | 7.1.1 | indirekt |
| npm | follow-redirects | 1.16.0 | indirekt |
| npm | for-each | 0.3.5 | indirekt |
| npm | form-data | 4.0.6 | indirekt |
| npm | fraction.js | 4.3.7 | indirekt |
| npm | function-bind | 1.1.2 | indirekt |
| npm | function.prototype.name | 1.1.8 | indirekt |
| npm | functions-have-names | 1.2.3 | indirekt |
| npm | get-intrinsic | 1.3.0 | indirekt |
| npm | get-proto | 1.0.1 | indirekt |
| npm | get-symbol-description | 1.1.0 | indirekt |
| npm | globalthis | 1.0.4 | indirekt |
| npm | gopd | 1.2.0 | indirekt |
| npm | graceful-fs | 4.2.11 | indirekt |
| npm | has-bigints | 1.1.0 | indirekt |
| npm | has-flag | 3.0.0 | indirekt |
| npm | has-property-descriptors | 1.0.2 | indirekt |
| npm | has-proto | 1.2.0 | indirekt |
| npm | has-symbols | 1.1.0 | indirekt |
| npm | has-tostringtag | 1.0.2 | indirekt |
| npm | hasown | 2.0.4 | indirekt |
| npm | hosted-git-info | 2.8.9 | indirekt |
| npm | https-proxy-agent | 5.0.1 | indirekt |
| npm | ieee754 | 1.2.1 | indirekt |
| npm | inherits | 2.0.4 | indirekt |
| npm | internal-slot | 1.1.0 | indirekt |
| npm | is-array-buffer | 3.0.5 | indirekt |
| npm | is-arrayish | 0.2.1 | indirekt |
| npm | is-async-function | 2.1.1 | indirekt |
| npm | is-bigint | 1.1.0 | indirekt |
| npm | is-boolean-object | 1.2.2 | indirekt |
| npm | is-callable | 1.2.7 | indirekt |
| npm | is-core-module | 2.16.1 | indirekt |
| npm | is-data-view | 1.0.2 | indirekt |
| npm | is-date-object | 1.1.0 | indirekt |
| npm | is-extglob | 2.1.1 | indirekt |
| npm | is-finalizationregistry | 1.1.1 | indirekt |
| npm | is-generator-function | 1.1.0 | indirekt |
| npm | is-glob | 4.0.3 | indirekt |
| npm | is-interactive | 2.0.0 | indirekt |
| npm | is-map | 2.0.3 | indirekt |
| npm | is-negative-zero | 2.0.3 | indirekt |
| npm | is-number | 7.0.0 | indirekt |
| npm | is-number-object | 1.1.1 | indirekt |
| npm | is-regex | 1.2.1 | indirekt |
| npm | is-set | 2.0.3 | indirekt |
| npm | is-shared-array-buffer | 1.0.4 | indirekt |
| npm | is-string | 1.1.1 | indirekt |
| npm | is-symbol | 1.1.1 | indirekt |
| npm | is-typed-array | 1.1.15 | indirekt |
| npm | is-unicode-supported | 1.3.0 | indirekt |
| npm | is-weakmap | 2.0.2 | indirekt |
| npm | is-weakref | 1.1.1 | indirekt |
| npm | is-weakset | 2.0.4 | indirekt |
| npm | isarray | 2.0.5 | indirekt |
| npm | isexe | 2.0.0 | indirekt |
| npm | jiti | 2.5.1 | indirekt |
| npm | json-parse-better-errors | 1.0.2 | indirekt |
| npm | lightningcss | 1.30.1 | indirekt |
| npm | lightningcss-darwin-arm64 | 1.30.1 | indirekt |
| npm | lightningcss-darwin-x64 | 1.30.1 | indirekt |
| npm | lightningcss-freebsd-x64 | 1.30.1 | indirekt |
| npm | lightningcss-linux-arm-gnueabihf | 1.30.1 | indirekt |
| npm | lightningcss-linux-arm64-gnu | 1.30.1 | indirekt |
| npm | lightningcss-linux-arm64-musl | 1.30.1 | indirekt |
| npm | lightningcss-linux-x64-gnu | 1.30.1 | indirekt |
| npm | lightningcss-linux-x64-musl | 1.30.1 | indirekt |
| npm | lightningcss-win32-arm64-msvc | 1.30.1 | indirekt |
| npm | lightningcss-win32-x64-msvc | 1.30.1 | indirekt |
| npm | load-json-file | 4.0.0 | indirekt |
| npm | lodash.castarray | 4.4.0 | indirekt |
| npm | lodash.isplainobject | 4.0.6 | indirekt |
| npm | lodash.merge | 4.6.2 | indirekt |
| npm | log-symbols | 5.1.0 | indirekt |
| npm | magic-string | 0.30.17 | indirekt |
| npm | math-intrinsics | 1.1.0 | indirekt |
| npm | mdn-data | 2.0.30 | indirekt |
| npm | memorystream | 0.3.1 | indirekt |
| npm | micromatch | 4.0.8 | indirekt |
| npm | mime-db | 1.52.0 | indirekt |
| npm | mime-types | 2.1.35 | indirekt |
| npm | mimic-fn | 2.1.0 | indirekt |
| npm | mini-svg-data-uri | 1.4.4 | indirekt |
| npm | minimatch | 3.1.5 | indirekt |
| npm | minipass | 7.1.2 | indirekt |
| npm | minizlib | 3.1.0 | indirekt |
| npm | mri | 1.2.0 | indirekt |
| npm | ms | 2.1.3 | indirekt |
| npm | nanoid | 3.3.11 | indirekt |
| npm | nice-try | 1.0.5 | indirekt |
| npm | node-addon-api | 7.1.1 | indirekt |
| npm | node-releases | 2.0.19 | indirekt |
| npm | normalize-package-data | 2.5.0 | indirekt |
| npm | normalize-range | 0.1.2 | indirekt |
| npm | npm-run-all | 4.1.5 | indirekt |
| npm | object-inspect | 1.13.4 | indirekt |
| npm | object-keys | 1.1.1 | indirekt |
| npm | object.assign | 4.1.7 | indirekt |
| npm | onetime | 5.1.2 | indirekt |
| npm | ora | 6.3.1 | indirekt |
| npm | own-keys | 1.0.1 | indirekt |
| npm | parse-json | 4.0.0 | indirekt |
| npm | path-key | 2.0.1 | indirekt |
| npm | path-parse | 1.0.7 | indirekt |
| npm | path-type | 3.0.0 | indirekt |
| npm | picocolors | 1.1.1 | indirekt |
| npm | picomatch | 2.3.2 | indirekt |
| npm | pidtree | 0.3.1 | indirekt |
| npm | pify | 3.0.0 | indirekt |
| npm | possible-typed-array-names | 1.1.0 | indirekt |
| npm | postcss | 8.5.13 | indirekt |
| npm | postcss-selector-parser | 6.0.10 | indirekt |
| npm | postcss-value-parser | 4.2.0 | indirekt |
| npm | prettier | 2.8.8 | indirekt |
| npm | prettier-plugin-tailwindcss | 0.1.13 | indirekt |
| npm | proxy-from-env | 2.1.0 | indirekt |
| npm | read-pkg | 3.0.0 | indirekt |
| npm | readable-stream | 3.6.2 | indirekt |
| npm | reflect.getprototypeof | 1.0.10 | indirekt |
| npm | regexp.prototype.flags | 1.5.4 | indirekt |
| npm | resolve | 1.22.10 | indirekt |
| npm | restore-cursor | 4.0.0 | indirekt |
| npm | safe-array-concat | 1.1.3 | indirekt |
| npm | safe-buffer | 5.2.1 | indirekt |
| npm | safe-push-apply | 1.0.0 | indirekt |
| npm | safe-regex-test | 1.1.0 | indirekt |
| npm | semver | 5.7.2 | indirekt |
| npm | set-function-length | 1.2.2 | indirekt |
| npm | set-function-name | 2.0.2 | indirekt |
| npm | set-proto | 1.0.0 | indirekt |
| npm | shebang-command | 1.2.0 | indirekt |
| npm | shebang-regex | 1.0.0 | indirekt |
| npm | shell-quote | 1.8.4 | indirekt |
| npm | side-channel | 1.1.0 | indirekt |
| npm | side-channel-list | 1.0.0 | indirekt |
| npm | side-channel-map | 1.0.1 | indirekt |
| npm | side-channel-weakmap | 1.0.2 | indirekt |
| npm | signal-exit | 3.0.7 | indirekt |
| npm | source-map-js | 1.2.1 | indirekt |
| npm | spdx-correct | 3.2.0 | indirekt |
| npm | spdx-exceptions | 2.5.0 | indirekt |
| npm | spdx-expression-parse | 3.0.1 | indirekt |
| npm | spdx-license-ids | 3.0.22 | indirekt |
| npm | stdin-discarder | 0.1.0 | indirekt |
| npm | stop-iteration-iterator | 1.1.0 | indirekt |
| npm | string.prototype.padend | 3.1.6 | indirekt |
| npm | string.prototype.trim | 1.2.10 | indirekt |
| npm | string.prototype.trimend | 1.0.9 | indirekt |
| npm | string.prototype.trimstart | 1.0.8 | indirekt |
| npm | string_decoder | 1.3.0 | indirekt |
| npm | strip-ansi | 7.1.0 | indirekt |
| npm | strip-bom | 3.0.0 | indirekt |
| npm | supports-color | 5.5.0 | indirekt |
| npm | supports-preserve-symlinks-flag | 1.0.0 | indirekt |
| npm | tailwindcss | 4.1.11 | indirekt |
| npm | tapable | 2.2.2 | indirekt |
| npm | tar | 7.5.16 | indirekt |
| npm | to-regex-range | 5.0.1 | indirekt |
| npm | tslib | 2.8.0 | indirekt |
| npm | typed-array-buffer | 1.0.3 | indirekt |
| npm | typed-array-byte-length | 1.0.3 | indirekt |
| npm | typed-array-byte-offset | 1.0.4 | indirekt |
| npm | typed-array-length | 1.0.7 | indirekt |
| npm | unbox-primitive | 1.1.0 | indirekt |
| npm | update-browserslist-db | 1.1.3 | indirekt |
| npm | util-deprecate | 1.0.2 | indirekt |
| npm | validate-npm-package-license | 3.0.4 | indirekt |
| npm | wcwidth | 1.0.1 | indirekt |
| npm | which | 1.3.1 | indirekt |
| npm | which-boxed-primitive | 1.1.1 | indirekt |
| npm | which-builtin-type | 1.2.1 | indirekt |
| npm | which-collection | 1.0.2 | indirekt |
| npm | which-typed-array | 1.1.19 | indirekt |
| npm | yallist | 5.0.0 | indirekt |
| Packagist | laravel/pint | — | indirekt |
| Packagist | php | — | indirekt |
| Packagist | spatie/laravel-ray | — | indirekt |
Dieses Repository veröffentlicht kein vom Index auflösbares Paket, daher wurde sein eigener Abhängigkeitsgraph bewertet – 302 Pakete, darunter auch Entwicklungs- und Test-Pins, die nie ausgeliefert werden: 1 tragen bekannte Advisories, davon 0 direkte. 6 konnten nicht bewertet werden – keine aufgelöste Version, ein nicht unterstütztes Ökosystem, oder außerhalb der ausgewiesenen Paketliste.
| Paket | Version | Beziehung | Schweregrad | Advisories | Behoben in |
|---|---|---|---|---|---|
| brace-expansion | 1.1.14 | indirekt | hoch | 1 | 5.0.7 |
Ein Advisory bedeutet, dass die im Abhängigkeitsgraphen erfasste Version in den betroffenen Bereich eines Advisories fällt. Erreichbarkeit wird nicht analysiert, und der Graph enthält Entwicklungs- und Test-Pins — ein Fund kann das Werkzeug betreffen und nicht die ausgelieferte Software.
Stimmt etwas in diesem Bericht nicht, oder gibt es Gedanken dazu? Falsche Messungen, übersehene Tools, Ideen, Fragen — alles ist willkommen. Jede Nachricht wird gelesen und beantwortet.
Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v2.10.0, Schema v0.16.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — Packagist.