Public recordModerate
Software health reportschema 0.27.0 · metrics 1.13.0 · 2026-07-26 01:39 UTC
danzuep / MailKitSimplified
Send and receive emails easily, fluently, with one line of code for each operation.
danzuep/MailKitSimplified holds a health index of 62 out of 100, placing it in the Moderate band. It scores highest on Vitality (72/100) and lowest on AI Readiness (52/100). It was last updated 21 days ago. A single contributor accounts for most of its recent work.
62
overall / 100Software health index
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.
62
Excellent85-100Exemplary; meets essentially all checked criteria
Good70-84Healthy; minor gaps
Moderate50-69Acceptable with notable gaps; review recommended
At risk30-49Significant weaknesses; adoption warrants caution
Critical1-29Severe problems (abandoned, single-maintainer, no hygiene)
Score profile
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
Ownership
Daniel CollingwoodPersonal account
24 followers41 public repossince Apr 2021
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
Package ecosystems
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| NuGet | MailKitSimplified.Sender | 2.13.1 | - | 45 | 21 days ago | smtpmailkitemailsendersendsimplyeasilysimpleeasyfluentc# |
| NuGet | MailKitSimplified.Receiver | 2.13.1 | - | 34 | 21 days ago | imapmailkitemailreceiverreceiveforwardreplysimplyeasilysimpleeasyfluentc# |
Metrics by category
Vitality
Is the project alive — is code being written and are releases shipping?
72
Development activity
58Moderate
How it's scored
| 28.8/36 | Push recency — last push 21 days ago |
| 11.1/36 | Commit cadence — 16/52 weeks with commits |
| 13.1/18 | Commit volume — 28 commits in the last year |
| 5/10 | OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
Inputs used
| commits_last_year | 28 |
| human_commit_share | 0.61 |
| days_since_last_push | 21 |
| active_weeks_last_year | 16 |
Release discipline
92Excellent
How it's scored
| 27/27 | Ships releases — 36 releases published |
| 36/36 | Release recency — latest release 21 days ago |
| 19.8/27 | Release cadence — a release every ~77.4 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
Inputs used
| releases_count | 36 |
| latest_release_tag | v2.13.1 |
| releases_from_tags | no |
| days_since_latest_release | 21 |
| mean_days_between_releases | 77.4 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.
Community & Adoption
Does the project have users, downloads, attention, and a welcoming setup for contributors?
52
Popularity & adoption
44At risk
How it's scored
| 32/60 | Stars — 95 stars |
| 9/25 | Forks — 13 forks |
| 2.7/15 | Watchers — 4 watchers |
Inputs used
| forks | 13 |
| stars | 95 |
| watchers | 4 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community health
50Moderate
How it's scored
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
Inputs used
| has_readme | yes |
| has_license | yes |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
Ecosystem adoption (downloads)
66Moderate
How it's scored
| 53.1/80 | Total downloads — 127,600 downloads all-time across nuget |
| 0/20 | Registry dependents — not reported by this ecosystem |
Inputs used
| packages | MailKitSimplified.Sender, MailKitSimplified.Receiver |
| dependents | — |
| ecosystems | nuget |
| total_downloads | 127,600 |
| monthly_downloads | — |
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.
Sustainability & Governance
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
57
Maintainer resilience (bus factor)
15Critical
How it's scored
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0.2/22.5 | Commit distribution — top contributor authored 99% of commits |
| 5.4/13.5 | Contributor breadth — 4 contributors |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
Inputs used
| bus_factor | 1 |
| contributors_sampled | 4 |
| top_contributor_share | 0.992 |
How it's scored
| 46.8/46.8 | Issue resolution — 100% of issues closed |
| 29.4/38.3 | PR acceptance — 60/78 decided PRs merged |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/15 approved changesets -- score normalized to 0 |
Inputs used
| merged_prs | 60 |
| open_issues | 0 |
| closed_issues | 33 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 18 |
Ownership & stewardship
53Moderate
How it's scored
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 10.1/25 | Owner reach — 24 followers of danzuep |
| 22.4/25 | Track record — 41 public repos, account ~5 yr old |
Inputs used
| followers | 24 |
| owner_type | User |
| is_verified | — |
| owner_login | danzuep |
| public_repos | 41 |
| account_age_days | 1,925 |
Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.
Package maintenance
100Excellent
How it's scored
| 25/25 | Published & resolvable — 2 package(s) on nuget |
| 35/35 | Publish recency — latest publish 21 days ago |
| 20/20 | Version history — 45 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
Inputs used
| packages | MailKitSimplified.Sender, MailKitSimplified.Receiver |
| ecosystems | nuget |
| any_deprecated | no |
| min_days_since_publish | 21 |
Engineering Quality
Are baseline engineering and documentation practices in place?
65
Engineering practices
68Moderate
How it's scored
| 24/24 | CI workflows — 13 workflow(s) |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 15 out of 15 merged PRs checked by a CI test -- score normalized to 10 |
Inputs used
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
Documentation
60Moderate
How it's scored
| 30/30 | README |
| 0/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 10/10 | Topics — 16 topics |
| 10/10 | Wiki |
Inputs used
| topics | email, fluent, imap, mail, smtp, asynchronous, csharp, dependency-injection, devops-enabled, unit-tested, imap-client, smtp-client, email-reader, email-receiver, email-sender, mailer |
| has_wiki | yes |
| homepage | — |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Security
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
61
Security posture
51Moderate
How it's scored
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 2.2/7.5 | Branch-Protection — branch protection is not maximal on development and all release branches |
| 2.5/2.5 | CI-Tests — 15 out of 15 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/15 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 3.8/7.5 | Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 3.5/5 | SAST — SAST tool detected but not run on all commits |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Inputs used
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5.1 |
Excluded from scoring (no data or not applicable): packaging, signed_releases. Remaining weights renormalized.
Dependency advisories
100Excellent
How it's scored
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 0/25 | Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
Inputs used
| source | osv |
| advisories | 3 |
| affected_packages | 1 |
| assessed_packages | 42 |
| unassessed_packages | 12 |
| affected_by_severity | moderate 1 |
| direct_affected_packages | 0 |
Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 42 resolved dependencies against OSV. 12 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.
AI Readiness
How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.
52
Agent context & guidance
18Critical
How it's scored
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 18.4/40 | Legible commit history — 21 of 61 human commits state their intent (structured subject or explanatory body) |
Inputs used
| has_llms_txt | no |
| legible_history_share | 0.344 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Verify loop (build / test / typecheck)
64Moderate
How it's scored
| 12.6/18 | One-command bootstrap — samples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj (toolchain convention, no task runner) |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — C# (statically typed) |
| 10/10 | Reproducible environment — devcontainer, Dockerfile |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 8/8 | Automated maintenance — 39 of the last 100 commits are automated dependency updates |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Inputs used
| has_nix | no |
| has_tests | yes |
| lockfiles | — |
| has_dockerfile | yes |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | yes |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | samples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj, samples/MonitorMultipleMailFolders/MonitorMultipleMailFolders.csproj, samples/WebApiExample/WebApiExample.csproj, samples/WorkerServiceExample/WorkerServiceExample.csproj, source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj, source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj, tests/MailKitSimplified.Receiver.Tests/MailKitSimplified.Receiver.Tests.csproj, tests/MailKitSimplified.Sender.Tests/MailKitSimplified.Sender.Tests.csproj |
| dependency_bot_commit_share | 0.39 |
Code legibility for models
100Excellent
How it's scored
| 45/45 | Type-checkable code — C# (statically typed) |
| 55/55 | Manageable file sizes — 0/105 source files over 60KB |
Inputs used
| primary_language | C# |
| largest_source_bytes | 35,241 |
| source_files_sampled | 105 |
| oversized_source_files | 0 |
Machine-readable interfaces
40At risk
How it's scored
| 0/40 | API schema (OpenAPI/GraphQL/proto) |
| 0/20 | MCP server |
| 40/40 | Runnable examples — samples |
Inputs used
| example_dirs | samples |
| has_mcp_signal | no |
| api_schema_files | — |
Key facts
95GitHub stars
4contributors
28commits, last 12 months
21days since last push
36releases
1bus factor
0open issues
—package ecosystems
Data collection warnings
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
More detail
Star and fork history 0 ★ / 13 ⇿
0Stars
13Forks
17Releases
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Major 0Minor 6Patch 11
Each point covers 3 days.
OpenSSF Scorecard 5.1 / 10
5.1aggregate
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 3 | Branch-Protection | branch protection is not maximal on development and all release branches |
| 10 | CI-Tests | 15 out of 15 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/15 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 5 | Maintained | 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| n/a | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 7 | SAST | SAST tool detected but not run on all commits |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Direct dependencies 21
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| NuGet | MailKit | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | MimeKit | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | Microsoft.Extensions.Caching.Memory | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | Microsoft.Extensions.Caching.Abstractions | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | Microsoft.Extensions.Configuration.Abstractions | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | Microsoft.Extensions.Logging | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | Microsoft.Extensions.Options.ConfigurationExtensions | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | System.ComponentModel.Annotations | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | System.IO.Abstractions | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | System.Text.Json | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | Microsoft.Extensions.Logging.Debug | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | Microsoft.Extensions.Logging.Console | — | source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj |
| NuGet | MailKit | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | MimeKit | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | Microsoft.Extensions.Configuration.Abstractions | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | Microsoft.Extensions.Logging | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | Microsoft.Extensions.Options.ConfigurationExtensions | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | System.ComponentModel.Annotations | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | System.IO.Abstractions | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | Microsoft.Extensions.Logging.Debug | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
| NuGet | Microsoft.Extensions.Logging.Console | — | source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj |
All dependencies 54
Full resolved dependency set from the GitHub dependency graph: 16 direct and 38 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| NuGet | MailKit | — | direct |
| NuGet | Microsoft.Extensions.Caching.Abstractions | — | direct |
| NuGet | Microsoft.Extensions.Caching.Memory | — | direct |
| NuGet | Microsoft.Extensions.Configuration.Abstractions | — | direct |
| NuGet | Microsoft.Extensions.Logging | — | direct |
| NuGet | Microsoft.Extensions.Logging | 10.0.3 | direct |
| NuGet | Microsoft.Extensions.Logging.Console | — | direct |
| NuGet | Microsoft.Extensions.Logging.Console | 10.0.3 | direct |
| NuGet | Microsoft.Extensions.Logging.Debug | — | direct |
| NuGet | Microsoft.Extensions.Logging.Debug | 10.0.3 | direct |
| NuGet | Microsoft.Extensions.Options.ConfigurationExtensions | — | direct |
| NuGet | MimeKit | — | direct |
| NuGet | System.ComponentModel.Annotations | — | direct |
| NuGet | System.IO.Abstractions | — | direct |
| NuGet | System.IO.Abstractions | 22.1.0 | direct |
| NuGet | System.Text.Json | — | direct |
| NuGet | Asp.Versioning.Mvc | 8.1.1 | indirect |
| NuGet | Asp.Versioning.Mvc.ApiExplorer | 8.1.1 | indirect |
| NuGet | CommunityToolkit.Common | 8.4.0 | indirect |
| NuGet | CommunityToolkit.Diagnostics | 8.4.0 | indirect |
| NuGet | CommunityToolkit.Mvvm | 8.4.0 | indirect |
| NuGet | coverlet.collector | 10.0.1 | indirect |
| NuGet | CsvHelper | 33.1.0 | indirect |
| NuGet | MailKitSimplified.Receiver | 2.12.0 | indirect |
| NuGet | MailKitSimplified.Sender | 2.12.0 | indirect |
| NuGet | Microsoft.EntityFrameworkCore.Sqlite | 10.0.3 | indirect |
| NuGet | Microsoft.Extensions.Configuration.CommandLine | 10.0.3 | indirect |
| NuGet | Microsoft.Extensions.DependencyInjection.Abstractions | 10.0.3 | indirect |
| NuGet | Microsoft.Extensions.Hosting | 10.0.3 | indirect |
| NuGet | Microsoft.Extensions.Http.Polly | 10.0.3 | indirect |
| NuGet | Microsoft.Extensions.Http.Resilience | 10.3.0 | indirect |
| NuGet | Microsoft.Identity.Web | 4.5.0 | indirect |
| NuGet | Microsoft.NET.Test.Sdk | 18.3.0 | indirect |
| NuGet | Microsoft.VisualStudio.Azure.Containers.Tools.Targets | 1.23.0 | indirect |
| NuGet | Moq | 4.20.72 | indirect |
| NuGet | Newtonsoft.Json | 13.0.4 | indirect |
| NuGet | NSwag.ApiDescription.Client | 14.6.3 | indirect |
| NuGet | OpenTelemetry.Exporter.Console | 1.15.0 | indirect |
| NuGet | OpenTelemetry.Exporter.OpenTelemetryProtocol | 1.15.0 | indirect |
| NuGet | OpenTelemetry.Extensions.Hosting | 1.15.0 | indirect |
| NuGet | OpenTelemetry.Instrumentation.AspNetCore | 1.15.0 | indirect |
| NuGet | OpenTelemetry.Instrumentation.Http | 1.15.0 | indirect |
| NuGet | OpenTelemetry.Instrumentation.Runtime | 1.15.0 | indirect |
| NuGet | Polly | 8.6.6 | indirect |
| NuGet | Polly.Contrib.WaitAndRetry | 1.1.1 | indirect |
| NuGet | Serilog.AspNetCore | 10.0.0 | indirect |
| NuGet | Serilog.Enrichers.Environment | 3.0.1 | indirect |
| NuGet | Serilog.Extensions.Logging | 10.0.0 | indirect |
| NuGet | Serilog.Sinks.Async | 2.1.0 | indirect |
| NuGet | Serilog.Sinks.OpenTelemetry | 4.2.0 | indirect |
| NuGet | Swashbuckle.AspNetCore | 10.1.4 | indirect |
| NuGet | System.IO.Abstractions.TestingHelpers | 22.1.0 | indirect |
| NuGet | xunit.runner.visualstudio | 3.1.5 | indirect |
| NuGet | xunit.v3 | 3.2.2 | indirect |
Dependency advisories 1
This repository publishes no package the index resolves, so its own dependency graph was assessed — 42 packages, which also include development and test pins that never ship: 1 carry known advisories, of which 0 are direct. 12 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list.
| Package | Version | Relation | Severity | Advisories | Fixed in |
|---|---|---|---|---|---|
| OpenTelemetry.Exporter.OpenTelemetryProtocol | 1.15.0 | indirect | moderate | 3 | 1.15.3 |
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Raw JSON report machine-readable
{
"data": {
"repo": {
"topics": [
"email",
"fluent",
"imap",
"mail",
"smtp",
"asynchronous",
"csharp",
"dependency-injection",
"devops-enabled",
"unit-tested",
"imap-client",
"smtp-client",
"email-reader",
"email-receiver",
"email-sender",
"mailer"
],
"is_fork": false,
"size_kb": 1077,
"has_wiki": true,
"homepage": null,
"languages": {
"C#": 380939,
"PowerShell": 1632
},
"pushed_at": "2026-07-04T18:58:49Z",
"created_at": "2022-09-25T14:50:16Z",
"owner_type": "User",
"updated_at": "2026-07-06T07:43:20Z",
"description": "Send and receive emails easily, fluently, with one line of code for each operation.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "C#",
"significant_languages": [
"C#"
]
},
"owner": {
"blog": null,
"name": "Daniel Collingwood",
"type": "User",
"login": "danzuep",
"company": null,
"location": null,
"followers": 24,
"avatar_url": "https://avatars.githubusercontent.com/u/82693586?v=4",
"created_at": "2021-04-17T04:33:12Z",
"is_verified": null,
"public_repos": 41,
"account_age_days": 1925
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v2.13.1",
"kind": "patch",
"published_at": "2026-07-04T18:58:50Z"
},
{
"tag": "v2.13.0",
"kind": "minor",
"published_at": "2026-03-08T12:44:12Z"
},
{
"tag": "v2.12.0",
"kind": "minor",
"published_at": "2025-11-14T02:22:00Z"
},
{
"tag": "v2.11.16",
"kind": "patch",
"published_at": "2025-11-01T13:21:19Z"
},
{
"tag": "v2.11.15",
"kind": "patch",
"published_at": "2025-03-06T16:21:49Z"
},
{
"tag": "v2.11.14",
"kind": "patch",
"published_at": "2025-02-06T00:11:02Z"
},
{
"tag": "v2.11.13",
"kind": "patch",
"published_at": "2024-08-25T03:37:01Z"
},
{
"tag": "v2.11.12",
"kind": "patch",
"published_at": "2024-08-22T14:13:39Z"
},
{
"tag": "v2.11.10",
"kind": "patch",
"published_at": "2024-08-07T17:04:42Z"
},
{
"tag": "v2.11.9",
"kind": "patch",
"published_at": "2024-08-07T14:14:31Z"
},
{
"tag": "v2.10.0",
"kind": "minor",
"published_at": "2024-05-01T10:37:53Z"
},
{
"tag": "v2.9.0",
"kind": "minor",
"published_at": "2023-12-15T01:22:39Z"
},
{
"tag": "v2.8.0",
"kind": "minor",
"published_at": "2023-10-21T15:51:34Z"
},
{
"tag": "v2.7.0",
"kind": "minor",
"published_at": "2023-09-28T02:15:28Z"
},
{
"tag": "v2.6.1",
"kind": "patch",
"published_at": "2023-09-18T14:09:25Z"
},
{
"tag": "v2.5.5",
"kind": "patch",
"published_at": "2023-08-25T14:43:51Z"
},
{
"tag": "v2.5.4",
"kind": "patch",
"published_at": "2023-08-19T16:19:06Z"
},
{
"tag": "v2.5.2",
"kind": "patch",
"published_at": "2023-08-11T14:21:48Z"
},
{
"tag": "v2.5.0",
"kind": "minor",
"published_at": "2023-07-29T17:14:55Z"
},
{
"tag": "v2.4.6",
"kind": "patch",
"published_at": "2023-01-15T13:41:04Z"
},
{
"tag": "v2.4.5",
"kind": "patch",
"published_at": "2023-01-15T09:05:59Z"
},
{
"tag": "v2.4.2",
"kind": "patch",
"published_at": "2023-01-10T23:25:27Z"
},
{
"tag": "v2.4.1",
"kind": "patch",
"published_at": "2023-01-10T23:22:16Z"
},
{
"tag": "v2.4.0",
"kind": "minor",
"published_at": "2022-12-12T03:35:51Z"
},
{
"tag": "v2.3.0",
"kind": "minor",
"published_at": "2022-12-09T10:00:50Z"
},
{
"tag": "v2.2.0",
"kind": "minor",
"published_at": "2022-12-06T16:23:08Z"
},
{
"tag": "v2.1.0",
"kind": "minor",
"published_at": "2022-12-02T05:11:05Z"
},
{
"tag": "v2.0.0",
"kind": "major",
"published_at": "2022-12-01T08:47:58Z"
},
{
"tag": "v1.1.4",
"kind": "patch",
"published_at": "2022-11-25T07:31:08Z"
},
{
"tag": "v1.1.3",
"kind": "patch",
"published_at": "2022-11-24T07:37:55Z"
},
{
"tag": "v1.1.2",
"kind": "patch",
"published_at": "2022-11-21T12:46:09Z"
},
{
"tag": "v1.1.0",
"kind": "minor",
"published_at": "2022-11-17T17:47:02Z"
},
{
"tag": "v1.0.1",
"kind": "patch",
"published_at": "2022-11-16T14:41:33Z"
},
{
"tag": "v0.2.0",
"kind": "minor",
"published_at": "2022-11-12T04:23:14Z"
},
{
"tag": "v0.1.3",
"kind": "patch",
"published_at": "2022-11-11T08:20:49Z"
},
{
"tag": "v0.1.3-beta",
"kind": "prerelease",
"published_at": "2022-11-11T05:29:16Z"
}
],
"recent_commits": [
{
"oid": "57416fa62b20b3b0a33bb474b59277b6ac45b572",
"body": "Bumps [actions/cache](https://github.com/actions/cache) from 3 to 6.\n- [Release notes](https://github.com/actions/cache/releases)\n- [Changelog](https://github.com/actions/cache/blob/main/RELEASES.md)\n- [Commits](https://github.com/actions/cache/compare/v3...v6)\n\n---\nupdated-dependencies:\n- dependency-name: actions/cache\n dependency-version: '6'\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump actions/cache from 3 to 6",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-07-02T14:52:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "81c8e930506e2bfe70b7935a7d8d4b908202a495",
"body": "Bumps MailKit from 4.15.1 to 4.17.0\nBumps MimeKit from 4.15.1 to 4.17.0\n\n---\nupdated-dependencies:\n- dependency-name: MailKit\n dependency-version: 4.17.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n- dependency-name: MimeKit\n dependency-version: 4.17.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump MailKit and MimeKit",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-07-02T14:51:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "68cbb1b9247c3cd02a1a22e813b0d2957f0f87e6",
"body": "Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 3 to 7.\n- [Release notes](https://github.com/actions/upload-artifact/releases)\n- [Commits](https://github.com/actions/upload-artifact/compare/v3...v7)\n\n---\nupdated-dependencies:\n- dependency-name: actions/upload-artifact\n dependency-version: '7'\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump actions/upload-artifact from 3 to 7",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-06-01T16:19:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "43acf9e3959b5fbfeb5ee137a28f2e0610db555e",
"body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n dependency-version: 10.0.1\n dependency-type: direct:production\n update-type: version-update:semver-patch\n- dependency-name: coverlet.collector\n dependency-version: 10.0.1\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump coverlet.collector from 10.0.0 to 10.0.1",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-06-01T16:17:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "51396a672dd2f20d67b6d4cd387015a6319df16a",
"body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.4 to 3.0.4.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.4...\n[…]\nocchino/sticky-pull-request-comment\n dependency-version: 3.0.4\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump marocchino/sticky-pull-request-comment from 2.9.4 to 3.0.4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-05-01T04:41:53Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "71cd1c44ddaa315756d0cbc4277ff99ff8429ef3",
"body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n dependency-version: 10.0.0\n dependency-type: direct:production\n update-type: version-update:semver-major\n- dependency-name: coverlet.collector\n dependency-version: 10.0.0\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump coverlet.collector from 8.0.1 to 10.0.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-05-01T04:41:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c79e6293f3e178ea164a04110b7dbf88fe6f7c75",
"body": "Bumps [actions/setup-dotnet](https://github.com/actions/setup-dotnet) from 3 to 5.\n- [Release notes](https://github.com/actions/setup-dotnet/releases)\n- [Commits](https://github.com/actions/setup-dotnet/compare/v3...v5)\n\n---\nupdated-dependencies:\n- dependency-name: actions/setup-dotnet\n dependency-version: '5'\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump actions/setup-dotnet from 3 to 5",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-04-01T01:29:52Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6ac3a44d43aa8a8b0025ee03f9a01266deb1d2aa",
"body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n dependency-version: 8.0.1\n dependency-type: direct:production\n update-type: version-update:semver-patch\n- dependency-name: coverlet.collector\n dependency-version: 8.0.1\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump coverlet.collector from 8.0.0 to 8.0.1",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-04-01T01:29:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "50dc64b420f2a467f2d8d4824e9e34e8cba5bc5c",
"body": "Calls to methods which accept CancellationToken should use TestContext.Current.CancellationToken to allow test cancellation to be more responsive. (https://xunit.net/xunit.analyzers/rules/xUnit1051)",
"is_bot": false,
"headline": "Add TestContext.Current.CancellationToken for unit tests",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2026-03-08T12:49:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "920e26661d04de14286ec921fd4f709599628668",
"body": "…P command injection) #105",
"is_bot": false,
"headline": "Bump MimeKit minimum version to 4.15.1 to address CVE-2026-30227 (SMT…",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2026-03-08T12:29:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fe5804e814a05b824181610a545b6b42eae46af7",
"body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 0 to 4.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/commits/v4)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n dependency-version: '4'\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump gittools/actions from 0 to 4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-01T03:36:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2c9e2ad554c3e7e79fd30342a830cc139971b3db",
"body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n dependency-version: 8.0.0\n dependency-type: direct:production\n update-type: version-update:semver-major\n- dependency-name: coverlet.collector\n dependency-version: 8.0.0\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump coverlet.collector from 6.0.4 to 8.0.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-01T03:35:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c7ba306969928cb6e151092b7fcd18983c54cb62",
"body": null,
"is_bot": false,
"headline": "Merge branch 'main' of https://github.com/danzuep/MailKitSimplified",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2026-02-27T15:05:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7a37266003b997b93a3e8dc1b976eaf8fc0588fc",
"body": null,
"is_bot": false,
"headline": "Added HostBuilderExtensions",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2026-02-27T15:04:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bffe4e1186b49738c8ade2983059047f675b31e5",
"body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.3 to 2.9.4.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.3...\n[…]\nocchino/sticky-pull-request-comment\n dependency-version: 2.9.4\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump marocchino/sticky-pull-request-comment from 2.9.3 to 2.9.4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-02-02T16:25:28Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "b186b3a1c01710ee25aec14920d2aa26b2383ae0",
"body": null,
"is_bot": false,
"headline": "Added full configuration for OpenTelemetry",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2026-02-02T16:22:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fe51bec484355916e1202e6c90cfa7411d217f30",
"body": "Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 3 to 7.\n- [Release notes](https://github.com/actions/download-artifact/releases)\n- [Commits](https://github.com/actions/download-artifact/compare/v3...v7)\n\n---\nupdated-dependencies:\n- dependency-name: actions/download-artifact\n dependency-version: '7'\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump actions/download-artifact from 3 to 7",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-01-31T06:26:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca84855eae4fb67643cd25b39ee7796ca0b6dd99",
"body": null,
"is_bot": false,
"headline": "Added example appsettings.serilog.json with OpenTelemetry",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2026-01-14T00:46:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a511577c3e571d2dee94533c91d6f05d7b1ad8bf",
"body": null,
"is_bot": false,
"headline": "Bumped all packages to their latest versions",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2026-01-14T00:13:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "675a702f612debda8f51f6b1b82b9d4cc81f88e1",
"body": "Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3 to 4.\n- [Release notes](https://github.com/github/codeql-action/releases)\n- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)\n- [Commits](https://github.com/github/codeql-action/compare/v3...v4)\n\n-\n[…]\ndependency-name: github/codeql-action\n dependency-version: '4'\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump github/codeql-action from 3 to 4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-12-01T05:09:03Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "6e58da0fb28b026208ca86628dd95c9677b79c76",
"body": null,
"is_bot": false,
"headline": "Added DefaultLogger for demo and updated dependencies",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-11-23T13:47:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "726cc0b6f1f8fc0fc1fc66e86e8e0a1687bdd5df",
"body": null,
"is_bot": false,
"headline": "Updated to .NET 10",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-11-14T02:13:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "84a2cb685783d7aee7200ce9d9cbac4a9663c8fb",
"body": null,
"is_bot": false,
"headline": "Separated versioning workflow",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-11-01T13:19:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5c1a746c746d50791f2f2385dcbe77d5ade75c55",
"body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.2.1 to 4.1.0.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Changelog](https://github.com/GitTools/actions/blob/main/GitReleaseManager.yml)\n- [Commits](https://github.com/gittools/actions/compare/v3.2.1...v4.1.0)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n dependency-version: 4.1.0\n dependency-type: direct:production\n update-type: version-update:semver-major\n...",
"is_bot": true,
"headline": "Bump gittools/actions from 3.2.1 to 4.1.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-11-01T13:15:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa07ac7baa342341fc1e786a8bb71f8887847c46",
"body": null,
"is_bot": false,
"headline": "Updated all packages to the latest versions",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-11-01T07:34:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f1945cf92e06ce3feb2be95a4ec09df1dc2b68b7",
"body": null,
"is_bot": false,
"headline": "Migrated from Microsoft.AspNetCore.Mvc to Asp.Versioning",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-11-01T07:33:47Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e07fae7bb5dc1fba8cd2a730791f5e6bae145c0f",
"body": null,
"is_bot": false,
"headline": "Package versions updated to latest",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-07-29T04:29:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a3b78127534f4550bfc4dfc21300368ff9bfe356",
"body": null,
"is_bot": false,
"headline": "Simplified way of reading Options sections",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-07-29T04:29:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2abb804461bf4f6db2baf176b649ba95fb1aae41",
"body": "Bumps MailKit from 4.10.0 to 4.13.0\nBumps Microsoft.Extensions.Caching.Abstractions from 9.0.2 to 9.0.6\nBumps Microsoft.Extensions.Caching.Memory from 9.0.2 to 9.0.6\nBumps Microsoft.Extensions.Configuration.Abstractions from 9.0.2 to 9.0.6\nBumps Microsoft.Extensions.Logging to 9.0.6\nBumps Microsoft.\n[…]\nncy-name: xunit.runner.visualstudio\n dependency-version: 3.1.1\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump MailKit and 13 others",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-07-22T05:38:05Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "810de9723a6b6cf7df99bf41e7325610c9bfa2b8",
"body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.2 to 2.9.3.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.2...\n[…]\nocchino/sticky-pull-request-comment\n dependency-version: 2.9.3\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump marocchino/sticky-pull-request-comment from 2.9.2 to 2.9.3",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-07-22T05:37:09Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "acbd23712c7a85ac38560db3484cea00e38caec0",
"body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.1.11 to 3.2.1.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Changelog](https://github.com/GitTools/actions/blob/main/GitReleaseManager.yml)\n- [Commits](https://github.com/gittools/actions/compare/v3.1.11...v3.\n[…]\n- dependency-name: gittools/actions\n dependency-version: 3.2.1\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump gittools/actions from 3.1.11 to 3.2.1",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-06-01T16:27:45Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "26fc94b8ce48bb470b88d823b344a17cbb13ffb3",
"body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.1 to 2.9.2.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.1...\n[…]\nocchino/sticky-pull-request-comment\n dependency-version: 2.9.2\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump marocchino/sticky-pull-request-comment from 2.9.1 to 2.9.2",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-05T11:53:00Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "82fc7274144e22fcc934a7a183f33a1e152b7154",
"body": "Bumps [MimeKit](https://github.com/jstedfast/MimeKit) from 4.10.0 to 4.12.0.\n- [Changelog](https://github.com/jstedfast/MimeKit/blob/master/ReleaseNotes.md)\n- [Commits](https://github.com/jstedfast/MimeKit/compare/4.10.0...4.12.0)\n\n---\nupdated-dependencies:\n- dependency-name: MimeKit\n dependency-version: 4.12.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump MimeKit from 4.10.0 to 4.12.0 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-05T11:52:44Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8817617cfe414f0de650b5698368bb19329a112e",
"body": "Bumps [System.IO.Abstractions.TestingHelpers](https://github.com/TestableIO/System.IO.Abstractions) from 22.0.10 to 22.0.12.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v22.0.10...v22.0.12)\n\n[…]\nem.IO.Abstractions.TestingHelpers\n dependency-version: 22.0.12\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump System.IO.Abstractions.TestingHelpers in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-04-03T03:02:06Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "09da07d6167da0b0855daa349aa20473364162ef",
"body": null,
"is_bot": false,
"headline": "GitVersion 6 removed NuGetVersion",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-07T01:11:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5a27ea422b5760fcba94be7cbe7c001b4f796cfb",
"body": null,
"is_bot": false,
"headline": "#63 Monitoring multiple mailboxes fixed",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-06T16:16:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1c261af1870221a790aa519bc2d05a2f6abad613",
"body": "…ding flags",
"is_bot": false,
"headline": "#63 replicated the issues when monitoring multiple mail folders or ad…",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-06T16:16:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d9faf9cb2c39e1c80d340b05234690aed2d05234",
"body": null,
"is_bot": false,
"headline": "Add a Dev Container for Visual Studio Code",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-01T06:54:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f996b258114ffaffaf29ee005f3e94ddf3d250df",
"body": null,
"is_bot": false,
"headline": "Update all sample package versions to latest",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-01T06:53:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e26ed3cf948cf382075f8b0a68f685e03adfedf2",
"body": null,
"is_bot": false,
"headline": "Updated gitversion to version 6",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-01T06:50:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "48d4121d298878d89a0b33de0b59f882be418c99",
"body": "…ry.Packages.props",
"is_bot": false,
"headline": "Use central package management by setting package versions in Directo…",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-01T06:25:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c8591cd78754ef0b1a62cc56c6ca2db6cb094694",
"body": "…t files",
"is_bot": false,
"headline": "Moved PackageReferences from Directory.Build.targets back into projec…",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-03-01T03:28:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c0a3acb67ecd95d9a00a083620379fcc0e53e31",
"body": "Bumps [System.IO.Abstractions](https://github.com/TestableIO/System.IO.Abstractions) from 21.3.1 to 22.0.10.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v21.3.1...v22.0.10)\n\n---\nupdated-dependencies:\n- dependency-name: System.IO.Abstractions\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump System.IO.Abstractions from 21.3.1 to 22.0.10 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-03-01T03:28:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7a3802f2ab5824523ad5bc710826f9749692758a",
"body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.0.3 to 3.1.11.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Changelog](https://github.com/GitTools/actions/blob/main/GitReleaseManager.yml)\n- [Commits](https://github.com/gittools/actions/compare/v3.0.3...v3.1\n[…]\n\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump gittools/actions from 3.0.3 to 3.1.11",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-02-06T00:08:47Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "23201e932097605e2f26892cb9db1eb67a8e22b9",
"body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.0 to 2.9.1.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.0...\n[…]\ncies:\n- dependency-name: marocchino/sticky-pull-request-comment\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump marocchino/sticky-pull-request-comment from 2.9.0 to 2.9.1",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-02-06T00:05:07Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "da07f6c659485d372052957e94c38f067f67a1b2",
"body": null,
"is_bot": false,
"headline": "Updated Directory.Build.props package versions",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-02-05T14:23:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c987d9a2d942107d35524376106d5dea4368f39b",
"body": null,
"is_bot": false,
"headline": "Updated packages",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2025-02-05T14:10:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e5fa9288558380e3ce4d008bd8c84a35a48c1453",
"body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.0.0 to 3.0.3.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/compare/v3.0.0...v3.0.3)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump gittools/actions from 3.0.0 to 3.0.3",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-12-01T22:33:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7b8ad6d6639fc09c55a39d47cafda77aaee51810",
"body": "Bumps [System.Text.Json](https://github.com/dotnet/runtime) from 8.0.4 to 9.0.0.\n- [Release notes](https://github.com/dotnet/runtime/releases)\n- [Commits](https://github.com/dotnet/runtime/compare/v8.0.4...v9.0.0)\n\n---\nupdated-dependencies:\n- dependency-name: System.Text.Json\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump System.Text.Json from 8.0.4 to 9.0.0 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-12-01T22:32:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7077a43ae9ae729bb09b73e5f7e2f643edcb8ad3",
"body": "…Caching.Memory and System.ComponentModel.Annotations\n\nBumps [Microsoft.Extensions.Caching.Abstractions](https://github.com/dotnet/runtime), [Microsoft.Extensions.Caching.Memory](https://github.com/dotnet/runtime) and [System.ComponentModel.Annotations](https://github.com/dotnet/runtime). These depe\n[…]\nmver-major\n- dependency-name: System.ComponentModel.Annotations\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump Microsoft.Extensions.Caching.Abstractions, Microsoft.Extensions.…",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-11-25T23:14:40Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "54d53b622d80938065496121baa1972c85c49f6c",
"body": null,
"is_bot": false,
"headline": "AddWithLifetime",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-11-07T15:24:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6efdff9ebb5f8b733cb3705abe478706880f7e51",
"body": "Bumps [MailKit](https://github.com/jstedfast/MailKit) and [MimeKit](https://github.com/jstedfast/MimeKit). These dependencies needed to be updated together.\n\nUpdates `MailKit` from 4.7.1.1 to 4.8.0\n- [Changelog](https://github.com/jstedfast/MailKit/blob/master/ReleaseNotes.md)\n- [Commits](https://gi\n[…]\nte-type: version-update:semver-minor\n- dependency-name: MimeKit\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump MailKit and MimeKit in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-11-01T13:08:17Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "d94a578e0ded9a691b5a7e0fd979709626f0f323",
"body": "Bumps [xunit](https://github.com/xunit/xunit) from 2.9.1 to 2.9.2.\n- [Commits](https://github.com/xunit/xunit/compare/v2-2.9.1...v2-2.9.2)\n\n---\nupdated-dependencies:\n- dependency-name: xunit\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump xunit from 2.9.1 to 2.9.2 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-10-09T00:48:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3b856bd07d0ea67e60839e225cfa6a47ae7c61ae",
"body": null,
"is_bot": false,
"headline": "added login textboxes",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-25T01:16:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1ec821fd4511d67e3e3df8e368129595b34bd492",
"body": null,
"is_bot": false,
"headline": "#76 moved unused Generic library to branch",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-25T01:11:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9d713d49d0059605eabbd554ccb308e29bd41c76",
"body": null,
"is_bot": false,
"headline": "updated package versions",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-25T00:27:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d4ffb8c63a172767377c583f1d77bee81a82299b",
"body": null,
"is_bot": false,
"headline": "missing optional bool in test",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-23T17:18:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2a8f23ad2ecad4182ac15079394faafa8eee0bf3",
"body": null,
"is_bot": false,
"headline": "#72 added an option to force a reconnection attempt",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-23T16:24:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "789a4d695e2dabeaa6c57db5982632dfab656b9f",
"body": null,
"is_bot": false,
"headline": "Added ToExponentialBackoff for failures",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-09T01:03:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0b3ddf01c27a724834b8882519da5653390df211",
"body": null,
"is_bot": false,
"headline": "#72 fix cancellation token disposed exception",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-08T13:59:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0d0c18c4b0369e355aa24a663923308824f518fc",
"body": "Removed double link.",
"is_bot": false,
"headline": "Update README.md",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-09-03T11:56:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6bc82dd5f9e344031f35903a97c62e52c5b9d44a",
"body": "Bumps [Microsoft.NET.Test.Sdk](https://github.com/microsoft/vstest) from 17.10.0 to 17.11.0.\n- [Release notes](https://github.com/microsoft/vstest/releases)\n- [Changelog](https://github.com/microsoft/vstest/blob/main/docs/releases.md)\n- [Commits](https://github.com/microsoft/vstest/compare/v17.10.0.\n[…]\nupdated-dependencies:\n- dependency-name: Microsoft.NET.Test.Sdk\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump Microsoft.NET.Test.Sdk from 17.10.0 to 17.11.0 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-09-01T09:04:12Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "cbbd242fd42e9fad234eb9bb85949db41b934dae",
"body": null,
"is_bot": false,
"headline": "#72 fixed alt idle task initialization",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-27T00:28:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9a0b34d704b05937af304175e7d824100cfa51a9",
"body": null,
"is_bot": false,
"headline": "#72 added option to disable exception handling on idle client",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-25T03:23:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b5577df9107621e6327ff374246a0dd42fe51cf0",
"body": null,
"is_bot": false,
"headline": "#73 re-read flag change email before returning it",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-23T00:21:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "dd31382c808f15c4dd38bb88e9c46ac83860d487",
"body": null,
"is_bot": false,
"headline": "#73 Add a handler for the IMailFolder.MessageFlagsChanged event",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-22T14:11:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7b4b1fc04f59b7b546c23a9ab028d020e75adbff",
"body": null,
"is_bot": false,
"headline": "#72 removed cancel from move",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-21T14:19:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e881f9b3efe92d3d697358e53c3ab912a43a59b7",
"body": null,
"is_bot": false,
"headline": "#72 added SocketException reconnect retry",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-10T16:49:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "087f638b878017318efea39051958c3d0f130f27",
"body": null,
"is_bot": false,
"headline": "#72 added retry to arrival and departure queues",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-07T17:01:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2575e8b0e971e4456d3d8e3dc4b7ab95be996aa5",
"body": null,
"is_bot": false,
"headline": "#72 changed error to a warning",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-07T15:55:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d03f07a33eaf897fbcc7c1bfa13063193db4e0c9",
"body": null,
"is_bot": false,
"headline": "Fixed cached source folder in move method #70",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-05T17:23:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0acdd14812a5bf7139ebbf51df6e1b4a97c49df",
"body": null,
"is_bot": false,
"headline": "Removed MailFolderCache",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-01T15:36:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "173e5008b2eaab0439fe6af1e022e3fd471fd7c7",
"body": null,
"is_bot": false,
"headline": "GetFolderAsync with createIfNotFound option",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-01T15:25:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4abe3f37c11f4b37f84ee4413f44f3d0c14f7160",
"body": "….Top and Range to use int.",
"is_bot": false,
"headline": "#70 simplified the internal move methods. Also simplified IMailReader…",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-08-01T14:59:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "10ade21c497a00992287abc384cbe0392cebee3f",
"body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 1.1.1 to 3.0.0.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/compare/v1.1.1...v3.0.0)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump gittools/actions from 1.1.1 to 3.0.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-08-01T01:40:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e7cacc0ebe6cb82561448e172433c81cea962162",
"body": null,
"is_bot": false,
"headline": "#70 fix null source folder",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-07-30T16:42:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ae5ecea08b18cc4044bf6e23edef6c0081b23d39",
"body": "Bumps [System.IO.Abstractions](https://github.com/TestableIO/System.IO.Abstractions) from 21.0.2 to 21.0.22.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v21.0.2...v21.0.22)\n\n---\nupdated-dependencies:\n- dependency-name: System.IO.Abstractions\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump System.IO.Abstractions from 21.0.2 to 21.0.22 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-07-30T16:41:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4639d560d28db2c078a86c388f6844944e5dcc1e",
"body": null,
"is_bot": false,
"headline": "Clean up for #63, part 2",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-22T15:10:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bb33f9f5ae93290e1750ef1d781653f60cd1114e",
"body": null,
"is_bot": false,
"headline": "Fixed tests",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-22T08:06:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8e803f7bb4c7e83fe5e564494391e5de4f762567",
"body": null,
"is_bot": false,
"headline": "Fixed MoveToAsync for #68",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-22T07:13:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9eac41196b35c24c96635571d50da846026a57bc",
"body": null,
"is_bot": false,
"headline": "Improved GetMailFolderNamesAsync for #68",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-22T06:23:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9b2ad4eff29e3e65c7612b1a01bd62cfc2bad774",
"body": null,
"is_bot": false,
"headline": "Bug fixes for #63, part 1",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-19T17:11:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "256569b5b5d9a023328e38418d246df959a7e051",
"body": null,
"is_bot": false,
"headline": "Updated sample to use _mailFolderCache.GetMailFolderAsync",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-10T07:02:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2b3c3e185f32811f4b14da5d4d15a04e78738a00",
"body": null,
"is_bot": false,
"headline": "Added MailFolderCache",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-10T01:35:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b5ca1539cc7d25e63c71c2157897fa06b8c9dd7d",
"body": null,
"is_bot": false,
"headline": "Added AddWithLifetime for services",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-06-10T01:34:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e4218e55cb51de7b0da720f1bbd07271a738b488",
"body": "Bumps [xunit](https://github.com/xunit/xunit) from 2.8.0 to 2.8.1.\n- [Commits](https://github.com/xunit/xunit/compare/2.8.0...2.8.1)\n\n---\nupdated-dependencies:\n- dependency-name: xunit\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump xunit from 2.8.0 to 2.8.1 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-06-01T06:49:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ce6f0c70e2195361260a6d7837343106cfa9a58b",
"body": null,
"is_bot": false,
"headline": "Removed MemoryCache from ImapReceiverFactory",
"author_name": "Sylar-A",
"author_login": "Sylar-A",
"committed_at": "2024-05-25T09:19:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f0a191510082e86d3b39e6b53d3f74b4eb998401",
"body": "…c to MailFolderClient.MoveToAsync",
"is_bot": false,
"headline": "Renamed GetOrCreateFolderAsync and moved IImapReceiver.MoveToSentAsyn…",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-05-17T00:38:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c4e724534dd5f652820f0b5a0686d7de55bec8bc",
"body": null,
"is_bot": false,
"headline": "Added GetOrCreateMailFolderAsync()",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-05-16T14:30:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "315be469d8d74c399985f54b90481a7eec788def",
"body": null,
"is_bot": false,
"headline": "Made GetOrCreateSubfolderAsync an extension of IMailFolder",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-05-16T00:58:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "abe85950199b690002bdb0e1448f4f3e65e9bd5f",
"body": null,
"is_bot": false,
"headline": "Added GetOrCreateSubfolderAsync to MailFolderClient",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-05-16T00:48:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4680ab7afd2edb8468e2bcc692448ca5b1815d84",
"body": null,
"is_bot": false,
"headline": "Removed net6.0 and net7.0 from TargetFrameworks",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-05-01T10:33:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1edfae8bd4251aa5b29defd3d15667c0d1b7a44f",
"body": null,
"is_bot": false,
"headline": "Updated all packages to latest versions",
"author_name": "Daniel Collingwood",
"author_login": "danzuep",
"committed_at": "2024-05-01T10:33:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bbc3acc2169ca77437584e22ce7136826cc4410d",
"body": "Bumps [System.IO.Abstractions](https://github.com/TestableIO/System.IO.Abstractions) from 20.0.15 to 21.0.2.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v20.0.15...v21.0.2)\n\n---\nupdated-dependencies:\n- dependency-name: System.IO.Abstractions\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump System.IO.Abstractions from 20.0.15 to 21.0.2 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-05-01T10:33:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bd3eaee6f5059a91679b82530d18702a74c987e9",
"body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.8.0 to 2.9.0.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.8.0...\n[…]\ncies:\n- dependency-name: marocchino/sticky-pull-request-comment\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump marocchino/sticky-pull-request-comment from 2.8.0 to 2.9.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-05-01T10:08:33Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "03fc4a0711c82683e18395eafcf42961b82a89cf",
"body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 0.10.2 to 1.1.1.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/compare/v0.10.2...v1.1.1)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump gittools/actions from 0.10.2 to 1.1.1",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-18T14:51:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6ed4cb55450f01705d2de41c1b793f1e118ea8e3",
"body": "Bumps [System.IO.Abstractions.TestingHelpers](https://github.com/TestableIO/System.IO.Abstractions) from 20.0.4 to 21.0.2.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v20.0.4...v21.0.2)\n\n---\n[…]\nncies:\n- dependency-name: System.IO.Abstractions.TestingHelpers\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump System.IO.Abstractions.TestingHelpers in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-18T14:50:03Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "f9dae53dc5de6c937ffba6d0815e14754c0d60d1",
"body": "Bumps [github/codeql-action](https://github.com/github/codeql-action) from 2 to 3.\n- [Release notes](https://github.com/github/codeql-action/releases)\n- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)\n- [Commits](https://github.com/github/codeql-action/compare/v2...v3)\n\n-\n[…]\n-\nupdated-dependencies:\n- dependency-name: github/codeql-action\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump github/codeql-action from 2 to 3",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-02T16:02:22Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "b0dd51250877143a5738a53398d98e608cb3d6ff",
"body": "Bumps [coverlet.collector](https://github.com/coverlet-coverage/coverlet) from 6.0.0 to 6.0.1.\n- [Release notes](https://github.com/coverlet-coverage/coverlet/releases)\n- [Commits](https://github.com/coverlet-coverage/coverlet/compare/v6.0.0...v6.0.1)\n\n---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n dependency-type: direct:production\n update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump coverlet.collector from 6.0.0 to 6.0.1 in /source",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-02T16:01:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3fef0c485aeb06deb91247914e2a181d847cd0e0",
"body": "Bumps [actions/cache](https://github.com/actions/cache) from 3 to 4.\n- [Release notes](https://github.com/actions/cache/releases)\n- [Changelog](https://github.com/actions/cache/blob/main/RELEASES.md)\n- [Commits](https://github.com/actions/cache/compare/v3...v4)\n\n---\nupdated-dependencies:\n- dependency-name: actions/cache\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump actions/cache from 3 to 4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-02-01T03:52:52Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 36,
"commits_last_year": 28,
"latest_release_at": "2026-07-04T18:58:50Z",
"latest_release_tag": "v2.13.1",
"releases_from_tags": false,
"days_since_last_push": 21,
"active_weeks_last_year": 16,
"days_since_latest_release": 21,
"mean_days_between_releases": 77.4
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 42,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "MailKitSimplified.Sender",
"exists": true,
"license": null,
"keywords": [
"SMTP",
"MailKit",
"email",
"sender",
"send",
"simply",
"easily",
"simple",
"easy",
"fluent",
"C#",
".NET"
],
"ecosystem": "nuget",
"matches_repo": true,
"registry_url": "https://www.nuget.org/packages/MailKitSimplified.Sender",
"is_deprecated": false,
"latest_version": "2.13.1",
"repository_url": "https://github.com/danzuep/MailKitSimplified",
"versions_count": 45,
"total_downloads": 80196,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": null,
"first_published_at": null,
"latest_published_at": "2026-07-04T19:00:06.510000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 21
},
{
"name": "MailKitSimplified.Receiver",
"exists": true,
"license": null,
"keywords": [
"IMAP",
"MailKit",
"email",
"receiver",
"receive",
"forward",
"reply",
"simply",
"easily",
"simple",
"easy",
"fluent",
"C#",
".NET"
],
"ecosystem": "nuget",
"matches_repo": true,
"registry_url": "https://www.nuget.org/packages/MailKitSimplified.Receiver",
"is_deprecated": false,
"latest_version": "2.13.1",
"repository_url": "https://github.com/danzuep/MailKitSimplified",
"versions_count": 34,
"total_downloads": 47404,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": null,
"first_published_at": null,
"latest_published_at": "2026-07-04T19:00:06.107000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 21
}
]
},
"popularity": {
"forks": 13,
"stars": 95,
"watchers": 4,
"fork_history": {
"days": [
{
"date": "2023-04-05",
"count": 1
},
{
"date": "2023-07-08",
"count": 1
},
{
"date": "2023-07-31",
"count": 1
},
{
"date": "2023-10-23",
"count": 1
},
{
"date": "2023-10-24",
"count": 1
},
{
"date": "2023-12-01",
"count": 1
},
{
"date": "2023-12-18",
"count": 1
},
{
"date": "2024-05-24",
"count": 1
},
{
"date": "2024-08-04",
"count": 1
},
{
"date": "2024-09-02",
"count": 1
},
{
"date": "2025-08-26",
"count": 1
},
{
"date": "2025-10-19",
"count": 1
},
{
"date": "2025-12-09",
"count": 1
}
],
"complete": true,
"collected": 13,
"total_forks": 13
},
"star_history": null,
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"samples"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": true,
"typecheck_configs": [],
"toolchain_manifests": [
"samples/ConsoleServiceExample/ConsoleServiceExample.csproj",
"samples/EmailWpfApp/EmailWpfApp.csproj",
"samples/ExporterExample/ExporterExample.csproj",
"samples/MonitorMultipleMailFolders/MonitorMultipleMailFolders.csproj",
"samples/WebApiExample/WebApiExample.csproj",
"samples/WorkerServiceExample/WorkerServiceExample.csproj",
"source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"tests/MailKitSimplified.Receiver.Tests/MailKitSimplified.Receiver.Tests.csproj",
"tests/MailKitSimplified.Sender.Tests/MailKitSimplified.Sender.Tests.csproj"
],
"largest_source_bytes": 35241,
"source_files_sampled": 105,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [],
"advisories": {
"error": null,
"scope": "repository_graph",
"source": "osv",
"findings": [
{
"name": "OpenTelemetry.Exporter.OpenTelemetryProtocol",
"direct": false,
"version": "1.15.0",
"severity": "moderate",
"ecosystem": "nuget",
"cvss_score": 6.5,
"advisory_ids": [
"GHSA-4625-4j76-fww9",
"GHSA-mr8r-92fq-pj8p",
"GHSA-q834-8qmm-v933"
],
"fixed_version": "1.15.3",
"advisory_count": 3,
"oldest_advisory_days": 93
}
],
"collected": true,
"malicious": [],
"truncated": false,
"by_severity": {
"moderate": 1
},
"advisory_count": 3,
"affected_count": 1,
"assessed_count": 42,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 12,
"direct_affected_count": 0
},
"ecosystems": [],
"dependencies": [
{
"name": "MailKit",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "MimeKit",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Caching.Memory",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Caching.Abstractions",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Configuration.Abstractions",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Logging",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Options.ConfigurationExtensions",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "System.ComponentModel.Annotations",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "System.IO.Abstractions",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "System.Text.Json",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Logging.Debug",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Logging.Console",
"manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "MailKit",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "MimeKit",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Configuration.Abstractions",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Logging",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Options.ConfigurationExtensions",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "System.ComponentModel.Annotations",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "System.IO.Abstractions",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Logging.Debug",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
},
{
"name": "Microsoft.Extensions.Logging.Console",
"manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"ecosystem": "nuget",
"version_constraint": null
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "MailKit",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Caching.Abstractions",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Caching.Memory",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Configuration.Abstractions",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Logging",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Logging",
"direct": true,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Logging.Console",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Logging.Console",
"direct": true,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Logging.Debug",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Logging.Debug",
"direct": true,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Options.ConfigurationExtensions",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "MimeKit",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "System.ComponentModel.Annotations",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "System.IO.Abstractions",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "System.IO.Abstractions",
"direct": true,
"version": "22.1.0",
"ecosystem": "nuget"
},
{
"name": "System.Text.Json",
"direct": true,
"version": null,
"ecosystem": "nuget"
},
{
"name": "Asp.Versioning.Mvc",
"direct": false,
"version": "8.1.1",
"ecosystem": "nuget"
},
{
"name": "Asp.Versioning.Mvc.ApiExplorer",
"direct": false,
"version": "8.1.1",
"ecosystem": "nuget"
},
{
"name": "CommunityToolkit.Common",
"direct": false,
"version": "8.4.0",
"ecosystem": "nuget"
},
{
"name": "CommunityToolkit.Diagnostics",
"direct": false,
"version": "8.4.0",
"ecosystem": "nuget"
},
{
"name": "CommunityToolkit.Mvvm",
"direct": false,
"version": "8.4.0",
"ecosystem": "nuget"
},
{
"name": "coverlet.collector",
"direct": false,
"version": "10.0.1",
"ecosystem": "nuget"
},
{
"name": "CsvHelper",
"direct": false,
"version": "33.1.0",
"ecosystem": "nuget"
},
{
"name": "MailKitSimplified.Receiver",
"direct": false,
"version": "2.12.0",
"ecosystem": "nuget"
},
{
"name": "MailKitSimplified.Sender",
"direct": false,
"version": "2.12.0",
"ecosystem": "nuget"
},
{
"name": "Microsoft.EntityFrameworkCore.Sqlite",
"direct": false,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Configuration.CommandLine",
"direct": false,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.DependencyInjection.Abstractions",
"direct": false,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Hosting",
"direct": false,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Http.Polly",
"direct": false,
"version": "10.0.3",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Extensions.Http.Resilience",
"direct": false,
"version": "10.3.0",
"ecosystem": "nuget"
},
{
"name": "Microsoft.Identity.Web",
"direct": false,
"version": "4.5.0",
"ecosystem": "nuget"
},
{
"name": "Microsoft.NET.Test.Sdk",
"direct": false,
"version": "18.3.0",
"ecosystem": "nuget"
},
{
"name": "Microsoft.VisualStudio.Azure.Containers.Tools.Targets",
"direct": false,
"version": "1.23.0",
"ecosystem": "nuget"
},
{
"name": "Moq",
"direct": false,
"version": "4.20.72",
"ecosystem": "nuget"
},
{
"name": "Newtonsoft.Json",
"direct": false,
"version": "13.0.4",
"ecosystem": "nuget"
},
{
"name": "NSwag.ApiDescription.Client",
"direct": false,
"version": "14.6.3",
"ecosystem": "nuget"
},
{
"name": "OpenTelemetry.Exporter.Console",
"direct": false,
"version": "1.15.0",
"ecosystem": "nuget"
},
{
"name": "OpenTelemetry.Exporter.OpenTelemetryProtocol",
"direct": false,
"version": "1.15.0",
"ecosystem": "nuget"
},
{
"name": "OpenTelemetry.Extensions.Hosting",
"direct": false,
"version": "1.15.0",
"ecosystem": "nuget"
},
{
"name": "OpenTelemetry.Instrumentation.AspNetCore",
"direct": false,
"version": "1.15.0",
"ecosystem": "nuget"
},
{
"name": "OpenTelemetry.Instrumentation.Http",
"direct": false,
"version": "1.15.0",
"ecosystem": "nuget"
},
{
"name": "OpenTelemetry.Instrumentation.Runtime",
"direct": false,
"version": "1.15.0",
"ecosystem": "nuget"
},
{
"name": "Polly",
"direct": false,
"version": "8.6.6",
"ecosystem": "nuget"
},
{
"name": "Polly.Contrib.WaitAndRetry",
"direct": false,
"version": "1.1.1",
"ecosystem": "nuget"
},
{
"name": "Serilog.AspNetCore",
"direct": false,
"version": "10.0.0",
"ecosystem": "nuget"
},
{
"name": "Serilog.Enrichers.Environment",
"direct": false,
"version": "3.0.1",
"ecosystem": "nuget"
},
{
"name": "Serilog.Extensions.Logging",
"direct": false,
"version": "10.0.0",
"ecosystem": "nuget"
},
{
"name": "Serilog.Sinks.Async",
"direct": false,
"version": "2.1.0",
"ecosystem": "nuget"
},
{
"name": "Serilog.Sinks.OpenTelemetry",
"direct": false,
"version": "4.2.0",
"ecosystem": "nuget"
},
{
"name": "Swashbuckle.AspNetCore",
"direct": false,
"version": "10.1.4",
"ecosystem": "nuget"
},
{
"name": "System.IO.Abstractions.TestingHelpers",
"direct": false,
"version": "22.1.0",
"ecosystem": "nuget"
},
{
"name": "xunit.runner.visualstudio",
"direct": false,
"version": "3.1.5",
"ecosystem": "nuget"
},
{
"name": "xunit.v3",
"direct": false,
"version": "3.2.2",
"ecosystem": "nuget"
}
],
"collected": true,
"truncated": false,
"total_count": 54,
"direct_count": 16,
"indirect_count": 38
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 60,
"open_issues": 0,
"closed_ratio": 1,
"closed_issues": 33,
"closed_unmerged_prs": 18
},
"bus_factor": 1,
"bot_contributors": 1,
"top_contributors": [
{
"type": "User",
"login": "danzuep",
"commits": 363,
"avatar_url": "https://avatars.githubusercontent.com/u/82693586?v=4"
},
{
"type": "User",
"login": "OsamaAlRashed",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/61357303?v=4"
},
{
"type": "User",
"login": "Sylar-A",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/76655052?v=4"
},
{
"type": "User",
"login": "staoran",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/7844538?v=4"
}
],
"contributors_sampled": 4,
"top_contributor_share": 0.992
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"_build-layered.yml",
"_build-test.yml",
"_build.yml",
"_codeql.yml",
"_deploy-nuget.yml",
"_pipeline.yml",
"_version.yml",
"_version_layered.yml",
"codeql.yml",
"development.yml",
"devops.yml",
"feature.yml",
"release.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 3,
"reason": "branch protection is not maximal on development and all release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 10,
"reason": "15 out of 15 merged PRs checked by a CI test -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/15 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 5,
"reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 7,
"reason": "SAST tool detected but not run on all commits",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "57416fa62b20b3b0a33bb474b59277b6ac45b572",
"ran_at": "2026-07-26T01:39:09Z",
"aggregate_score": 5.1,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": true,
"has_security_policy": false,
"has_dependabot_config": true
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-04T19:00:10Z",
"oldest_open_prs": [],
"last_merged_pr_at": "2026-07-02T14:52:29Z",
"ci_last_conclusion": "SUCCESS",
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/danzuep/MailKitSimplified",
"host": "github.com",
"name": "MailKitSimplified",
"owner": "danzuep"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 62,
"inputs": {
"security": 61,
"vitality": 72,
"community": 52,
"governance": 57,
"engineering": 65
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 72,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 58,
"inputs": {
"commits_last_year": 28,
"human_commit_share": 0.61,
"days_since_last_push": 21,
"active_weeks_last_year": 16
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 21 days ago",
"points": 28.8,
"status": "partial",
"details": [
{
"code": "push_recency",
"params": {
"days": 21
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "16/52 weeks with commits",
"points": 11.1,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 16
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "28 commits in the last year",
"points": 13.1,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 28
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 5,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"releases_count": 36,
"latest_release_tag": "v2.13.1",
"releases_from_tags": false,
"days_since_latest_release": 21,
"mean_days_between_releases": 77.4
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "36 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 36
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 21 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 21
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~77.4 days",
"points": 19.8,
"status": "partial",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 77.4
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 139,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 139 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 139
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 52,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 44,
"inputs": {
"forks": 13,
"stars": 95,
"watchers": 4,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "95 stars",
"points": 32,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 95
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "13 forks",
"points": 9,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 13
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "4 watchers",
"points": 2.7,
"status": "partial",
"details": [
{
"code": "watchers",
"params": {
"count": 4
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 66,
"inputs": {
"packages": [
"MailKitSimplified.Sender",
"MailKitSimplified.Receiver"
],
"dependents": null,
"ecosystems": "nuget",
"total_downloads": 127600,
"monthly_downloads": null
},
"components": [
{
"key": "total_downloads",
"name": "Total downloads",
"detail": "127,600 downloads all-time across nuget",
"points": 53.1,
"status": "partial",
"details": [
{
"code": "downloads_total",
"params": {
"count": 127600,
"ecosystems": "nuget"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 57,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 15,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 4,
"top_contributor_share": 0.992
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.2,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "4 contributors",
"points": 5.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 4
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "good",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 76,
"inputs": {
"merged_prs": 60,
"open_issues": 0,
"closed_issues": 33,
"issue_closed_ratio": 1,
"closed_unmerged_prs": 18
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "100% of issues closed",
"points": 46.8,
"status": "met",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 100
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "60/78 decided PRs merged",
"points": 29.4,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 60,
"decided": 78
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/15 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 53,
"inputs": {
"followers": 24,
"owner_type": "User",
"is_verified": null,
"owner_login": "danzuep",
"public_repos": 41,
"account_age_days": 1925
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "24 followers of danzuep",
"points": 10.1,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 24,
"login": "danzuep"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "41 public repos, account ~5 yr old",
"points": 22.4,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 41
}
},
{
"code": "account_age_years",
"params": {
"years": 5
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"MailKitSimplified.Sender",
"MailKitSimplified.Receiver"
],
"ecosystems": "nuget",
"any_deprecated": false,
"min_days_since_publish": 21
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "2 package(s) on nuget",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 2,
"ecosystems": "nuget"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 21 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 21
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "45 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 45
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "moderate",
"name": "Engineering Quality",
"value": 65,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 68,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "13 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 13
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "15 out of 15 merged PRs checked by a CI test -- score normalized to 10",
"points": 20,
"status": "met",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 60,
"inputs": {
"topics": [
"email",
"fluent",
"imap",
"mail",
"smtp",
"asynchronous",
"csharp",
"dependency-injection",
"devops-enabled",
"unit-tested",
"imap-client",
"smtp-client",
"email-reader",
"email-receiver",
"email-sender",
"mailer"
],
"has_wiki": true,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "16 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 16
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 61,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"packaging",
"signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 51,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5.1
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection is not maximal on development and all release branches",
"points": 2.2,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "15 out of 15 merged PRs checked by a CI test -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/15 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool detected but not run on all commits",
"points": 3.5,
"status": "partial",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "dependency_advisories",
"band": "excellent",
"name": "Dependency advisories",
"note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 42 resolved dependencies against OSV; 12 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"indirect_dependencies_free_of_known_advisories",
"no_advisories_left_outstanding"
]
}
},
{
"code": "weights_renormalized",
"params": {}
},
{
"code": "advisories_scope_repository",
"params": {
"assessed": 42
}
},
{
"code": "advisories_unassessed",
"params": {
"count": 12
}
},
{
"code": "advisories_repo_graph_caveat",
"params": {}
},
{
"code": "advisories_reachability",
"params": {}
}
],
"value": 100,
"inputs": {
"source": "osv",
"advisories": 3,
"affected_packages": 1,
"assessed_packages": 42,
"unassessed_packages": 12,
"affected_by_severity": "moderate 1",
"direct_affected_packages": 0
},
"components": [
{
"key": "direct_dependencies_free_of_known_advisories",
"name": "Direct dependencies free of known advisories",
"detail": "no direct dependency carries a known advisory",
"points": 35,
"status": "met",
"details": [
{
"code": "no_direct_advisories",
"params": {}
}
],
"max_points": 35
},
{
"key": "indirect_dependencies_free_of_known_advisories",
"name": "Indirect dependencies free of known advisories",
"detail": "transitive set not separable from development and test dependencies in this scope",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_scope_not_separable",
"params": {}
}
],
"max_points": 25
},
{
"key": "no_advisories_left_outstanding",
"name": "No advisories left outstanding",
"detail": "no advisory carries a publication date",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_no_publication_date",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "malicious_dependencies",
"band": "excellent",
"name": "Malicious dependencies",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"source": "osv",
"meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
"packages": [],
"red_flag": false,
"assessed_packages": 42,
"malicious_packages": 0,
"direct_malicious_packages": 0,
"withdrawn_malicious_packages": 0,
"installable_malicious_packages": 0
},
"components": [
{
"key": "no_dependency_reported_as_a_malicious_package",
"name": "No dependency reported as a malicious package",
"detail": "no dependency is reported as a malicious package",
"points": 100,
"status": "met",
"details": [
{
"code": "no_malicious_dependencies",
"params": {}
}
],
"max_points": 100
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 2
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 52,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 18,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.344,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "21 of 61 human commits state their intent (structured subject or explanatory body)",
"points": 18.4,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 21,
"sampled": 61
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "moderate",
"name": "Verify loop (build / test / typecheck)",
"note": null,
"notes": [],
"value": 64,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [],
"has_dockerfile": true,
"typed_language": true,
"bootstrap_files": [],
"has_devcontainer": true,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0,
"toolchain_manifests": [
"samples/ConsoleServiceExample/ConsoleServiceExample.csproj",
"samples/EmailWpfApp/EmailWpfApp.csproj",
"samples/ExporterExample/ExporterExample.csproj",
"samples/MonitorMultipleMailFolders/MonitorMultipleMailFolders.csproj",
"samples/WebApiExample/WebApiExample.csproj",
"samples/WorkerServiceExample/WorkerServiceExample.csproj",
"source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
"source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
"tests/MailKitSimplified.Receiver.Tests/MailKitSimplified.Receiver.Tests.csproj",
"tests/MailKitSimplified.Sender.Tests/MailKitSimplified.Sender.Tests.csproj"
],
"dependency_bot_commit_share": 0.39
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "samples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj (toolchain convention, no task runner)",
"points": 12.6,
"status": "partial",
"details": [
{
"code": "toolchain_convention",
"params": {
"files": "samples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "C# (statically typed)",
"points": 11,
"status": "met",
"details": [
{
"code": "statically_typed_language",
"params": {
"language": "C#"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "devcontainer, Dockerfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "devcontainer, Dockerfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no agent-authored commits among the last 100",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_authored_commits",
"params": {
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "39 of the last 100 commits are automated dependency updates",
"points": 8,
"status": "met",
"details": [
{
"code": "dependency_bot_commits",
"params": {
"count": 39,
"sampled": 100
}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "excellent",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"primary_language": "C#",
"largest_source_bytes": 35241,
"source_files_sampled": 105,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "C# (statically typed)",
"points": 45,
"status": "met",
"details": [
{
"code": "statically_typed_language",
"params": {
"language": "C#"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/105 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 105,
"oversized": 0
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"samples"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "samples",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "samples"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
],
"report_type": "repository",
"generated_at": "2026-07-26T01:39:21.140661Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/d/danzuep/MailKitSimplified.svg",
"full_name": "danzuep/MailKitSimplified",
"license_state": "standard",
"license_spdx": "MIT"
}Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.27.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — NuGet.