Öffentliches RegisterMittel
Software-GesundheitsberichtSchema 0.16.0 · Metriken 1.13.0 · 2026-07-20 21:39 UTC
MarcelWeidum / filament-passkeys
Use passkeys in your filament app
MarcelWeidum/filament-passkeys erreicht einen Gesundheitsindex von 66 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Vitality (92/100) ab, am schwächsten bei AI Readiness (19/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
66
gesamt / 100Software-Gesundheitsindex
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
66
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
Bewertungsprofil
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Eigentümerschaft
MarcelPersönliches Konto
28 Follower43 öffentliche Reposseit Okt. 2014
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
Paket-Ökosysteme
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| Packagist | marcelweidum/filament-passkeys | v4.0.5 | 7.226 | 29 | vor 11 Tagen | laravelfilamentfilamentphpmarcelweidumfilament-passkeys |
Metriken nach Kategorie
Vitalität
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
92
Entwicklungsaktivität
86Exzellent
Wie die Bewertung erfolgt
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 21.5/36 | Commit-Rhythmus — 31/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 149 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
Verwendete Eingangsdaten
| commits_last_year | 149 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 31 |
Release-Disziplin
100Exzellent
Wie die Bewertung erfolgt
| 27/27 | Liefert Releases aus — 29 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 11 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 9 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
Verwendete Eingangsdaten
| releases_count | 29 |
| latest_release_tag | v4.0.5 |
| releases_from_tags | nein |
| days_since_latest_release | 11 |
| mean_days_between_releases | 9 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.
Community & Verbreitung
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
54
Popularität & Verbreitung
39Gefährdet
Wie die Bewertung erfolgt
| 29.5/60 | Stars — 67 Stars |
| 9.8/25 | Forks — 16 Forks |
| 0/15 | Watcher — 2 Watcher |
Verwendete Eingangsdaten
| forks | 16 |
| stars | 67 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community-Gesundheit
70Gut
Wie die Bewertung erfolgt
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 18/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
Verwendete Eingangsdaten
| has_readme | ja |
| has_license | ja |
| has_contributing | ja |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | nein |
Wie die Bewertung erfolgt
| 51.5/80 | Downloads pro Monat — 7.226 Downloads/Monat über packagist |
| 2/20 | Abhängige in der Registry — 1 Pakete hängen davon ab |
Verwendete Eingangsdaten
| packages | marcelweidum/filament-passkeys |
| dependents | 1 |
| ecosystems | packagist |
| total_downloads | 54.357 |
| monthly_downloads | 7.226 |
Nachhaltigkeit & Governance
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
65
Maintainer-Resilienz (Bus-Faktor)
28Kritisch
Wie die Bewertung erfolgt
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 7/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 69 % der Commits |
| 12.2/13.5 | Breite der Beitragenden — 9 Beitragende |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
Verwendete Eingangsdaten
| bus_factor | 1 |
| contributors_sampled | 9 |
| top_contributor_share | 0,689 |
Reaktionsfähigkeit bei Issues & PRs
92Exzellent
Wie die Bewertung erfolgt
| 46.8/46.8 | Issue-Lösungsquote — 100 % der Issues geschlossen |
| 37.5/38.3 | PR-Annahme — 50/51 entschiedene PRs gemergt |
| 7.5/15 | OpenSSF Scorecard: Code-Review — Found 1/2 approved changesets -- score normalized to 5 |
Verwendete Eingangsdaten
| merged_prs | 50 |
| open_issues | 0 |
| closed_issues | 20 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 1 |
Eigentümerschaft & Trägerschaft
56Mittel
Wie die Bewertung erfolgt
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 10.5/25 | Reichweite des Inhabers — 28 Follower von MarcelWeidum |
| 24/25 | Kontohistorie — 43 öffentliche Repos, Kontoalter ca. 11 Jahre |
Verwendete Eingangsdaten
| followers | 28 |
| owner_type | User |
| is_verified | — |
| owner_login | MarcelWeidum |
| public_repos | 43 |
| account_age_days | 4.284 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Verifizierte Domain. Die verbleibenden Gewichte wurden renormalisiert.
Paketpflege
100Exzellent
Wie die Bewertung erfolgt
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf packagist |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 11 Tagen |
| 20/20 | Versionshistorie — 29 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
Verwendete Eingangsdaten
| packages | marcelweidum/filament-passkeys |
| ecosystems | packagist |
| any_deprecated | nein |
| min_days_since_publish | 11 |
Engineering-Qualität
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
48
Engineering-Praktiken
46Gefährdet
Wie die Bewertung erfolgt
| 24/24 | CI-Workflows — 2 Workflow(s) |
| 0/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 6.4/6.4 | .editorconfig |
| 16/20 | OpenSSF Scorecard: CI-Tests — 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
Verwendete Eingangsdaten
| has_ci | ja |
| has_tests | nein |
| has_editorconfig | ja |
| has_linter_config | nein |
| has_precommit_config | nein |
Dokumentation
50Mittel
Wie die Bewertung erfolgt
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 0/15 | Dokumentations-/Homepage-Site |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 17 Topics |
| 0/10 | Wiki |
Verwendete Eingangsdaten
| topics | filament, filament-4, filament-plugin, filamentphp, filamentphp-4, filamentphp-plugin, livewire, passkey, passkeys, php, plugin, filament-passkey, filament-passkeys, filamentphp-passkey, filamentphp-passkeys, spatie-passkey, spatie-passkeys |
| has_wiki | nein |
| homepage | — |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sicherheit
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
68
Sicherheitslage
60Mittel
Wie die Bewertung erfolgt
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — keine Daten |
| 2/2.5 | CI-Tests — 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 3.8/7.5 | Code-Review — Found 1/2 approved changesets -- score normalized to 5 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 0/10 | Dangerous-Workflow — keine Daten |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — keine Daten |
| 0/5 | Pinned-Dependencies — keine Daten |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — keine Daten |
| 6.8/7.5 | Vulnerabilities — 1 existing vulnerabilities detected |
Verwendete Eingangsdaten
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 6 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): branch_protection, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Die verbleibenden Gewichte wurden renormalisiert.
Abhängigkeits-Advisories
100Exzellent
Wie die Bewertung erfolgt
| 35/35 | Direkte Abhängigkeiten ohne bekannte Advisories — keine direkte Abhängigkeit trägt ein bekanntes Advisory |
| 0/25 | Indirekte Abhängigkeiten ohne bekannte Advisories — transitive Menge in diesem Bereich nicht von Entwicklungs- und Test-Abhängigkeiten trennbar |
| 0/40 | Keine offenen Advisories — kein Advisory trägt ein Veröffentlichungsdatum |
Verwendete Eingangsdaten
| source | osv |
| advisories | 1 |
| affected_packages | 1 |
| assessed_packages | 302 |
| unassessed_packages | 6 |
| affected_by_severity | high 1 |
| direct_affected_packages | 0 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Indirekte Abhängigkeiten ohne bekannte Advisories, Keine offenen Advisories. Die verbleibenden Gewichte wurden renormalisiert. 302 aufgelöste Abhängigkeiten wurden mit OSV abgeglichen. 6 konnten nicht bewertet werden — keine aufgelöste Version, ein nicht unterstütztes Ökosystem oder außerhalb der ausgewiesenen Paketliste. Dieses Repository veröffentlicht kein Paket, das der Index auflöst; bewertet wurde daher der Abhängigkeitsgraph des Repositorys. Dieser Graph vermischt Entwicklungs- und Test-Pins mit ausgelieferten Abhängigkeiten, daher werden nur die deklarierten Laufzeit-Abhängigkeiten bewertet; transitive Befunde werden als Kontext ausgewiesen und fließen nicht in die Bewertung ein. Erreichbarkeit wird nicht analysiert.
AI Readiness
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
19
AI-Agentenkontext & Leitlinien
1Kritisch
Wie die Bewertung erfolgt
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
Verwendete Eingangsdaten
| has_llms_txt | nein |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Lesbare Commit-Historie. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
| 0/18 | Bootstrap mit einem Befehl |
| 0/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 0/11 | Statische Typprüfung |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 5/8 | Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — keine Daten |
Verwendete Eingangsdaten
| has_nix | nein |
| has_tests | nein |
| lockfiles | package-lock.json |
| has_dockerfile | nein |
| typed_language | nein |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Belegte Agentenpraxis, OpenSSF Scorecard: Pinned-Dependencies. Die verbleibenden Gewichte wurden renormalisiert.
AI-Code-Lesbarkeit für Modelle
55Mittel
Wie die Bewertung erfolgt
| 0/45 | Typprüfbarer Code — PHP ohne Typprüfungs-Konfiguration |
| 55/55 | Handhabbare Dateigrößen — 0/16 Quelldateien über 60 KB |
Verwendete Eingangsdaten
| primary_language | PHP |
| largest_source_bytes | 3.714 |
| source_files_sampled | 16 |
| oversized_source_files | 0 |
Eckdaten
67GitHub-Sterne
9Mitwirkende
149Commits, letzte 12 Monate
0Tage seit letztem Push
29Releases
1Bus-Faktor
0offene Issues
npm, PackagistPaket-Ökosysteme
Weitere Details
OpenSSF Scorecard 6.0 / 10
6.0Gesamtwert
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| k. A. | Branch-Protection | internal error: error during GetBranch(2.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 8 | CI-Tests | 8 out of 10 merged PRs checked by a CI test -- score normalized to 8 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 5 | Code-Review | Found 1/2 approved changesets -- score normalized to 5 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| k. A. | Dangerous-Workflow | no workflows found |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10 |
| k. A. | Packaging | packaging workflow not detected |
| k. A. | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| k. A. | Token-Permissions | No tokens found |
| 9 | Vulnerabilities | 1 existing vulnerabilities detected |
Direkte Abhängigkeiten 5
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| Packagist | filament/filament | ^5.0 | composer.json |
| Packagist | laravel/passkeys | ^0.2.0 | composer.json |
| Packagist | spatie/laravel-package-tools | ^1.15.0 | composer.json |
| npm | @laravel/passkeys | ^0.1.0 | package.json |
| npm | @tailwindcss/cli | ^4.1.11 | package.json |
Alle Abhängigkeiten 308
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 5 direkte und 303 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| npm | @laravel/passkeys | 0.1.0 | direkt |
| npm | @tailwindcss/cli | 4.1.11 | direkt |
| Packagist | filament/filament | — | direkt |
| Packagist | laravel/passkeys | — | direkt |
| Packagist | spatie/laravel-package-tools | — | direkt |
| npm | @ampproject/remapping | 2.3.0 | indirekt |
| npm | @awcodes/filament-plugin-purge | 1.1.2 | indirekt |
| npm | @emnapi/core | 1.4.3 | indirekt |
| npm | @emnapi/runtime | 1.4.3 | indirekt |
| npm | @emnapi/wasi-threads | 1.0.2 | indirekt |
| npm | @esbuild/aix-ppc64 | 0.28.1 | indirekt |
| npm | @esbuild/android-arm | 0.28.1 | indirekt |
| npm | @esbuild/android-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/android-x64 | 0.28.1 | indirekt |
| npm | @esbuild/darwin-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/darwin-x64 | 0.28.1 | indirekt |
| npm | @esbuild/freebsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/freebsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-arm | 0.28.1 | indirekt |
| npm | @esbuild/linux-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-ia32 | 0.28.1 | indirekt |
| npm | @esbuild/linux-loong64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-mips64el | 0.28.1 | indirekt |
| npm | @esbuild/linux-ppc64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-riscv64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-s390x | 0.28.1 | indirekt |
| npm | @esbuild/linux-x64 | 0.28.1 | indirekt |
| npm | @esbuild/netbsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/netbsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/openbsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/openbsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/openharmony-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/sunos-x64 | 0.28.1 | indirekt |
| npm | @esbuild/win32-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/win32-ia32 | 0.28.1 | indirekt |
| npm | @esbuild/win32-x64 | 0.28.1 | indirekt |
| npm | @isaacs/fs-minipass | 4.0.1 | indirekt |
| npm | @jridgewell/gen-mapping | 0.3.13 | indirekt |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirekt |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirekt |
| npm | @jridgewell/trace-mapping | 0.3.30 | indirekt |
| npm | @napi-rs/wasm-runtime | 0.2.11 | indirekt |
| npm | @parcel/watcher | 2.5.1 | indirekt |
| npm | @parcel/watcher-android-arm64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-darwin-arm64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-darwin-x64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-freebsd-x64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm-glibc | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm-musl | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm64-glibc | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-arm64-musl | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-x64-glibc | 2.5.1 | indirekt |
| npm | @parcel/watcher-linux-x64-musl | 2.5.1 | indirekt |
| npm | @parcel/watcher-win32-arm64 | 2.5.1 | indirekt |
| npm | @parcel/watcher-win32-ia32 | 2.5.1 | indirekt |
| npm | @parcel/watcher-win32-x64 | 2.5.1 | indirekt |
| npm | @simplewebauthn/browser | 13.1.2 | indirekt |
| npm | @tailwindcss/forms | 0.5.10 | indirekt |
| npm | @tailwindcss/node | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-android-arm64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-darwin-arm64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-darwin-x64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-freebsd-x64 | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-arm-gnueabihf | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-arm64-gnu | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-arm64-musl | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-x64-gnu | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-linux-x64-musl | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-wasm32-wasi | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-win32-arm64-msvc | 4.1.11 | indirekt |
| npm | @tailwindcss/oxide-win32-x64-msvc | 4.1.11 | indirekt |
| npm | @tailwindcss/typography | 0.5.16 | indirekt |
| npm | @tybys/wasm-util | 0.9.0 | indirekt |
| npm | agent-base | 6.0.2 | indirekt |
| npm | ansi-regex | 6.1.0 | indirekt |
| npm | ansi-styles | 3.2.1 | indirekt |
| npm | array-buffer-byte-length | 1.0.2 | indirekt |
| npm | arraybuffer.prototype.slice | 1.0.4 | indirekt |
| npm | async-function | 1.0.0 | indirekt |
| npm | asynckit | 0.4.0 | indirekt |
| npm | autoprefixer | 10.4.21 | indirekt |
| npm | available-typed-arrays | 1.0.7 | indirekt |
| npm | axios | 1.18.1 | indirekt |
| npm | balanced-match | 1.0.2 | indirekt |
| npm | base64-js | 1.5.1 | indirekt |
| npm | bl | 5.1.0 | indirekt |
| npm | brace-expansion | 1.1.14 | indirekt |
| npm | braces | 3.0.3 | indirekt |
| npm | browserslist | 4.25.2 | indirekt |
| npm | buffer | 6.0.3 | indirekt |
| npm | call-bind | 1.0.8 | indirekt |
| npm | call-bind-apply-helpers | 1.0.2 | indirekt |
| npm | call-bound | 1.0.4 | indirekt |
| npm | caniuse-lite | 1.0.30001734 | indirekt |
| npm | chalk | 2.4.2 | indirekt |
| npm | chalk | 5.5.0 | indirekt |
| npm | chownr | 3.0.0 | indirekt |
| npm | cli-cursor | 4.0.0 | indirekt |
| npm | cli-spinners | 2.9.2 | indirekt |
| npm | clone | 1.0.4 | indirekt |
| npm | color-convert | 1.9.3 | indirekt |
| npm | color-name | 1.1.3 | indirekt |
| npm | combined-stream | 1.0.8 | indirekt |
| npm | concat-map | 0.0.1 | indirekt |
| npm | cross-spawn | 6.0.6 | indirekt |
| npm | css-tree | 2.3.1 | indirekt |
| npm | cssesc | 3.0.0 | indirekt |
| npm | data-view-buffer | 1.0.2 | indirekt |
| npm | data-view-byte-length | 1.0.2 | indirekt |
| npm | data-view-byte-offset | 1.0.1 | indirekt |
| npm | debug | 4.4.3 | indirekt |
| npm | defaults | 1.0.4 | indirekt |
| npm | define-data-property | 1.1.4 | indirekt |
| npm | define-properties | 1.2.1 | indirekt |
| npm | delayed-stream | 1.0.0 | indirekt |
| npm | detect-libc | 1.0.3 | indirekt |
| npm | detect-libc | 2.0.4 | indirekt |
| npm | dunder-proto | 1.0.1 | indirekt |
| npm | electron-to-chromium | 1.5.200 | indirekt |
| npm | enhanced-resolve | 5.18.3 | indirekt |
| npm | error-ex | 1.3.2 | indirekt |
| npm | es-abstract | 1.24.0 | indirekt |
| npm | es-define-property | 1.0.1 | indirekt |
| npm | es-errors | 1.3.0 | indirekt |
| npm | es-object-atoms | 1.1.1 | indirekt |
| npm | es-set-tostringtag | 2.1.0 | indirekt |
| npm | es-to-primitive | 1.3.0 | indirekt |
| npm | esbuild | 0.28.1 | indirekt |
| npm | escalade | 3.2.0 | indirekt |
| npm | escape-string-regexp | 1.0.5 | indirekt |
| npm | fill-range | 7.1.1 | indirekt |
| npm | follow-redirects | 1.16.0 | indirekt |
| npm | for-each | 0.3.5 | indirekt |
| npm | form-data | 4.0.6 | indirekt |
| npm | fraction.js | 4.3.7 | indirekt |
| npm | function-bind | 1.1.2 | indirekt |
| npm | function.prototype.name | 1.1.8 | indirekt |
| npm | functions-have-names | 1.2.3 | indirekt |
| npm | get-intrinsic | 1.3.0 | indirekt |
| npm | get-proto | 1.0.1 | indirekt |
| npm | get-symbol-description | 1.1.0 | indirekt |
| npm | globalthis | 1.0.4 | indirekt |
| npm | gopd | 1.2.0 | indirekt |
| npm | graceful-fs | 4.2.11 | indirekt |
| npm | has-bigints | 1.1.0 | indirekt |
| npm | has-flag | 3.0.0 | indirekt |
| npm | has-property-descriptors | 1.0.2 | indirekt |
| npm | has-proto | 1.2.0 | indirekt |
| npm | has-symbols | 1.1.0 | indirekt |
| npm | has-tostringtag | 1.0.2 | indirekt |
| npm | hasown | 2.0.4 | indirekt |
| npm | hosted-git-info | 2.8.9 | indirekt |
| npm | https-proxy-agent | 5.0.1 | indirekt |
| npm | ieee754 | 1.2.1 | indirekt |
| npm | inherits | 2.0.4 | indirekt |
| npm | internal-slot | 1.1.0 | indirekt |
| npm | is-array-buffer | 3.0.5 | indirekt |
| npm | is-arrayish | 0.2.1 | indirekt |
| npm | is-async-function | 2.1.1 | indirekt |
| npm | is-bigint | 1.1.0 | indirekt |
| npm | is-boolean-object | 1.2.2 | indirekt |
| npm | is-callable | 1.2.7 | indirekt |
| npm | is-core-module | 2.16.1 | indirekt |
| npm | is-data-view | 1.0.2 | indirekt |
| npm | is-date-object | 1.1.0 | indirekt |
| npm | is-extglob | 2.1.1 | indirekt |
| npm | is-finalizationregistry | 1.1.1 | indirekt |
| npm | is-generator-function | 1.1.0 | indirekt |
| npm | is-glob | 4.0.3 | indirekt |
| npm | is-interactive | 2.0.0 | indirekt |
| npm | is-map | 2.0.3 | indirekt |
| npm | is-negative-zero | 2.0.3 | indirekt |
| npm | is-number | 7.0.0 | indirekt |
| npm | is-number-object | 1.1.1 | indirekt |
| npm | is-regex | 1.2.1 | indirekt |
| npm | is-set | 2.0.3 | indirekt |
| npm | is-shared-array-buffer | 1.0.4 | indirekt |
| npm | is-string | 1.1.1 | indirekt |
| npm | is-symbol | 1.1.1 | indirekt |
| npm | is-typed-array | 1.1.15 | indirekt |
| npm | is-unicode-supported | 1.3.0 | indirekt |
| npm | is-weakmap | 2.0.2 | indirekt |
| npm | is-weakref | 1.1.1 | indirekt |
| npm | is-weakset | 2.0.4 | indirekt |
| npm | isarray | 2.0.5 | indirekt |
| npm | isexe | 2.0.0 | indirekt |
| npm | jiti | 2.5.1 | indirekt |
| npm | json-parse-better-errors | 1.0.2 | indirekt |
| npm | lightningcss | 1.30.1 | indirekt |
| npm | lightningcss-darwin-arm64 | 1.30.1 | indirekt |
| npm | lightningcss-darwin-x64 | 1.30.1 | indirekt |
| npm | lightningcss-freebsd-x64 | 1.30.1 | indirekt |
| npm | lightningcss-linux-arm-gnueabihf | 1.30.1 | indirekt |
| npm | lightningcss-linux-arm64-gnu | 1.30.1 | indirekt |
| npm | lightningcss-linux-arm64-musl | 1.30.1 | indirekt |
| npm | lightningcss-linux-x64-gnu | 1.30.1 | indirekt |
| npm | lightningcss-linux-x64-musl | 1.30.1 | indirekt |
| npm | lightningcss-win32-arm64-msvc | 1.30.1 | indirekt |
| npm | lightningcss-win32-x64-msvc | 1.30.1 | indirekt |
| npm | load-json-file | 4.0.0 | indirekt |
| npm | lodash.castarray | 4.4.0 | indirekt |
| npm | lodash.isplainobject | 4.0.6 | indirekt |
| npm | lodash.merge | 4.6.2 | indirekt |
| npm | log-symbols | 5.1.0 | indirekt |
| npm | magic-string | 0.30.17 | indirekt |
| npm | math-intrinsics | 1.1.0 | indirekt |
| npm | mdn-data | 2.0.30 | indirekt |
| npm | memorystream | 0.3.1 | indirekt |
| npm | micromatch | 4.0.8 | indirekt |
| npm | mime-db | 1.52.0 | indirekt |
| npm | mime-types | 2.1.35 | indirekt |
| npm | mimic-fn | 2.1.0 | indirekt |
| npm | mini-svg-data-uri | 1.4.4 | indirekt |
| npm | minimatch | 3.1.5 | indirekt |
| npm | minipass | 7.1.2 | indirekt |
| npm | minizlib | 3.1.0 | indirekt |
| npm | mri | 1.2.0 | indirekt |
| npm | ms | 2.1.3 | indirekt |
| npm | nanoid | 3.3.11 | indirekt |
| npm | nice-try | 1.0.5 | indirekt |
| npm | node-addon-api | 7.1.1 | indirekt |
| npm | node-releases | 2.0.19 | indirekt |
| npm | normalize-package-data | 2.5.0 | indirekt |
| npm | normalize-range | 0.1.2 | indirekt |
| npm | npm-run-all | 4.1.5 | indirekt |
| npm | object-inspect | 1.13.4 | indirekt |
| npm | object-keys | 1.1.1 | indirekt |
| npm | object.assign | 4.1.7 | indirekt |
| npm | onetime | 5.1.2 | indirekt |
| npm | ora | 6.3.1 | indirekt |
| npm | own-keys | 1.0.1 | indirekt |
| npm | parse-json | 4.0.0 | indirekt |
| npm | path-key | 2.0.1 | indirekt |
| npm | path-parse | 1.0.7 | indirekt |
| npm | path-type | 3.0.0 | indirekt |
| npm | picocolors | 1.1.1 | indirekt |
| npm | picomatch | 2.3.2 | indirekt |
| npm | pidtree | 0.3.1 | indirekt |
| npm | pify | 3.0.0 | indirekt |
| npm | possible-typed-array-names | 1.1.0 | indirekt |
| npm | postcss | 8.5.13 | indirekt |
| npm | postcss-selector-parser | 6.0.10 | indirekt |
| npm | postcss-value-parser | 4.2.0 | indirekt |
| npm | prettier | 2.8.8 | indirekt |
| npm | prettier-plugin-tailwindcss | 0.1.13 | indirekt |
| npm | proxy-from-env | 2.1.0 | indirekt |
| npm | read-pkg | 3.0.0 | indirekt |
| npm | readable-stream | 3.6.2 | indirekt |
| npm | reflect.getprototypeof | 1.0.10 | indirekt |
| npm | regexp.prototype.flags | 1.5.4 | indirekt |
| npm | resolve | 1.22.10 | indirekt |
| npm | restore-cursor | 4.0.0 | indirekt |
| npm | safe-array-concat | 1.1.3 | indirekt |
| npm | safe-buffer | 5.2.1 | indirekt |
| npm | safe-push-apply | 1.0.0 | indirekt |
| npm | safe-regex-test | 1.1.0 | indirekt |
| npm | semver | 5.7.2 | indirekt |
| npm | set-function-length | 1.2.2 | indirekt |
| npm | set-function-name | 2.0.2 | indirekt |
| npm | set-proto | 1.0.0 | indirekt |
| npm | shebang-command | 1.2.0 | indirekt |
| npm | shebang-regex | 1.0.0 | indirekt |
| npm | shell-quote | 1.8.4 | indirekt |
| npm | side-channel | 1.1.0 | indirekt |
| npm | side-channel-list | 1.0.0 | indirekt |
| npm | side-channel-map | 1.0.1 | indirekt |
| npm | side-channel-weakmap | 1.0.2 | indirekt |
| npm | signal-exit | 3.0.7 | indirekt |
| npm | source-map-js | 1.2.1 | indirekt |
| npm | spdx-correct | 3.2.0 | indirekt |
| npm | spdx-exceptions | 2.5.0 | indirekt |
| npm | spdx-expression-parse | 3.0.1 | indirekt |
| npm | spdx-license-ids | 3.0.22 | indirekt |
| npm | stdin-discarder | 0.1.0 | indirekt |
| npm | stop-iteration-iterator | 1.1.0 | indirekt |
| npm | string.prototype.padend | 3.1.6 | indirekt |
| npm | string.prototype.trim | 1.2.10 | indirekt |
| npm | string.prototype.trimend | 1.0.9 | indirekt |
| npm | string.prototype.trimstart | 1.0.8 | indirekt |
| npm | string_decoder | 1.3.0 | indirekt |
| npm | strip-ansi | 7.1.0 | indirekt |
| npm | strip-bom | 3.0.0 | indirekt |
| npm | supports-color | 5.5.0 | indirekt |
| npm | supports-preserve-symlinks-flag | 1.0.0 | indirekt |
| npm | tailwindcss | 4.1.11 | indirekt |
| npm | tapable | 2.2.2 | indirekt |
| npm | tar | 7.5.16 | indirekt |
| npm | to-regex-range | 5.0.1 | indirekt |
| npm | tslib | 2.8.0 | indirekt |
| npm | typed-array-buffer | 1.0.3 | indirekt |
| npm | typed-array-byte-length | 1.0.3 | indirekt |
| npm | typed-array-byte-offset | 1.0.4 | indirekt |
| npm | typed-array-length | 1.0.7 | indirekt |
| npm | unbox-primitive | 1.1.0 | indirekt |
| npm | update-browserslist-db | 1.1.3 | indirekt |
| npm | util-deprecate | 1.0.2 | indirekt |
| npm | validate-npm-package-license | 3.0.4 | indirekt |
| npm | wcwidth | 1.0.1 | indirekt |
| npm | which | 1.3.1 | indirekt |
| npm | which-boxed-primitive | 1.1.1 | indirekt |
| npm | which-builtin-type | 1.2.1 | indirekt |
| npm | which-collection | 1.0.2 | indirekt |
| npm | which-typed-array | 1.1.19 | indirekt |
| npm | yallist | 5.0.0 | indirekt |
| Packagist | laravel/pint | — | indirekt |
| Packagist | php | — | indirekt |
| Packagist | spatie/laravel-ray | — | indirekt |
Abhängigkeits-Advisories 1
Dieses Repository veröffentlicht kein vom Index auflösbares Paket, daher wurde sein eigener Abhängigkeitsgraph bewertet – 302 Pakete, darunter auch Entwicklungs- und Test-Pins, die nie ausgeliefert werden: 1 tragen bekannte Advisories, davon 0 direkte. 6 konnten nicht bewertet werden – keine aufgelöste Version, ein nicht unterstütztes Ökosystem, oder außerhalb der ausgewiesenen Paketliste.
| Paket | Version | Beziehung | Schweregrad | Advisories | Behoben in |
|---|---|---|---|---|---|
| brace-expansion | 1.1.14 | indirekt | hoch | 1 | 5.0.7 |
Ein Advisory bedeutet, dass die im Abhängigkeitsgraphen erfasste Version in den betroffenen Bereich eines Advisories fällt. Erreichbarkeit wird nicht analysiert, und der Graph enthält Entwicklungs- und Test-Pins — ein Fund kann das Werkzeug betreffen und nicht die ausgelieferte Software.
JSON-Rohbericht maschinenlesbar
{
"data": {
"repo": {
"topics": [
"filament",
"filament-4",
"filament-plugin",
"filamentphp",
"filamentphp-4",
"filamentphp-plugin",
"livewire",
"passkey",
"passkeys",
"php",
"plugin",
"filament-passkey",
"filament-passkeys",
"filamentphp-passkey",
"filamentphp-passkeys",
"spatie-passkey",
"spatie-passkeys"
],
"is_fork": false,
"size_kb": 4706,
"has_wiki": false,
"homepage": null,
"languages": {
"CSS": 59,
"PHP": 16150,
"Blade": 3482,
"JavaScript": 1849
},
"pushed_at": "2026-07-20T18:21:25Z",
"created_at": "2025-08-11T18:25:07Z",
"owner_type": "User",
"updated_at": "2026-07-20T18:22:34Z",
"description": "Use passkeys in your filament app",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "4.x",
"license_spdx_raw": "MIT",
"primary_language": "PHP",
"significant_languages": [
"PHP",
"Blade"
]
},
"owner": {
"blog": null,
"name": "Marcel",
"type": "User",
"login": "MarcelWeidum",
"company": null,
"location": "Netherlands",
"followers": 28,
"avatar_url": "https://avatars.githubusercontent.com/u/9413586?v=4",
"created_at": "2014-10-27T08:32:06Z",
"is_verified": null,
"public_repos": 43,
"account_age_days": 4284
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 29,
"commits_last_year": 149,
"latest_release_at": "2026-07-09T16:46:04Z",
"latest_release_tag": "v4.0.5",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 31,
"days_since_latest_release": 11,
"mean_days_between_releases": 9
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 71,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "marcelweidum/filament-passkeys",
"exists": true,
"license": "MIT",
"keywords": [
"laravel",
"filament",
"filamentphp",
"MarcelWeidum",
"filament-passkeys"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/marcelweidum/filament-passkeys",
"is_deprecated": false,
"latest_version": "v4.0.5",
"repository_url": "https://github.com/MarcelWeidum/filament-passkeys",
"versions_count": 29,
"total_downloads": 54357,
"dependents_count": 1,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 7226,
"first_published_at": null,
"latest_published_at": "2026-07-09T16:45:39Z",
"latest_version_yanked": null,
"days_since_latest_publish": 11
}
]
},
"popularity": {
"forks": 16,
"stars": 67,
"watchers": 2,
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 3714,
"source_files_sampled": 16,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json",
"package.json"
],
"advisories": {
"error": null,
"scope": "repository_graph",
"source": "osv",
"findings": [
{
"name": "brace-expansion",
"direct": false,
"version": "1.1.14",
"severity": "high",
"ecosystem": "npm",
"cvss_score": 7.5,
"advisory_ids": [
"GHSA-3jxr-9vmj-r5cp"
],
"fixed_version": "5.0.7",
"advisory_count": 1,
"oldest_advisory_days": 0
}
],
"collected": true,
"truncated": false,
"by_severity": {
"high": 1
},
"advisory_count": 1,
"affected_count": 1,
"assessed_count": 302,
"assessed_package": null,
"unassessed_count": 6,
"direct_affected_count": 0
},
"ecosystems": [
"npm",
"packagist"
],
"dependencies": [
{
"name": "filament/filament",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^5.0"
},
{
"name": "laravel/passkeys",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^0.2.0"
},
{
"name": "spatie/laravel-package-tools",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^1.15.0"
},
{
"name": "@laravel/passkeys",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^0.1.0"
},
{
"name": "@tailwindcss/cli",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^4.1.11"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "@laravel/passkeys",
"direct": true,
"version": "0.1.0",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/cli",
"direct": true,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "filament/filament",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "laravel/passkeys",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-package-tools",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "@ampproject/remapping",
"direct": false,
"version": "2.3.0",
"ecosystem": "npm"
},
{
"name": "@awcodes/filament-plugin-purge",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "@emnapi/core",
"direct": false,
"version": "1.4.3",
"ecosystem": "npm"
},
{
"name": "@emnapi/runtime",
"direct": false,
"version": "1.4.3",
"ecosystem": "npm"
},
{
"name": "@emnapi/wasi-threads",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "@esbuild/aix-ppc64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-arm",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/darwin-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/darwin-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/freebsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/freebsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-arm",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-ia32",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-loong64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-mips64el",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-ppc64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-riscv64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-s390x",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/netbsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/netbsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openbsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openbsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openharmony-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/sunos-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-ia32",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@isaacs/fs-minipass",
"direct": false,
"version": "4.0.1",
"ecosystem": "npm"
},
{
"name": "@jridgewell/gen-mapping",
"direct": false,
"version": "0.3.13",
"ecosystem": "npm"
},
{
"name": "@jridgewell/resolve-uri",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "@jridgewell/sourcemap-codec",
"direct": false,
"version": "1.5.5",
"ecosystem": "npm"
},
{
"name": "@jridgewell/trace-mapping",
"direct": false,
"version": "0.3.30",
"ecosystem": "npm"
},
{
"name": "@napi-rs/wasm-runtime",
"direct": false,
"version": "0.2.11",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-android-arm64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-darwin-arm64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-darwin-x64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-freebsd-x64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm-glibc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm-musl",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm64-glibc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-arm64-musl",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-x64-glibc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-linux-x64-musl",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-win32-arm64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-win32-ia32",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@parcel/watcher-win32-x64",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@simplewebauthn/browser",
"direct": false,
"version": "13.1.2",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/forms",
"direct": false,
"version": "0.5.10",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/node",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-android-arm64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-darwin-arm64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-darwin-x64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-freebsd-x64",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-arm-gnueabihf",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-arm64-gnu",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-arm64-musl",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-x64-gnu",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-linux-x64-musl",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-wasm32-wasi",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-win32-arm64-msvc",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/oxide-win32-x64-msvc",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "@tailwindcss/typography",
"direct": false,
"version": "0.5.16",
"ecosystem": "npm"
},
{
"name": "@tybys/wasm-util",
"direct": false,
"version": "0.9.0",
"ecosystem": "npm"
},
{
"name": "agent-base",
"direct": false,
"version": "6.0.2",
"ecosystem": "npm"
},
{
"name": "ansi-regex",
"direct": false,
"version": "6.1.0",
"ecosystem": "npm"
},
{
"name": "ansi-styles",
"direct": false,
"version": "3.2.1",
"ecosystem": "npm"
},
{
"name": "array-buffer-byte-length",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "arraybuffer.prototype.slice",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "async-function",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "asynckit",
"direct": false,
"version": "0.4.0",
"ecosystem": "npm"
},
{
"name": "autoprefixer",
"direct": false,
"version": "10.4.21",
"ecosystem": "npm"
},
{
"name": "available-typed-arrays",
"direct": false,
"version": "1.0.7",
"ecosystem": "npm"
},
{
"name": "axios",
"direct": false,
"version": "1.18.1",
"ecosystem": "npm"
},
{
"name": "balanced-match",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "base64-js",
"direct": false,
"version": "1.5.1",
"ecosystem": "npm"
},
{
"name": "bl",
"direct": false,
"version": "5.1.0",
"ecosystem": "npm"
},
{
"name": "brace-expansion",
"direct": false,
"version": "1.1.14",
"ecosystem": "npm"
},
{
"name": "braces",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "browserslist",
"direct": false,
"version": "4.25.2",
"ecosystem": "npm"
},
{
"name": "buffer",
"direct": false,
"version": "6.0.3",
"ecosystem": "npm"
},
{
"name": "call-bind",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "call-bind-apply-helpers",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "call-bound",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "caniuse-lite",
"direct": false,
"version": "1.0.30001734",
"ecosystem": "npm"
},
{
"name": "chalk",
"direct": false,
"version": "2.4.2",
"ecosystem": "npm"
},
{
"name": "chalk",
"direct": false,
"version": "5.5.0",
"ecosystem": "npm"
},
{
"name": "chownr",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "cli-cursor",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "cli-spinners",
"direct": false,
"version": "2.9.2",
"ecosystem": "npm"
},
{
"name": "clone",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "color-convert",
"direct": false,
"version": "1.9.3",
"ecosystem": "npm"
},
{
"name": "color-name",
"direct": false,
"version": "1.1.3",
"ecosystem": "npm"
},
{
"name": "combined-stream",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "concat-map",
"direct": false,
"version": "0.0.1",
"ecosystem": "npm"
},
{
"name": "cross-spawn",
"direct": false,
"version": "6.0.6",
"ecosystem": "npm"
},
{
"name": "css-tree",
"direct": false,
"version": "2.3.1",
"ecosystem": "npm"
},
{
"name": "cssesc",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "data-view-buffer",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "data-view-byte-length",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "data-view-byte-offset",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "debug",
"direct": false,
"version": "4.4.3",
"ecosystem": "npm"
},
{
"name": "defaults",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "define-data-property",
"direct": false,
"version": "1.1.4",
"ecosystem": "npm"
},
{
"name": "define-properties",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "delayed-stream",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "detect-libc",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "detect-libc",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "dunder-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "electron-to-chromium",
"direct": false,
"version": "1.5.200",
"ecosystem": "npm"
},
{
"name": "enhanced-resolve",
"direct": false,
"version": "5.18.3",
"ecosystem": "npm"
},
{
"name": "error-ex",
"direct": false,
"version": "1.3.2",
"ecosystem": "npm"
},
{
"name": "es-abstract",
"direct": false,
"version": "1.24.0",
"ecosystem": "npm"
},
{
"name": "es-define-property",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "es-errors",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "es-object-atoms",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "es-set-tostringtag",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "es-to-primitive",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "esbuild",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "escalade",
"direct": false,
"version": "3.2.0",
"ecosystem": "npm"
},
{
"name": "escape-string-regexp",
"direct": false,
"version": "1.0.5",
"ecosystem": "npm"
},
{
"name": "fill-range",
"direct": false,
"version": "7.1.1",
"ecosystem": "npm"
},
{
"name": "follow-redirects",
"direct": false,
"version": "1.16.0",
"ecosystem": "npm"
},
{
"name": "for-each",
"direct": false,
"version": "0.3.5",
"ecosystem": "npm"
},
{
"name": "form-data",
"direct": false,
"version": "4.0.6",
"ecosystem": "npm"
},
{
"name": "fraction.js",
"direct": false,
"version": "4.3.7",
"ecosystem": "npm"
},
{
"name": "function-bind",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "function.prototype.name",
"direct": false,
"version": "1.1.8",
"ecosystem": "npm"
},
{
"name": "functions-have-names",
"direct": false,
"version": "1.2.3",
"ecosystem": "npm"
},
{
"name": "get-intrinsic",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "get-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "get-symbol-description",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "globalthis",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "gopd",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "graceful-fs",
"direct": false,
"version": "4.2.11",
"ecosystem": "npm"
},
{
"name": "has-bigints",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "has-flag",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "has-property-descriptors",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "has-proto",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "has-symbols",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "has-tostringtag",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "hasown",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "hosted-git-info",
"direct": false,
"version": "2.8.9",
"ecosystem": "npm"
},
{
"name": "https-proxy-agent",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "ieee754",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "inherits",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "internal-slot",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-array-buffer",
"direct": false,
"version": "3.0.5",
"ecosystem": "npm"
},
{
"name": "is-arrayish",
"direct": false,
"version": "0.2.1",
"ecosystem": "npm"
},
{
"name": "is-async-function",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "is-bigint",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-boolean-object",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "is-callable",
"direct": false,
"version": "1.2.7",
"ecosystem": "npm"
},
{
"name": "is-core-module",
"direct": false,
"version": "2.16.1",
"ecosystem": "npm"
},
{
"name": "is-data-view",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "is-date-object",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-extglob",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "is-finalizationregistry",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-generator-function",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "is-glob",
"direct": false,
"version": "4.0.3",
"ecosystem": "npm"
},
{
"name": "is-interactive",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "is-map",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "is-negative-zero",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "is-number",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "is-number-object",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-regex",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "is-set",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "is-shared-array-buffer",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "is-string",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-symbol",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-typed-array",
"direct": false,
"version": "1.1.15",
"ecosystem": "npm"
},
{
"name": "is-unicode-supported",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "is-weakmap",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "is-weakref",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "is-weakset",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "isarray",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "isexe",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "jiti",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "json-parse-better-errors",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "lightningcss",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-arm64",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-x64",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-freebsd-x64",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm-gnueabihf",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-gnu",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-musl",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-gnu",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-musl",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-arm64-msvc",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-x64-msvc",
"direct": false,
"version": "1.30.1",
"ecosystem": "npm"
},
{
"name": "load-json-file",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "lodash.castarray",
"direct": false,
"version": "4.4.0",
"ecosystem": "npm"
},
{
"name": "lodash.isplainobject",
"direct": false,
"version": "4.0.6",
"ecosystem": "npm"
},
{
"name": "lodash.merge",
"direct": false,
"version": "4.6.2",
"ecosystem": "npm"
},
{
"name": "log-symbols",
"direct": false,
"version": "5.1.0",
"ecosystem": "npm"
},
{
"name": "magic-string",
"direct": false,
"version": "0.30.17",
"ecosystem": "npm"
},
{
"name": "math-intrinsics",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "mdn-data",
"direct": false,
"version": "2.0.30",
"ecosystem": "npm"
},
{
"name": "memorystream",
"direct": false,
"version": "0.3.1",
"ecosystem": "npm"
},
{
"name": "micromatch",
"direct": false,
"version": "4.0.8",
"ecosystem": "npm"
},
{
"name": "mime-db",
"direct": false,
"version": "1.52.0",
"ecosystem": "npm"
},
{
"name": "mime-types",
"direct": false,
"version": "2.1.35",
"ecosystem": "npm"
},
{
"name": "mimic-fn",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "mini-svg-data-uri",
"direct": false,
"version": "1.4.4",
"ecosystem": "npm"
},
{
"name": "minimatch",
"direct": false,
"version": "3.1.5",
"ecosystem": "npm"
},
{
"name": "minipass",
"direct": false,
"version": "7.1.2",
"ecosystem": "npm"
},
{
"name": "minizlib",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "mri",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "ms",
"direct": false,
"version": "2.1.3",
"ecosystem": "npm"
},
{
"name": "nanoid",
"direct": false,
"version": "3.3.11",
"ecosystem": "npm"
},
{
"name": "nice-try",
"direct": false,
"version": "1.0.5",
"ecosystem": "npm"
},
{
"name": "node-addon-api",
"direct": false,
"version": "7.1.1",
"ecosystem": "npm"
},
{
"name": "node-releases",
"direct": false,
"version": "2.0.19",
"ecosystem": "npm"
},
{
"name": "normalize-package-data",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "normalize-range",
"direct": false,
"version": "0.1.2",
"ecosystem": "npm"
},
{
"name": "npm-run-all",
"direct": false,
"version": "4.1.5",
"ecosystem": "npm"
},
{
"name": "object-inspect",
"direct": false,
"version": "1.13.4",
"ecosystem": "npm"
},
{
"name": "object-keys",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "object.assign",
"direct": false,
"version": "4.1.7",
"ecosystem": "npm"
},
{
"name": "onetime",
"direct": false,
"version": "5.1.2",
"ecosystem": "npm"
},
{
"name": "ora",
"direct": false,
"version": "6.3.1",
"ecosystem": "npm"
},
{
"name": "own-keys",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "parse-json",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "path-key",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "path-parse",
"direct": false,
"version": "1.0.7",
"ecosystem": "npm"
},
{
"name": "path-type",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "picocolors",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "picomatch",
"direct": false,
"version": "2.3.2",
"ecosystem": "npm"
},
{
"name": "pidtree",
"direct": false,
"version": "0.3.1",
"ecosystem": "npm"
},
{
"name": "pify",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "possible-typed-array-names",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "postcss",
"direct": false,
"version": "8.5.13",
"ecosystem": "npm"
},
{
"name": "postcss-selector-parser",
"direct": false,
"version": "6.0.10",
"ecosystem": "npm"
},
{
"name": "postcss-value-parser",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "prettier",
"direct": false,
"version": "2.8.8",
"ecosystem": "npm"
},
{
"name": "prettier-plugin-tailwindcss",
"direct": false,
"version": "0.1.13",
"ecosystem": "npm"
},
{
"name": "proxy-from-env",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "read-pkg",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "readable-stream",
"direct": false,
"version": "3.6.2",
"ecosystem": "npm"
},
{
"name": "reflect.getprototypeof",
"direct": false,
"version": "1.0.10",
"ecosystem": "npm"
},
{
"name": "regexp.prototype.flags",
"direct": false,
"version": "1.5.4",
"ecosystem": "npm"
},
{
"name": "resolve",
"direct": false,
"version": "1.22.10",
"ecosystem": "npm"
},
{
"name": "restore-cursor",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "safe-array-concat",
"direct": false,
"version": "1.1.3",
"ecosystem": "npm"
},
{
"name": "safe-buffer",
"direct": false,
"version": "5.2.1",
"ecosystem": "npm"
},
{
"name": "safe-push-apply",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "safe-regex-test",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "semver",
"direct": false,
"version": "5.7.2",
"ecosystem": "npm"
},
{
"name": "set-function-length",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "set-function-name",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "set-proto",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "shebang-command",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "shebang-regex",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "shell-quote",
"direct": false,
"version": "1.8.4",
"ecosystem": "npm"
},
{
"name": "side-channel",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "side-channel-list",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "side-channel-map",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "side-channel-weakmap",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "signal-exit",
"direct": false,
"version": "3.0.7",
"ecosystem": "npm"
},
{
"name": "source-map-js",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "spdx-correct",
"direct": false,
"version": "3.2.0",
"ecosystem": "npm"
},
{
"name": "spdx-exceptions",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "spdx-expression-parse",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "spdx-license-ids",
"direct": false,
"version": "3.0.22",
"ecosystem": "npm"
},
{
"name": "stdin-discarder",
"direct": false,
"version": "0.1.0",
"ecosystem": "npm"
},
{
"name": "stop-iteration-iterator",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "string.prototype.padend",
"direct": false,
"version": "3.1.6",
"ecosystem": "npm"
},
{
"name": "string.prototype.trim",
"direct": false,
"version": "1.2.10",
"ecosystem": "npm"
},
{
"name": "string.prototype.trimend",
"direct": false,
"version": "1.0.9",
"ecosystem": "npm"
},
{
"name": "string.prototype.trimstart",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "string_decoder",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "strip-ansi",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "strip-bom",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "supports-color",
"direct": false,
"version": "5.5.0",
"ecosystem": "npm"
},
{
"name": "supports-preserve-symlinks-flag",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "tailwindcss",
"direct": false,
"version": "4.1.11",
"ecosystem": "npm"
},
{
"name": "tapable",
"direct": false,
"version": "2.2.2",
"ecosystem": "npm"
},
{
"name": "tar",
"direct": false,
"version": "7.5.16",
"ecosystem": "npm"
},
{
"name": "to-regex-range",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "tslib",
"direct": false,
"version": "2.8.0",
"ecosystem": "npm"
},
{
"name": "typed-array-buffer",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "typed-array-byte-length",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "typed-array-byte-offset",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "typed-array-length",
"direct": false,
"version": "1.0.7",
"ecosystem": "npm"
},
{
"name": "unbox-primitive",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "update-browserslist-db",
"direct": false,
"version": "1.1.3",
"ecosystem": "npm"
},
{
"name": "util-deprecate",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "validate-npm-package-license",
"direct": false,
"version": "3.0.4",
"ecosystem": "npm"
},
{
"name": "wcwidth",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "which",
"direct": false,
"version": "1.3.1",
"ecosystem": "npm"
},
{
"name": "which-boxed-primitive",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "which-builtin-type",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "which-collection",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "which-typed-array",
"direct": false,
"version": "1.1.19",
"ecosystem": "npm"
},
{
"name": "yallist",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "laravel/pint",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "php",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-ray",
"direct": false,
"version": null,
"ecosystem": "packagist"
}
],
"collected": true,
"truncated": false,
"total_count": 308,
"direct_count": 5,
"indirect_count": 303
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 50,
"open_issues": 0,
"closed_ratio": 1,
"closed_issues": 20,
"closed_unmerged_prs": 1
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "MarcelWeidum",
"commits": 104,
"avatar_url": "https://avatars.githubusercontent.com/u/9413586?v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 23,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 14,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
},
{
"type": "User",
"login": "DSpeichert",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/1254971?v=4"
},
{
"type": "User",
"login": "webard",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/855788?v=4"
},
{
"type": "User",
"login": "hamza200411",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/132139779?v=4"
},
{
"type": "User",
"login": "MACscr",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/1404944?v=4"
},
{
"type": "User",
"login": "rmartinoscar",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/40749467?v=4"
},
{
"type": "User",
"login": "MrSleeps",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/9741713?v=4"
}
],
"contributors_sampled": 9,
"top_contributor_share": 0.689
},
"quality_signals": {
"has_ci": true,
"has_tests": false,
"ci_workflows": [
"dependabot-auto-merge.yml",
"fix-php-code-style-issues.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during GetBranch(2.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 8,
"reason": "8 out of 10 merged PRs checked by a CI test -- score normalized to 8",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 5,
"reason": "Found 1/2 approved changesets -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 9,
"reason": "1 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "c2108e0eb5abb44d4a1131e9dfc59a7cf1d5c425",
"ran_at": "2026-07-20T21:38:46Z",
"aggregate_score": 6,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/MarcelWeidum/filament-passkeys",
"host": "github.com",
"name": "filament-passkeys",
"owner": "MarcelWeidum"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 66,
"inputs": {
"security": 68,
"vitality": 92,
"community": 54,
"governance": 65,
"engineering": 48
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 92,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 86,
"inputs": {
"commits_last_year": 149,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 31
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "31/52 weeks with commits",
"points": 21.5,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 31
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "149 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 149
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 100,
"inputs": {
"releases_count": 29,
"latest_release_tag": "v4.0.5",
"releases_from_tags": false,
"days_since_latest_release": 11,
"mean_days_between_releases": 9
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "29 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 29
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 11 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 11
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~9 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 9
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 54,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 39,
"inputs": {
"forks": 16,
"stars": 67,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "67 stars",
"points": 29.5,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 67
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "16 forks",
"points": 9.8,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 16
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 70,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"packages": [
"marcelweidum/filament-passkeys"
],
"dependents": 1,
"ecosystems": "packagist",
"total_downloads": 54357,
"monthly_downloads": 7226
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "7,226 downloads/month across packagist",
"points": 51.5,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 7226,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "1 packages depend on it",
"points": 2,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 1
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 65,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 28,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 9,
"top_contributor_share": 0.689
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 69% of commits",
"points": 7,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 69
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "9 contributors",
"points": 12.2,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 9
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "excellent",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 92,
"inputs": {
"merged_prs": 50,
"open_issues": 0,
"closed_issues": 20,
"issue_closed_ratio": 1,
"closed_unmerged_prs": 1
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "100% of issues closed",
"points": 46.8,
"status": "met",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 100
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "50/51 decided PRs merged",
"points": 37.5,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 50,
"decided": 51
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 1/2 approved changesets -- score normalized to 5",
"points": 7.5,
"status": "partial",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 56,
"inputs": {
"followers": 28,
"owner_type": "User",
"is_verified": null,
"owner_login": "MarcelWeidum",
"public_repos": 43,
"account_age_days": 4284
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "28 followers of MarcelWeidum",
"points": 10.5,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 28,
"login": "MarcelWeidum"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "43 public repos, account ~11 yr old",
"points": 24,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 43
}
},
{
"code": "account_age_years",
"params": {
"years": 11
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"marcelweidum/filament-passkeys"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 11
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 11 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 11
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "29 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 29
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "at_risk",
"name": "Engineering Quality",
"value": 48,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "at_risk",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 46,
"inputs": {
"has_ci": true,
"has_tests": false,
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "2 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 2
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 6.4,
"status": "met",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "8 out of 10 merged PRs checked by a CI test -- score normalized to 8",
"points": 16,
"status": "partial",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"topics": [
"filament",
"filament-4",
"filament-plugin",
"filamentphp",
"filamentphp-4",
"filamentphp-plugin",
"livewire",
"passkey",
"passkeys",
"php",
"plugin",
"filament-passkey",
"filament-passkeys",
"filamentphp-passkey",
"filamentphp-passkeys",
"spatie-passkey",
"spatie-passkeys"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "17 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 17
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 68,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 12,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 6,
"scorecard_aggregate": 6
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during GetBranch(2.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "8 out of 10 merged PRs checked by a CI test -- score normalized to 8",
"points": 2,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 1/2 approved changesets -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 2 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "1 existing vulnerabilities detected",
"points": 6.8,
"status": "partial",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "dependency_advisories",
"band": "excellent",
"name": "Dependency advisories",
"note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 302 resolved dependencies against OSV; 6 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"indirect_dependencies_free_of_known_advisories",
"no_advisories_left_outstanding"
]
}
},
{
"code": "weights_renormalized",
"params": {}
},
{
"code": "advisories_scope_repository",
"params": {
"assessed": 302
}
},
{
"code": "advisories_unassessed",
"params": {
"count": 6
}
},
{
"code": "advisories_repo_graph_caveat",
"params": {}
},
{
"code": "advisories_reachability",
"params": {}
}
],
"value": 100,
"inputs": {
"source": "osv",
"advisories": 1,
"affected_packages": 1,
"assessed_packages": 302,
"unassessed_packages": 6,
"affected_by_severity": "high 1",
"direct_affected_packages": 0
},
"components": [
{
"key": "direct_dependencies_free_of_known_advisories",
"name": "Direct dependencies free of known advisories",
"detail": "no direct dependency carries a known advisory",
"points": 35,
"status": "met",
"details": [
{
"code": "no_direct_advisories",
"params": {}
}
],
"max_points": 35
},
{
"key": "indirect_dependencies_free_of_known_advisories",
"name": "Indirect dependencies free of known advisories",
"detail": "transitive set not separable from development and test dependencies in this scope",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_scope_not_separable",
"params": {}
}
],
"max_points": 25
},
{
"key": "no_advisories_left_outstanding",
"name": "No advisories left outstanding",
"detail": "no advisory carries a publication date",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_no_publication_date",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "malicious_dependencies",
"band": "excellent",
"name": "Malicious dependencies",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"source": "osv",
"meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
"packages": [],
"red_flag": false,
"assessed_packages": 302,
"malicious_packages": 0,
"direct_malicious_packages": 0,
"withdrawn_malicious_packages": 0,
"installable_malicious_packages": 0
},
"components": [
{
"key": "no_dependency_reported_as_a_malicious_package",
"name": "No dependency reported as a malicious package",
"detail": "no dependency is reported as a malicious package",
"points": 100,
"status": "met",
"details": [
{
"code": "no_malicious_dependencies",
"params": {}
}
],
"max_points": 100
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 9
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 19,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "critical",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice",
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 19,
"inputs": {
"has_nix": false,
"has_tests": false,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "PHP",
"largest_source_bytes": 3714,
"source_files_sampled": 16,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "PHP without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "PHP"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/16 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 16,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-20T21:39:04.569448Z",
"schema_version": "0.16.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/m/MarcelWeidum/filament-passkeys.svg",
"full_name": "MarcelWeidum/filament-passkeys",
"license_state": "standard",
"license_spdx": "MIT"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.16.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — Packagist.