Registro público
Informe de salud del softwareesquema 0.27.0 · métricas 1.13.0 · 2026-07-26 01:39 UTC

danzuep / MailKitSimplified

Send and receive emails easily, fluently, with one line of code for each operation.

C#MIT★ 95 estrellas⑂ 13 forksdesde sept 2022Ver en GitHub ↗

danzuep/MailKitSimplified tiene un índice de salud de 62 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (72/100) y la más baja, AI Readiness (52/100). Se actualizó por última vez hace 21 días. Una sola persona concentra la mayor parte del trabajo reciente.

62
global / 100
Moderado

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

62
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

Daniel CollingwoodCuenta personal
24 seguidores41 repositorios públicosdesde abr 2021

Este repositorio pertenece a una cuenta personal. Un proyecto con un único propietario conlleva más riesgo de continuidad que uno respaldado por una organización.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
NuGetMailKitSimplified.Sender2.13.1-45hace 21 díassmtpmailkitemailsendersendsimplyeasilysimpleeasyfluentc#
NuGetMailKitSimplified.Receiver2.13.1-34hace 21 díasimapmailkitemailreceiverreceiveforwardreplysimplyeasilysimpleeasyfluentc#

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

72Bueno · 22% del índice global
Cómo se puntúa
28.8/36Recencia de push — último push hace 21 días
11.1/36Cadencia de commits — 16/52 semanas con commits
13.1/18Volumen de commits — 28 commits en el último año
5/10OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
Datos de entrada utilizados
commits_last_year28
human_commit_share0,61
days_since_last_push21
active_weeks_last_year16
Cómo se puntúa
27/27Publica versiones — 36 versiones publicadas
36/36Recencia de las versiones — última versión hace 21 días
19.8/27Cadencia de publicación — una versión cada ~77,4 días
0/10OpenSSF Scorecard: Signed-Releases — sin datos
Datos de entrada utilizados
releases_count36
latest_release_tagv2.13.1
releases_from_tagsno
days_since_latest_release21
mean_days_between_releases77,4
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

52Moderado · 18% del índice global
Cómo se puntúa
32/60Estrellas — 95 estrellas
9/25Forks — 13 forks
2.7/15Observadores — 4 observadores
Datos de entrada utilizados
forks13
stars95
watchers4
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Cómo se puntúa
22.5/22.5README
22.5/22.5Licencia — licencia reconocida (MIT)
0/18Guía CONTRIBUTING
0/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributingno
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno
Cómo se puntúa
53.1/80Descargas totales — 127.600 descargas históricas en nuget
0/20Dependientes en el registro — no lo informa este ecosistema
Datos de entrada utilizados
packagesMailKitSimplified.Sender, MailKitSimplified.Receiver
dependents
ecosystemsnuget
total_downloads127.600
monthly_downloads
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

57Moderado · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
0.2/22.5Distribución de commits — el principal contribuyente firma el 99% de los commits
5.4/13.5Amplitud de contribuyentes — 4 contribuyentes
0/10OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0
Datos de entrada utilizados
bus_factor1
contributors_sampled4
top_contributor_share0,992
Cómo se puntúa
46.8/46.8Resolución de issues — 100% de issues cerradas
29.4/38.3Aceptación de PR — 60/78 PR decididos fusionados
0/15OpenSSF Scorecard: Code-Review — Found 0/15 approved changesets -- score normalized to 0
Datos de entrada utilizados
merged_prs60
open_issues0
closed_issues33
issue_closed_ratio1
closed_unmerged_prs18
Cómo se puntúa
10/30Respaldo de la propiedad — cuenta personal (usuario)
0/20Dominio verificado — no aplicable a cuentas de usuario
10.1/25Alcance del propietario — 24 seguidores de danzuep
22.4/25Trayectoria — 41 repos públicos, cuenta de ~5 años
Datos de entrada utilizados
followers24
owner_typeUser
is_verified
owner_logindanzuep
public_repos41
account_age_days1925
Excluidos de la puntuación (sin datos o no aplicable): Dominio verificado. Los pesos restantes se han renormalizado.
Cómo se puntúa
25/25Publicado y resoluble — 2 paquete(s) en nuget
35/35Recencia de publicación — última publicación hace 21 días
20/20Historial de versiones — 45 versiones en el registro
20/20No obsoleto — activo, ni obsoleto ni retirado
Datos de entrada utilizados
packagesMailKitSimplified.Sender, MailKitSimplified.Receiver
ecosystemsnuget
any_deprecatedno
min_days_since_publish21

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

65Moderado · 20% del índice global
Cómo se puntúa
24/24Flujos de trabajo de CI — 13 flujo(s) de trabajo
24/24Pruebas presentes
0/16Configuración de linter
0/9.6Hooks de pre-commit
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 15 out of 15 merged PRs checked by a CI test -- score normalized to 10
Datos de entrada utilizados
has_ci
has_tests
has_editorconfigno
has_linter_configno
has_precommit_configno

Documentación

60Moderado
Cómo se puntúa
30/30README
0/25Directorio de documentación
0/15Sitio de documentación / página del proyecto
10/10Descripción del repositorio
10/10Topics — 16 topics
10/10Wiki
Datos de entrada utilizados
topicsemail, fluent, imap, mail, smtp, asynchronous, csharp, dependency-injection, devops-enabled, unit-tested, imap-client, smtp-client, email-reader, email-receiver, email-sender, mailer
has_wiki
homepage
has_readme
has_docs_dirno
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

61Moderado · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
2.2/7.5Branch-Protection — branch protection is not maximal on development and all release branches
2.5/2.5CI-Tests — 15 out of 15 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/15 approved changesets -- score normalized to 0
0/2.5Contributors — project has 0 contributing companies or organizations -- score normalized to 0
10/10Dangerous-Workflow — no dangerous workflow patterns detected
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Licencia — license file detected
3.8/7.5Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
0/5Packaging — sin datos
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
3.5/5SAST — SAST tool detected but not run on all commits
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — sin datos
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated16
scorecard_versionv5.5.0
checks_inconclusive2
scorecard_aggregate5,1
Excluidos de la puntuación (sin datos o no aplicable): packaging, signed_releases. Los pesos restantes se han renormalizado.
Cómo se puntúa
35/35Dependencias directas libres de avisos conocidos — ninguna dependencia directa tiene un aviso conocido
0/25Dependencias indirectas libres de avisos conocidos — el conjunto transitivo no es separable de las dependencias de desarrollo y prueba en este alcance
0/40Sin avisos pendientes — ningún aviso tiene fecha de publicación
Datos de entrada utilizados
sourceosv
advisories3
affected_packages1
assessed_packages42
unassessed_packages12
affected_by_severitymoderate 1
direct_affected_packages0
Excluidos de la puntuación (sin datos o no aplicable): Dependencias indirectas libres de avisos conocidos, Sin avisos pendientes. Los pesos restantes se han renormalizado. Se cotejaron 42 dependencias resueltas con OSV. 12 no pudieron evaluarse: sin versión resuelta, ecosistema no admitido o fuera de la lista de paquetes informada. Este repositorio no publica ningún paquete que el índice resuelva, por lo que se evaluó en su lugar el grafo de dependencias del repositorio. Ese grafo mezcla fijaciones de desarrollo y prueba con las dependencias distribuidas, de modo que solo se puntúan las dependencias declaradas en tiempo de ejecución; los hallazgos transitivos se informan como contexto y quedan excluidos de la puntuación. No se analiza la alcanzabilidad.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

52Moderado · 0% del índice global
Cómo se puntúa
0/45Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor
0/15Documentación legible por máquinas (llms.txt)
18.4/40Historial de commits legible — 21 de 61 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo)
Datos de entrada utilizados
has_llms_txtno
legible_history_share0,344
agent_instruction_files
agent_instruction_max_bytes
Cómo se puntúa
12.6/18Arranque con un solo comando — samples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj (convención del toolchain, sin ejecutor de tareas)
22/22Pruebas automatizadas
0/11Configuración de lint / formato
11/11Verificación estática de tipos — C# (tipado estático)
10/10Entorno reproducible — devcontainer, Dockerfile
0/10Práctica demostrada con agentes — ningún commit con autoría de agente entre los últimos 100
8/8Mantenimiento automatizado — 39 de los últimos 100 commits son actualizaciones automáticas de dependencias
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Datos de entrada utilizados
has_nixno
has_tests
lockfiles
has_dockerfile
typed_language
bootstrap_files
has_devcontainer
has_linter_configno
typecheck_configs
agent_commit_share0
toolchain_manifestssamples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj, samples/MonitorMultipleMailFolders/MonitorMultipleMailFolders.csproj, samples/WebApiExample/WebApiExample.csproj, samples/WorkerServiceExample/WorkerServiceExample.csproj, source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj, source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj, tests/MailKitSimplified.Receiver.Tests/MailKitSimplified.Receiver.Tests.csproj, tests/MailKitSimplified.Sender.Tests/MailKitSimplified.Sender.Tests.csproj
dependency_bot_commit_share0,39
Cómo se puntúa
45/45Código verificable por tipos — C# (tipado estático)
55/55Tamaños de archivo manejables — 0/105 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languageC#
largest_source_bytes35.241
source_files_sampled105
oversized_source_files0
Cómo se puntúa
0/40Esquema de API (OpenAPI/GraphQL/proto)
0/20Servidor MCP
40/40Ejemplos ejecutables — samples
Datos de entrada utilizados
example_dirssamples
has_mcp_signalno
api_schema_files

Datos clave

95estrellas de GitHub
4contribuidores
28commits en los últimos 12 meses
21días desde el último push
36versiones publicadas
1factor bus
0issues abiertas
ecosistemas de paquetes

Advertencias de recopilación de datos

  • Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token

Más detalle

Historial de estrellas y forks 0 ★ / 13 ⇿
0Estrellas
13Forks
17Versiones

Cuándo se añadió cada estrella y fork, recopilado de GitHub y agrupado por día. El crecimiento acumulado se sitúa justo encima de las adiciones diarias que lo componen, de modo que ambos se leen en conjunto: la acumulación orgánica sostenida no se parece en nada a un pico abrupto y efímero. Cuando esa diferencia es medible, se informa como autenticidad del crecimiento.

03581013151322023-042024-082025-12
Mayor 0Menor 6Parche 11

Cada punto abarca 3 días.

OpenSSF Scorecard 5.1 / 10
5.1agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-26 01:39 UTC

10Binary-Artifactsno binaries found in the repo
3Branch-Protectionbranch protection is not maximal on development and all release branches
10CI-Tests15 out of 15 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/15 approved changesets -- score normalized to 0
0Contributorsproject has 0 contributing companies or organizations -- score normalized to 0
10Dangerous-Workflowno dangerous workflow patterns detected
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
5Maintained6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
n/dPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
7SASTSAST tool detected but not run on all commits
0Security-Policysecurity policy file not detected
n/dSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Dependencias directas 21
RegistroPaqueteRestricción de versiónManifiesto
NuGetMailKitsource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMimeKitsource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMicrosoft.Extensions.Caching.Memorysource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMicrosoft.Extensions.Caching.Abstractionssource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMicrosoft.Extensions.Configuration.Abstractionssource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMicrosoft.Extensions.Loggingsource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMicrosoft.Extensions.Options.ConfigurationExtensionssource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetSystem.ComponentModel.Annotationssource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetSystem.IO.Abstractionssource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetSystem.Text.Jsonsource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMicrosoft.Extensions.Logging.Debugsource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMicrosoft.Extensions.Logging.Consolesource/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj
NuGetMailKitsource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetMimeKitsource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetMicrosoft.Extensions.Configuration.Abstractionssource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetMicrosoft.Extensions.Loggingsource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetMicrosoft.Extensions.Options.ConfigurationExtensionssource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetSystem.ComponentModel.Annotationssource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetSystem.IO.Abstractionssource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetMicrosoft.Extensions.Logging.Debugsource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
NuGetMicrosoft.Extensions.Logging.Consolesource/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj
Todas las dependencias 54

Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 16 paquetes directos y 38 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.

RegistroPaqueteVersiónRelación
NuGetMailKitdirecta
NuGetMicrosoft.Extensions.Caching.Abstractionsdirecta
NuGetMicrosoft.Extensions.Caching.Memorydirecta
NuGetMicrosoft.Extensions.Configuration.Abstractionsdirecta
NuGetMicrosoft.Extensions.Loggingdirecta
NuGetMicrosoft.Extensions.Logging10.0.3directa
NuGetMicrosoft.Extensions.Logging.Consoledirecta
NuGetMicrosoft.Extensions.Logging.Console10.0.3directa
NuGetMicrosoft.Extensions.Logging.Debugdirecta
NuGetMicrosoft.Extensions.Logging.Debug10.0.3directa
NuGetMicrosoft.Extensions.Options.ConfigurationExtensionsdirecta
NuGetMimeKitdirecta
NuGetSystem.ComponentModel.Annotationsdirecta
NuGetSystem.IO.Abstractionsdirecta
NuGetSystem.IO.Abstractions22.1.0directa
NuGetSystem.Text.Jsondirecta
NuGetAsp.Versioning.Mvc8.1.1indirecta
NuGetAsp.Versioning.Mvc.ApiExplorer8.1.1indirecta
NuGetCommunityToolkit.Common8.4.0indirecta
NuGetCommunityToolkit.Diagnostics8.4.0indirecta
NuGetCommunityToolkit.Mvvm8.4.0indirecta
NuGetcoverlet.collector10.0.1indirecta
NuGetCsvHelper33.1.0indirecta
NuGetMailKitSimplified.Receiver2.12.0indirecta
NuGetMailKitSimplified.Sender2.12.0indirecta
NuGetMicrosoft.EntityFrameworkCore.Sqlite10.0.3indirecta
NuGetMicrosoft.Extensions.Configuration.CommandLine10.0.3indirecta
NuGetMicrosoft.Extensions.DependencyInjection.Abstractions10.0.3indirecta
NuGetMicrosoft.Extensions.Hosting10.0.3indirecta
NuGetMicrosoft.Extensions.Http.Polly10.0.3indirecta
NuGetMicrosoft.Extensions.Http.Resilience10.3.0indirecta
NuGetMicrosoft.Identity.Web4.5.0indirecta
NuGetMicrosoft.NET.Test.Sdk18.3.0indirecta
NuGetMicrosoft.VisualStudio.Azure.Containers.Tools.Targets1.23.0indirecta
NuGetMoq4.20.72indirecta
NuGetNewtonsoft.Json13.0.4indirecta
NuGetNSwag.ApiDescription.Client14.6.3indirecta
NuGetOpenTelemetry.Exporter.Console1.15.0indirecta
NuGetOpenTelemetry.Exporter.OpenTelemetryProtocol1.15.0indirecta
NuGetOpenTelemetry.Extensions.Hosting1.15.0indirecta
NuGetOpenTelemetry.Instrumentation.AspNetCore1.15.0indirecta
NuGetOpenTelemetry.Instrumentation.Http1.15.0indirecta
NuGetOpenTelemetry.Instrumentation.Runtime1.15.0indirecta
NuGetPolly8.6.6indirecta
NuGetPolly.Contrib.WaitAndRetry1.1.1indirecta
NuGetSerilog.AspNetCore10.0.0indirecta
NuGetSerilog.Enrichers.Environment3.0.1indirecta
NuGetSerilog.Extensions.Logging10.0.0indirecta
NuGetSerilog.Sinks.Async2.1.0indirecta
NuGetSerilog.Sinks.OpenTelemetry4.2.0indirecta
NuGetSwashbuckle.AspNetCore10.1.4indirecta
NuGetSystem.IO.Abstractions.TestingHelpers22.1.0indirecta
NuGetxunit.runner.visualstudio3.1.5indirecta
NuGetxunit.v33.2.2indirecta
Avisos de dependencias 1

Este repositorio no publica ningún paquete que el índice resuelva, así que se evaluó su propio grafo de dependencias — 42 paquetes, que incluyen también fijaciones de desarrollo y prueba que nunca se distribuyen: 1 tienen avisos conocidos, de los cuales 0 son directas. 12 no pudieron evaluarse: sin versión resuelta, ecosistema no admitido, o fuera de la lista de paquetes informada.

PaqueteVersiónRelaciónGravedadAvisosCorregido en
OpenTelemetry.Exporter.OpenTelemetryProtocol1.15.0indirectamoderada31.15.3

Un aviso significa que la versión registrada en el grafo de dependencias cae dentro del rango afectado de un aviso. No se analiza la alcanzabilidad, y el grafo incluye fijaciones de desarrollo y prueba: un hallazgo puede referirse al utillaje y no al software distribuido.

Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [
        "email",
        "fluent",
        "imap",
        "mail",
        "smtp",
        "asynchronous",
        "csharp",
        "dependency-injection",
        "devops-enabled",
        "unit-tested",
        "imap-client",
        "smtp-client",
        "email-reader",
        "email-receiver",
        "email-sender",
        "mailer"
      ],
      "is_fork": false,
      "size_kb": 1077,
      "has_wiki": true,
      "homepage": null,
      "languages": {
        "C#": 380939,
        "PowerShell": 1632
      },
      "pushed_at": "2026-07-04T18:58:49Z",
      "created_at": "2022-09-25T14:50:16Z",
      "owner_type": "User",
      "updated_at": "2026-07-06T07:43:20Z",
      "description": "Send and receive emails easily, fluently, with one line of code for each operation.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "C#",
      "significant_languages": [
        "C#"
      ]
    },
    "owner": {
      "blog": null,
      "name": "Daniel Collingwood",
      "type": "User",
      "login": "danzuep",
      "company": null,
      "location": null,
      "followers": 24,
      "avatar_url": "https://avatars.githubusercontent.com/u/82693586?v=4",
      "created_at": "2021-04-17T04:33:12Z",
      "is_verified": null,
      "public_repos": 41,
      "account_age_days": 1925
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v2.13.1",
          "kind": "patch",
          "published_at": "2026-07-04T18:58:50Z"
        },
        {
          "tag": "v2.13.0",
          "kind": "minor",
          "published_at": "2026-03-08T12:44:12Z"
        },
        {
          "tag": "v2.12.0",
          "kind": "minor",
          "published_at": "2025-11-14T02:22:00Z"
        },
        {
          "tag": "v2.11.16",
          "kind": "patch",
          "published_at": "2025-11-01T13:21:19Z"
        },
        {
          "tag": "v2.11.15",
          "kind": "patch",
          "published_at": "2025-03-06T16:21:49Z"
        },
        {
          "tag": "v2.11.14",
          "kind": "patch",
          "published_at": "2025-02-06T00:11:02Z"
        },
        {
          "tag": "v2.11.13",
          "kind": "patch",
          "published_at": "2024-08-25T03:37:01Z"
        },
        {
          "tag": "v2.11.12",
          "kind": "patch",
          "published_at": "2024-08-22T14:13:39Z"
        },
        {
          "tag": "v2.11.10",
          "kind": "patch",
          "published_at": "2024-08-07T17:04:42Z"
        },
        {
          "tag": "v2.11.9",
          "kind": "patch",
          "published_at": "2024-08-07T14:14:31Z"
        },
        {
          "tag": "v2.10.0",
          "kind": "minor",
          "published_at": "2024-05-01T10:37:53Z"
        },
        {
          "tag": "v2.9.0",
          "kind": "minor",
          "published_at": "2023-12-15T01:22:39Z"
        },
        {
          "tag": "v2.8.0",
          "kind": "minor",
          "published_at": "2023-10-21T15:51:34Z"
        },
        {
          "tag": "v2.7.0",
          "kind": "minor",
          "published_at": "2023-09-28T02:15:28Z"
        },
        {
          "tag": "v2.6.1",
          "kind": "patch",
          "published_at": "2023-09-18T14:09:25Z"
        },
        {
          "tag": "v2.5.5",
          "kind": "patch",
          "published_at": "2023-08-25T14:43:51Z"
        },
        {
          "tag": "v2.5.4",
          "kind": "patch",
          "published_at": "2023-08-19T16:19:06Z"
        },
        {
          "tag": "v2.5.2",
          "kind": "patch",
          "published_at": "2023-08-11T14:21:48Z"
        },
        {
          "tag": "v2.5.0",
          "kind": "minor",
          "published_at": "2023-07-29T17:14:55Z"
        },
        {
          "tag": "v2.4.6",
          "kind": "patch",
          "published_at": "2023-01-15T13:41:04Z"
        },
        {
          "tag": "v2.4.5",
          "kind": "patch",
          "published_at": "2023-01-15T09:05:59Z"
        },
        {
          "tag": "v2.4.2",
          "kind": "patch",
          "published_at": "2023-01-10T23:25:27Z"
        },
        {
          "tag": "v2.4.1",
          "kind": "patch",
          "published_at": "2023-01-10T23:22:16Z"
        },
        {
          "tag": "v2.4.0",
          "kind": "minor",
          "published_at": "2022-12-12T03:35:51Z"
        },
        {
          "tag": "v2.3.0",
          "kind": "minor",
          "published_at": "2022-12-09T10:00:50Z"
        },
        {
          "tag": "v2.2.0",
          "kind": "minor",
          "published_at": "2022-12-06T16:23:08Z"
        },
        {
          "tag": "v2.1.0",
          "kind": "minor",
          "published_at": "2022-12-02T05:11:05Z"
        },
        {
          "tag": "v2.0.0",
          "kind": "major",
          "published_at": "2022-12-01T08:47:58Z"
        },
        {
          "tag": "v1.1.4",
          "kind": "patch",
          "published_at": "2022-11-25T07:31:08Z"
        },
        {
          "tag": "v1.1.3",
          "kind": "patch",
          "published_at": "2022-11-24T07:37:55Z"
        },
        {
          "tag": "v1.1.2",
          "kind": "patch",
          "published_at": "2022-11-21T12:46:09Z"
        },
        {
          "tag": "v1.1.0",
          "kind": "minor",
          "published_at": "2022-11-17T17:47:02Z"
        },
        {
          "tag": "v1.0.1",
          "kind": "patch",
          "published_at": "2022-11-16T14:41:33Z"
        },
        {
          "tag": "v0.2.0",
          "kind": "minor",
          "published_at": "2022-11-12T04:23:14Z"
        },
        {
          "tag": "v0.1.3",
          "kind": "patch",
          "published_at": "2022-11-11T08:20:49Z"
        },
        {
          "tag": "v0.1.3-beta",
          "kind": "prerelease",
          "published_at": "2022-11-11T05:29:16Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "57416fa62b20b3b0a33bb474b59277b6ac45b572",
          "body": "Bumps [actions/cache](https://github.com/actions/cache) from 3 to 6.\n- [Release notes](https://github.com/actions/cache/releases)\n- [Changelog](https://github.com/actions/cache/blob/main/RELEASES.md)\n- [Commits](https://github.com/actions/cache/compare/v3...v6)\n\n---\nupdated-dependencies:\n- dependency-name: actions/cache\n  dependency-version: '6'\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump actions/cache from 3 to 6",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-07-02T14:52:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "81c8e930506e2bfe70b7935a7d8d4b908202a495",
          "body": "Bumps MailKit from 4.15.1 to 4.17.0\nBumps MimeKit from 4.15.1 to 4.17.0\n\n---\nupdated-dependencies:\n- dependency-name: MailKit\n  dependency-version: 4.17.0\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n- dependency-name: MimeKit\n  dependency-version: 4.17.0\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump MailKit and MimeKit",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-07-02T14:51:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "68cbb1b9247c3cd02a1a22e813b0d2957f0f87e6",
          "body": "Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 3 to 7.\n- [Release notes](https://github.com/actions/upload-artifact/releases)\n- [Commits](https://github.com/actions/upload-artifact/compare/v3...v7)\n\n---\nupdated-dependencies:\n- dependency-name: actions/upload-artifact\n  dependency-version: '7'\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump actions/upload-artifact from 3 to 7",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-06-01T16:19:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "43acf9e3959b5fbfeb5ee137a28f2e0610db555e",
          "body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n  dependency-version: 10.0.1\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n- dependency-name: coverlet.collector\n  dependency-version: 10.0.1\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump coverlet.collector from 10.0.0 to 10.0.1",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-06-01T16:17:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "51396a672dd2f20d67b6d4cd387015a6319df16a",
          "body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.4 to 3.0.4.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.4...\n[…]\nocchino/sticky-pull-request-comment\n  dependency-version: 3.0.4\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump marocchino/sticky-pull-request-comment from 2.9.4 to 3.0.4",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-05-01T04:41:53Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "71cd1c44ddaa315756d0cbc4277ff99ff8429ef3",
          "body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n  dependency-version: 10.0.0\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n- dependency-name: coverlet.collector\n  dependency-version: 10.0.0\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump coverlet.collector from 8.0.1 to 10.0.0",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-05-01T04:41:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c79e6293f3e178ea164a04110b7dbf88fe6f7c75",
          "body": "Bumps [actions/setup-dotnet](https://github.com/actions/setup-dotnet) from 3 to 5.\n- [Release notes](https://github.com/actions/setup-dotnet/releases)\n- [Commits](https://github.com/actions/setup-dotnet/compare/v3...v5)\n\n---\nupdated-dependencies:\n- dependency-name: actions/setup-dotnet\n  dependency-version: '5'\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump actions/setup-dotnet from 3 to 5",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-04-01T01:29:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6ac3a44d43aa8a8b0025ee03f9a01266deb1d2aa",
          "body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n  dependency-version: 8.0.1\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n- dependency-name: coverlet.collector\n  dependency-version: 8.0.1\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump coverlet.collector from 8.0.0 to 8.0.1",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-04-01T01:29:31Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "50dc64b420f2a467f2d8d4824e9e34e8cba5bc5c",
          "body": "Calls to methods which accept CancellationToken should use TestContext.Current.CancellationToken to allow test cancellation to be more responsive. (https://xunit.net/xunit.analyzers/rules/xUnit1051)",
          "is_bot": false,
          "headline": "Add TestContext.Current.CancellationToken for unit tests",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2026-03-08T12:49:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "920e26661d04de14286ec921fd4f709599628668",
          "body": "…P command injection) #105",
          "is_bot": false,
          "headline": "Bump MimeKit minimum version to 4.15.1 to address CVE-2026-30227 (SMT…",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2026-03-08T12:29:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fe5804e814a05b824181610a545b6b42eae46af7",
          "body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 0 to 4.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/commits/v4)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n  dependency-version: '4'\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump gittools/actions from 0 to 4",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-03-01T03:36:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2c9e2ad554c3e7e79fd30342a830cc139971b3db",
          "body": "---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n  dependency-version: 8.0.0\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n- dependency-name: coverlet.collector\n  dependency-version: 8.0.0\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump coverlet.collector from 6.0.4 to 8.0.0",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-03-01T03:35:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c7ba306969928cb6e151092b7fcd18983c54cb62",
          "body": null,
          "is_bot": false,
          "headline": "Merge branch 'main' of https://github.com/danzuep/MailKitSimplified",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2026-02-27T15:05:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a37266003b997b93a3e8dc1b976eaf8fc0588fc",
          "body": null,
          "is_bot": false,
          "headline": "Added HostBuilderExtensions",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2026-02-27T15:04:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bffe4e1186b49738c8ade2983059047f675b31e5",
          "body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.3 to 2.9.4.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.3...\n[…]\nocchino/sticky-pull-request-comment\n  dependency-version: 2.9.4\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump marocchino/sticky-pull-request-comment from 2.9.3 to 2.9.4",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-02-02T16:25:28Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "b186b3a1c01710ee25aec14920d2aa26b2383ae0",
          "body": null,
          "is_bot": false,
          "headline": "Added full configuration for OpenTelemetry",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2026-02-02T16:22:54Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fe51bec484355916e1202e6c90cfa7411d217f30",
          "body": "Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 3 to 7.\n- [Release notes](https://github.com/actions/download-artifact/releases)\n- [Commits](https://github.com/actions/download-artifact/compare/v3...v7)\n\n---\nupdated-dependencies:\n- dependency-name: actions/download-artifact\n  dependency-version: '7'\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump actions/download-artifact from 3 to 7",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2026-01-31T06:26:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ca84855eae4fb67643cd25b39ee7796ca0b6dd99",
          "body": null,
          "is_bot": false,
          "headline": "Added example appsettings.serilog.json with OpenTelemetry",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2026-01-14T00:46:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a511577c3e571d2dee94533c91d6f05d7b1ad8bf",
          "body": null,
          "is_bot": false,
          "headline": "Bumped all packages to their latest versions",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2026-01-14T00:13:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "675a702f612debda8f51f6b1b82b9d4cc81f88e1",
          "body": "Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3 to 4.\n- [Release notes](https://github.com/github/codeql-action/releases)\n- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)\n- [Commits](https://github.com/github/codeql-action/compare/v3...v4)\n\n-\n[…]\ndependency-name: github/codeql-action\n  dependency-version: '4'\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump github/codeql-action from 3 to 4",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-12-01T05:09:03Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "6e58da0fb28b026208ca86628dd95c9677b79c76",
          "body": null,
          "is_bot": false,
          "headline": "Added DefaultLogger for demo and updated dependencies",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-11-23T13:47:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "726cc0b6f1f8fc0fc1fc66e86e8e0a1687bdd5df",
          "body": null,
          "is_bot": false,
          "headline": "Updated to .NET 10",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-11-14T02:13:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "84a2cb685783d7aee7200ce9d9cbac4a9663c8fb",
          "body": null,
          "is_bot": false,
          "headline": "Separated versioning workflow",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-11-01T13:19:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5c1a746c746d50791f2f2385dcbe77d5ade75c55",
          "body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.2.1 to 4.1.0.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Changelog](https://github.com/GitTools/actions/blob/main/GitReleaseManager.yml)\n- [Commits](https://github.com/gittools/actions/compare/v3.2.1...v4.1.0)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n  dependency-version: 4.1.0\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...",
          "is_bot": true,
          "headline": "Bump gittools/actions from 3.2.1 to 4.1.0",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-11-01T13:15:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "aa07ac7baa342341fc1e786a8bb71f8887847c46",
          "body": null,
          "is_bot": false,
          "headline": "Updated all packages to the latest versions",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-11-01T07:34:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f1945cf92e06ce3feb2be95a4ec09df1dc2b68b7",
          "body": null,
          "is_bot": false,
          "headline": "Migrated from Microsoft.AspNetCore.Mvc to Asp.Versioning",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-11-01T07:33:47Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e07fae7bb5dc1fba8cd2a730791f5e6bae145c0f",
          "body": null,
          "is_bot": false,
          "headline": "Package versions updated to latest",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-07-29T04:29:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a3b78127534f4550bfc4dfc21300368ff9bfe356",
          "body": null,
          "is_bot": false,
          "headline": "Simplified way of reading Options sections",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-07-29T04:29:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2abb804461bf4f6db2baf176b649ba95fb1aae41",
          "body": "Bumps MailKit from 4.10.0 to 4.13.0\nBumps Microsoft.Extensions.Caching.Abstractions from 9.0.2 to 9.0.6\nBumps Microsoft.Extensions.Caching.Memory from 9.0.2 to 9.0.6\nBumps Microsoft.Extensions.Configuration.Abstractions from 9.0.2 to 9.0.6\nBumps Microsoft.Extensions.Logging to 9.0.6\nBumps Microsoft.\n[…]\nncy-name: xunit.runner.visualstudio\n  dependency-version: 3.1.1\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump MailKit and 13 others",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-07-22T05:38:05Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "810de9723a6b6cf7df99bf41e7325610c9bfa2b8",
          "body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.2 to 2.9.3.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.2...\n[…]\nocchino/sticky-pull-request-comment\n  dependency-version: 2.9.3\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump marocchino/sticky-pull-request-comment from 2.9.2 to 2.9.3",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-07-22T05:37:09Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "acbd23712c7a85ac38560db3484cea00e38caec0",
          "body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.1.11 to 3.2.1.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Changelog](https://github.com/GitTools/actions/blob/main/GitReleaseManager.yml)\n- [Commits](https://github.com/gittools/actions/compare/v3.1.11...v3.\n[…]\n- dependency-name: gittools/actions\n  dependency-version: 3.2.1\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump gittools/actions from 3.1.11 to 3.2.1",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-06-01T16:27:45Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "26fc94b8ce48bb470b88d823b344a17cbb13ffb3",
          "body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.1 to 2.9.2.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.1...\n[…]\nocchino/sticky-pull-request-comment\n  dependency-version: 2.9.2\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump marocchino/sticky-pull-request-comment from 2.9.1 to 2.9.2",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-05-05T11:53:00Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "82fc7274144e22fcc934a7a183f33a1e152b7154",
          "body": "Bumps [MimeKit](https://github.com/jstedfast/MimeKit) from 4.10.0 to 4.12.0.\n- [Changelog](https://github.com/jstedfast/MimeKit/blob/master/ReleaseNotes.md)\n- [Commits](https://github.com/jstedfast/MimeKit/compare/4.10.0...4.12.0)\n\n---\nupdated-dependencies:\n- dependency-name: MimeKit\n  dependency-version: 4.12.0\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump MimeKit from 4.10.0 to 4.12.0 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-05-05T11:52:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8817617cfe414f0de650b5698368bb19329a112e",
          "body": "Bumps [System.IO.Abstractions.TestingHelpers](https://github.com/TestableIO/System.IO.Abstractions) from 22.0.10 to 22.0.12.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v22.0.10...v22.0.12)\n\n[…]\nem.IO.Abstractions.TestingHelpers\n  dependency-version: 22.0.12\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump System.IO.Abstractions.TestingHelpers in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-04-03T03:02:06Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "09da07d6167da0b0855daa349aa20473364162ef",
          "body": null,
          "is_bot": false,
          "headline": "GitVersion 6 removed NuGetVersion",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-07T01:11:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5a27ea422b5760fcba94be7cbe7c001b4f796cfb",
          "body": null,
          "is_bot": false,
          "headline": "#63 Monitoring multiple mailboxes fixed",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-06T16:16:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1c261af1870221a790aa519bc2d05a2f6abad613",
          "body": "…ding flags",
          "is_bot": false,
          "headline": "#63 replicated the issues when monitoring multiple mail folders or ad…",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-06T16:16:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d9faf9cb2c39e1c80d340b05234690aed2d05234",
          "body": null,
          "is_bot": false,
          "headline": "Add a Dev Container for Visual Studio Code",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-01T06:54:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f996b258114ffaffaf29ee005f3e94ddf3d250df",
          "body": null,
          "is_bot": false,
          "headline": "Update all sample package versions to latest",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-01T06:53:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e26ed3cf948cf382075f8b0a68f685e03adfedf2",
          "body": null,
          "is_bot": false,
          "headline": "Updated gitversion to version 6",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-01T06:50:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "48d4121d298878d89a0b33de0b59f882be418c99",
          "body": "…ry.Packages.props",
          "is_bot": false,
          "headline": "Use central package management by setting package versions in Directo…",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-01T06:25:40Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c8591cd78754ef0b1a62cc56c6ca2db6cb094694",
          "body": "…t files",
          "is_bot": false,
          "headline": "Moved PackageReferences from Directory.Build.targets back into projec…",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-03-01T03:28:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8c0a3acb67ecd95d9a00a083620379fcc0e53e31",
          "body": "Bumps [System.IO.Abstractions](https://github.com/TestableIO/System.IO.Abstractions) from 21.3.1 to 22.0.10.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v21.3.1...v22.0.10)\n\n---\nupdated-dependencies:\n- dependency-name: System.IO.Abstractions\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump System.IO.Abstractions from 21.3.1 to 22.0.10 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-03-01T03:28:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a3802f2ab5824523ad5bc710826f9749692758a",
          "body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.0.3 to 3.1.11.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Changelog](https://github.com/GitTools/actions/blob/main/GitReleaseManager.yml)\n- [Commits](https://github.com/gittools/actions/compare/v3.0.3...v3.1\n[…]\n\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump gittools/actions from 3.0.3 to 3.1.11",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-02-06T00:08:47Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "23201e932097605e2f26892cb9db1eb67a8e22b9",
          "body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.9.0 to 2.9.1.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.9.0...\n[…]\ncies:\n- dependency-name: marocchino/sticky-pull-request-comment\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump marocchino/sticky-pull-request-comment from 2.9.0 to 2.9.1",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2025-02-06T00:05:07Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "da07f6c659485d372052957e94c38f067f67a1b2",
          "body": null,
          "is_bot": false,
          "headline": "Updated Directory.Build.props package versions",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-02-05T14:23:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c987d9a2d942107d35524376106d5dea4368f39b",
          "body": null,
          "is_bot": false,
          "headline": "Updated packages",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2025-02-05T14:10:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e5fa9288558380e3ce4d008bd8c84a35a48c1453",
          "body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 3.0.0 to 3.0.3.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/compare/v3.0.0...v3.0.3)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump gittools/actions from 3.0.0 to 3.0.3",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-12-01T22:33:31Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7b8ad6d6639fc09c55a39d47cafda77aaee51810",
          "body": "Bumps [System.Text.Json](https://github.com/dotnet/runtime) from 8.0.4 to 9.0.0.\n- [Release notes](https://github.com/dotnet/runtime/releases)\n- [Commits](https://github.com/dotnet/runtime/compare/v8.0.4...v9.0.0)\n\n---\nupdated-dependencies:\n- dependency-name: System.Text.Json\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump System.Text.Json from 8.0.4 to 9.0.0 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-12-01T22:32:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7077a43ae9ae729bb09b73e5f7e2f643edcb8ad3",
          "body": "…Caching.Memory and System.ComponentModel.Annotations\n\nBumps [Microsoft.Extensions.Caching.Abstractions](https://github.com/dotnet/runtime), [Microsoft.Extensions.Caching.Memory](https://github.com/dotnet/runtime) and [System.ComponentModel.Annotations](https://github.com/dotnet/runtime). These depe\n[…]\nmver-major\n- dependency-name: System.ComponentModel.Annotations\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump Microsoft.Extensions.Caching.Abstractions, Microsoft.Extensions.…",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-11-25T23:14:40Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "54d53b622d80938065496121baa1972c85c49f6c",
          "body": null,
          "is_bot": false,
          "headline": "AddWithLifetime",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-11-07T15:24:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6efdff9ebb5f8b733cb3705abe478706880f7e51",
          "body": "Bumps [MailKit](https://github.com/jstedfast/MailKit) and [MimeKit](https://github.com/jstedfast/MimeKit). These dependencies needed to be updated together.\n\nUpdates `MailKit` from 4.7.1.1 to 4.8.0\n- [Changelog](https://github.com/jstedfast/MailKit/blob/master/ReleaseNotes.md)\n- [Commits](https://gi\n[…]\nte-type: version-update:semver-minor\n- dependency-name: MimeKit\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump MailKit and MimeKit in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-11-01T13:08:17Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "d94a578e0ded9a691b5a7e0fd979709626f0f323",
          "body": "Bumps [xunit](https://github.com/xunit/xunit) from 2.9.1 to 2.9.2.\n- [Commits](https://github.com/xunit/xunit/compare/v2-2.9.1...v2-2.9.2)\n\n---\nupdated-dependencies:\n- dependency-name: xunit\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump xunit from 2.9.1 to 2.9.2 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-10-09T00:48:18Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3b856bd07d0ea67e60839e225cfa6a47ae7c61ae",
          "body": null,
          "is_bot": false,
          "headline": "added login textboxes",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-25T01:16:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1ec821fd4511d67e3e3df8e368129595b34bd492",
          "body": null,
          "is_bot": false,
          "headline": "#76 moved unused Generic library to branch",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-25T01:11:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9d713d49d0059605eabbd554ccb308e29bd41c76",
          "body": null,
          "is_bot": false,
          "headline": "updated package versions",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-25T00:27:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d4ffb8c63a172767377c583f1d77bee81a82299b",
          "body": null,
          "is_bot": false,
          "headline": "missing optional bool in test",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-23T17:18:17Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2a8f23ad2ecad4182ac15079394faafa8eee0bf3",
          "body": null,
          "is_bot": false,
          "headline": "#72 added an option to force a reconnection attempt",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-23T16:24:39Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "789a4d695e2dabeaa6c57db5982632dfab656b9f",
          "body": null,
          "is_bot": false,
          "headline": "Added ToExponentialBackoff for failures",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-09T01:03:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0b3ddf01c27a724834b8882519da5653390df211",
          "body": null,
          "is_bot": false,
          "headline": "#72 fix cancellation token disposed exception",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-08T13:59:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0d0c18c4b0369e355aa24a663923308824f518fc",
          "body": "Removed double link.",
          "is_bot": false,
          "headline": "Update README.md",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-09-03T11:56:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6bc82dd5f9e344031f35903a97c62e52c5b9d44a",
          "body": "Bumps [Microsoft.NET.Test.Sdk](https://github.com/microsoft/vstest) from 17.10.0 to 17.11.0.\n- [Release notes](https://github.com/microsoft/vstest/releases)\n- [Changelog](https://github.com/microsoft/vstest/blob/main/docs/releases.md)\n- [Commits](https://github.com/microsoft/vstest/compare/v17.10.0.\n[…]\nupdated-dependencies:\n- dependency-name: Microsoft.NET.Test.Sdk\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump Microsoft.NET.Test.Sdk from 17.10.0 to 17.11.0 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-09-01T09:04:12Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "cbbd242fd42e9fad234eb9bb85949db41b934dae",
          "body": null,
          "is_bot": false,
          "headline": "#72 fixed alt idle task initialization",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-27T00:28:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9a0b34d704b05937af304175e7d824100cfa51a9",
          "body": null,
          "is_bot": false,
          "headline": "#72 added option to disable exception handling on idle client",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-25T03:23:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b5577df9107621e6327ff374246a0dd42fe51cf0",
          "body": null,
          "is_bot": false,
          "headline": "#73 re-read flag change email before returning it",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-23T00:21:31Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dd31382c808f15c4dd38bb88e9c46ac83860d487",
          "body": null,
          "is_bot": false,
          "headline": "#73 Add a handler for the IMailFolder.MessageFlagsChanged event",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-22T14:11:42Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7b4b1fc04f59b7b546c23a9ab028d020e75adbff",
          "body": null,
          "is_bot": false,
          "headline": "#72 removed cancel from move",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-21T14:19:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e881f9b3efe92d3d697358e53c3ab912a43a59b7",
          "body": null,
          "is_bot": false,
          "headline": "#72 added SocketException reconnect retry",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-10T16:49:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "087f638b878017318efea39051958c3d0f130f27",
          "body": null,
          "is_bot": false,
          "headline": "#72 added retry to arrival and departure queues",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-07T17:01:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2575e8b0e971e4456d3d8e3dc4b7ab95be996aa5",
          "body": null,
          "is_bot": false,
          "headline": "#72 changed error to a warning",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-07T15:55:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d03f07a33eaf897fbcc7c1bfa13063193db4e0c9",
          "body": null,
          "is_bot": false,
          "headline": "Fixed cached source folder in move method #70",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-05T17:23:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d0acdd14812a5bf7139ebbf51df6e1b4a97c49df",
          "body": null,
          "is_bot": false,
          "headline": "Removed MailFolderCache",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-01T15:36:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "173e5008b2eaab0439fe6af1e022e3fd471fd7c7",
          "body": null,
          "is_bot": false,
          "headline": "GetFolderAsync with createIfNotFound option",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-01T15:25:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4abe3f37c11f4b37f84ee4413f44f3d0c14f7160",
          "body": "….Top and Range to use int.",
          "is_bot": false,
          "headline": "#70 simplified the internal move methods. Also simplified IMailReader…",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-08-01T14:59:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "10ade21c497a00992287abc384cbe0392cebee3f",
          "body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 1.1.1 to 3.0.0.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/compare/v1.1.1...v3.0.0)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump gittools/actions from 1.1.1 to 3.0.0",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-08-01T01:40:16Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e7cacc0ebe6cb82561448e172433c81cea962162",
          "body": null,
          "is_bot": false,
          "headline": "#70 fix null source folder",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-07-30T16:42:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ae5ecea08b18cc4044bf6e23edef6c0081b23d39",
          "body": "Bumps [System.IO.Abstractions](https://github.com/TestableIO/System.IO.Abstractions) from 21.0.2 to 21.0.22.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v21.0.2...v21.0.22)\n\n---\nupdated-dependencies:\n- dependency-name: System.IO.Abstractions\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump System.IO.Abstractions from 21.0.2 to 21.0.22 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-07-30T16:41:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4639d560d28db2c078a86c388f6844944e5dcc1e",
          "body": null,
          "is_bot": false,
          "headline": "Clean up for #63, part 2",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-22T15:10:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bb33f9f5ae93290e1750ef1d781653f60cd1114e",
          "body": null,
          "is_bot": false,
          "headline": "Fixed tests",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-22T08:06:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8e803f7bb4c7e83fe5e564494391e5de4f762567",
          "body": null,
          "is_bot": false,
          "headline": "Fixed MoveToAsync for #68",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-22T07:13:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9eac41196b35c24c96635571d50da846026a57bc",
          "body": null,
          "is_bot": false,
          "headline": "Improved GetMailFolderNamesAsync for #68",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-22T06:23:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9b2ad4eff29e3e65c7612b1a01bd62cfc2bad774",
          "body": null,
          "is_bot": false,
          "headline": "Bug fixes for #63, part 1",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-19T17:11:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "256569b5b5d9a023328e38418d246df959a7e051",
          "body": null,
          "is_bot": false,
          "headline": "Updated sample to use _mailFolderCache.GetMailFolderAsync",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-10T07:02:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2b3c3e185f32811f4b14da5d4d15a04e78738a00",
          "body": null,
          "is_bot": false,
          "headline": "Added MailFolderCache",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-10T01:35:05Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b5ca1539cc7d25e63c71c2157897fa06b8c9dd7d",
          "body": null,
          "is_bot": false,
          "headline": "Added AddWithLifetime for services",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-06-10T01:34:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e4218e55cb51de7b0da720f1bbd07271a738b488",
          "body": "Bumps [xunit](https://github.com/xunit/xunit) from 2.8.0 to 2.8.1.\n- [Commits](https://github.com/xunit/xunit/compare/2.8.0...2.8.1)\n\n---\nupdated-dependencies:\n- dependency-name: xunit\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump xunit from 2.8.0 to 2.8.1 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-06-01T06:49:01Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ce6f0c70e2195361260a6d7837343106cfa9a58b",
          "body": null,
          "is_bot": false,
          "headline": "Removed MemoryCache from ImapReceiverFactory",
          "author_name": "Sylar-A",
          "author_login": "Sylar-A",
          "committed_at": "2024-05-25T09:19:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f0a191510082e86d3b39e6b53d3f74b4eb998401",
          "body": "…c to MailFolderClient.MoveToAsync",
          "is_bot": false,
          "headline": "Renamed GetOrCreateFolderAsync and moved IImapReceiver.MoveToSentAsyn…",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-05-17T00:38:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c4e724534dd5f652820f0b5a0686d7de55bec8bc",
          "body": null,
          "is_bot": false,
          "headline": "Added GetOrCreateMailFolderAsync()",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-05-16T14:30:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "315be469d8d74c399985f54b90481a7eec788def",
          "body": null,
          "is_bot": false,
          "headline": "Made GetOrCreateSubfolderAsync an extension of IMailFolder",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-05-16T00:58:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "abe85950199b690002bdb0e1448f4f3e65e9bd5f",
          "body": null,
          "is_bot": false,
          "headline": "Added GetOrCreateSubfolderAsync to MailFolderClient",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-05-16T00:48:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4680ab7afd2edb8468e2bcc692448ca5b1815d84",
          "body": null,
          "is_bot": false,
          "headline": "Removed net6.0 and net7.0 from TargetFrameworks",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-05-01T10:33:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1edfae8bd4251aa5b29defd3d15667c0d1b7a44f",
          "body": null,
          "is_bot": false,
          "headline": "Updated all packages to latest versions",
          "author_name": "Daniel Collingwood",
          "author_login": "danzuep",
          "committed_at": "2024-05-01T10:33:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bbc3acc2169ca77437584e22ce7136826cc4410d",
          "body": "Bumps [System.IO.Abstractions](https://github.com/TestableIO/System.IO.Abstractions) from 20.0.15 to 21.0.2.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v20.0.15...v21.0.2)\n\n---\nupdated-dependencies:\n- dependency-name: System.IO.Abstractions\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump System.IO.Abstractions from 20.0.15 to 21.0.2 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-05-01T10:33:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bd3eaee6f5059a91679b82530d18702a74c987e9",
          "body": "Bumps [marocchino/sticky-pull-request-comment](https://github.com/marocchino/sticky-pull-request-comment) from 2.8.0 to 2.9.0.\n- [Release notes](https://github.com/marocchino/sticky-pull-request-comment/releases)\n- [Commits](https://github.com/marocchino/sticky-pull-request-comment/compare/v2.8.0...\n[…]\ncies:\n- dependency-name: marocchino/sticky-pull-request-comment\n  dependency-type: direct:production\n  update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump marocchino/sticky-pull-request-comment from 2.8.0 to 2.9.0",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-05-01T10:08:33Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "03fc4a0711c82683e18395eafcf42961b82a89cf",
          "body": "Bumps [gittools/actions](https://github.com/gittools/actions) from 0.10.2 to 1.1.1.\n- [Release notes](https://github.com/gittools/actions/releases)\n- [Commits](https://github.com/gittools/actions/compare/v0.10.2...v1.1.1)\n\n---\nupdated-dependencies:\n- dependency-name: gittools/actions\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump gittools/actions from 0.10.2 to 1.1.1",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-04-18T14:51:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6ed4cb55450f01705d2de41c1b793f1e118ea8e3",
          "body": "Bumps [System.IO.Abstractions.TestingHelpers](https://github.com/TestableIO/System.IO.Abstractions) from 20.0.4 to 21.0.2.\n- [Release notes](https://github.com/TestableIO/System.IO.Abstractions/releases)\n- [Commits](https://github.com/TestableIO/System.IO.Abstractions/compare/v20.0.4...v21.0.2)\n\n---\n[…]\nncies:\n- dependency-name: System.IO.Abstractions.TestingHelpers\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump System.IO.Abstractions.TestingHelpers in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-04-18T14:50:03Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "f9dae53dc5de6c937ffba6d0815e14754c0d60d1",
          "body": "Bumps [github/codeql-action](https://github.com/github/codeql-action) from 2 to 3.\n- [Release notes](https://github.com/github/codeql-action/releases)\n- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)\n- [Commits](https://github.com/github/codeql-action/compare/v2...v3)\n\n-\n[…]\n-\nupdated-dependencies:\n- dependency-name: github/codeql-action\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump github/codeql-action from 2 to 3",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-03-02T16:02:22Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "b0dd51250877143a5738a53398d98e608cb3d6ff",
          "body": "Bumps [coverlet.collector](https://github.com/coverlet-coverage/coverlet) from 6.0.0 to 6.0.1.\n- [Release notes](https://github.com/coverlet-coverage/coverlet/releases)\n- [Commits](https://github.com/coverlet-coverage/coverlet/compare/v6.0.0...v6.0.1)\n\n---\nupdated-dependencies:\n- dependency-name: coverlet.collector\n  dependency-type: direct:production\n  update-type: version-update:semver-patch\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump coverlet.collector from 6.0.0 to 6.0.1 in /source",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-03-02T16:01:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3fef0c485aeb06deb91247914e2a181d847cd0e0",
          "body": "Bumps [actions/cache](https://github.com/actions/cache) from 3 to 4.\n- [Release notes](https://github.com/actions/cache/releases)\n- [Changelog](https://github.com/actions/cache/blob/main/RELEASES.md)\n- [Commits](https://github.com/actions/cache/compare/v3...v4)\n\n---\nupdated-dependencies:\n- dependency-name: actions/cache\n  dependency-type: direct:production\n  update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
          "is_bot": true,
          "headline": "Bump actions/cache from 3 to 4",
          "author_name": "dependabot[bot]",
          "author_login": "dependabot[bot]",
          "committed_at": "2024-02-01T03:52:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 36,
      "commits_last_year": 28,
      "latest_release_at": "2026-07-04T18:58:50Z",
      "latest_release_tag": "v2.13.1",
      "releases_from_tags": false,
      "days_since_last_push": 21,
      "active_weeks_last_year": 16,
      "days_since_latest_release": 21,
      "mean_days_between_releases": 77.4
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 42,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "MailKitSimplified.Sender",
          "exists": true,
          "license": null,
          "keywords": [
            "SMTP",
            "MailKit",
            "email",
            "sender",
            "send",
            "simply",
            "easily",
            "simple",
            "easy",
            "fluent",
            "C#",
            ".NET"
          ],
          "ecosystem": "nuget",
          "matches_repo": true,
          "registry_url": "https://www.nuget.org/packages/MailKitSimplified.Sender",
          "is_deprecated": false,
          "latest_version": "2.13.1",
          "repository_url": "https://github.com/danzuep/MailKitSimplified",
          "versions_count": 45,
          "total_downloads": 80196,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": null,
          "first_published_at": null,
          "latest_published_at": "2026-07-04T19:00:06.510000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 21
        },
        {
          "name": "MailKitSimplified.Receiver",
          "exists": true,
          "license": null,
          "keywords": [
            "IMAP",
            "MailKit",
            "email",
            "receiver",
            "receive",
            "forward",
            "reply",
            "simply",
            "easily",
            "simple",
            "easy",
            "fluent",
            "C#",
            ".NET"
          ],
          "ecosystem": "nuget",
          "matches_repo": true,
          "registry_url": "https://www.nuget.org/packages/MailKitSimplified.Receiver",
          "is_deprecated": false,
          "latest_version": "2.13.1",
          "repository_url": "https://github.com/danzuep/MailKitSimplified",
          "versions_count": 34,
          "total_downloads": 47404,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": null,
          "first_published_at": null,
          "latest_published_at": "2026-07-04T19:00:06.107000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 21
        }
      ]
    },
    "popularity": {
      "forks": 13,
      "stars": 95,
      "watchers": 4,
      "fork_history": {
        "days": [
          {
            "date": "2023-04-05",
            "count": 1
          },
          {
            "date": "2023-07-08",
            "count": 1
          },
          {
            "date": "2023-07-31",
            "count": 1
          },
          {
            "date": "2023-10-23",
            "count": 1
          },
          {
            "date": "2023-10-24",
            "count": 1
          },
          {
            "date": "2023-12-01",
            "count": 1
          },
          {
            "date": "2023-12-18",
            "count": 1
          },
          {
            "date": "2024-05-24",
            "count": 1
          },
          {
            "date": "2024-08-04",
            "count": 1
          },
          {
            "date": "2024-09-02",
            "count": 1
          },
          {
            "date": "2025-08-26",
            "count": 1
          },
          {
            "date": "2025-10-19",
            "count": 1
          },
          {
            "date": "2025-12-09",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 13,
        "total_forks": 13
      },
      "star_history": null,
      "open_issues_and_prs": 0
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [
        "samples"
      ],
      "has_llms_txt": false,
      "has_dockerfile": true,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": true,
      "typecheck_configs": [],
      "toolchain_manifests": [
        "samples/ConsoleServiceExample/ConsoleServiceExample.csproj",
        "samples/EmailWpfApp/EmailWpfApp.csproj",
        "samples/ExporterExample/ExporterExample.csproj",
        "samples/MonitorMultipleMailFolders/MonitorMultipleMailFolders.csproj",
        "samples/WebApiExample/WebApiExample.csproj",
        "samples/WorkerServiceExample/WorkerServiceExample.csproj",
        "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
        "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
        "tests/MailKitSimplified.Receiver.Tests/MailKitSimplified.Receiver.Tests.csproj",
        "tests/MailKitSimplified.Sender.Tests/MailKitSimplified.Sender.Tests.csproj"
      ],
      "largest_source_bytes": 35241,
      "source_files_sampled": 105,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [
          {
            "name": "OpenTelemetry.Exporter.OpenTelemetryProtocol",
            "direct": false,
            "version": "1.15.0",
            "severity": "moderate",
            "ecosystem": "nuget",
            "cvss_score": 6.5,
            "advisory_ids": [
              "GHSA-4625-4j76-fww9",
              "GHSA-mr8r-92fq-pj8p",
              "GHSA-q834-8qmm-v933"
            ],
            "fixed_version": "1.15.3",
            "advisory_count": 3,
            "oldest_advisory_days": 93
          }
        ],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {
          "moderate": 1
        },
        "advisory_count": 3,
        "affected_count": 1,
        "assessed_count": 42,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 12,
        "direct_affected_count": 0
      },
      "ecosystems": [],
      "dependencies": [
        {
          "name": "MailKit",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "MimeKit",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Caching.Memory",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Caching.Abstractions",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Configuration.Abstractions",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Logging",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Options.ConfigurationExtensions",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "System.ComponentModel.Annotations",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "System.IO.Abstractions",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "System.Text.Json",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Logging.Debug",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Logging.Console",
          "manifest": "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "MailKit",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "MimeKit",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Configuration.Abstractions",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Logging",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Options.ConfigurationExtensions",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "System.ComponentModel.Annotations",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "System.IO.Abstractions",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Logging.Debug",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        },
        {
          "name": "Microsoft.Extensions.Logging.Console",
          "manifest": "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
          "ecosystem": "nuget",
          "version_constraint": null
        }
      ],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "MailKit",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Caching.Abstractions",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Caching.Memory",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Configuration.Abstractions",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Logging",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Logging",
            "direct": true,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Logging.Console",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Logging.Console",
            "direct": true,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Logging.Debug",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Logging.Debug",
            "direct": true,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Options.ConfigurationExtensions",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "MimeKit",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "System.ComponentModel.Annotations",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "System.IO.Abstractions",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "System.IO.Abstractions",
            "direct": true,
            "version": "22.1.0",
            "ecosystem": "nuget"
          },
          {
            "name": "System.Text.Json",
            "direct": true,
            "version": null,
            "ecosystem": "nuget"
          },
          {
            "name": "Asp.Versioning.Mvc",
            "direct": false,
            "version": "8.1.1",
            "ecosystem": "nuget"
          },
          {
            "name": "Asp.Versioning.Mvc.ApiExplorer",
            "direct": false,
            "version": "8.1.1",
            "ecosystem": "nuget"
          },
          {
            "name": "CommunityToolkit.Common",
            "direct": false,
            "version": "8.4.0",
            "ecosystem": "nuget"
          },
          {
            "name": "CommunityToolkit.Diagnostics",
            "direct": false,
            "version": "8.4.0",
            "ecosystem": "nuget"
          },
          {
            "name": "CommunityToolkit.Mvvm",
            "direct": false,
            "version": "8.4.0",
            "ecosystem": "nuget"
          },
          {
            "name": "coverlet.collector",
            "direct": false,
            "version": "10.0.1",
            "ecosystem": "nuget"
          },
          {
            "name": "CsvHelper",
            "direct": false,
            "version": "33.1.0",
            "ecosystem": "nuget"
          },
          {
            "name": "MailKitSimplified.Receiver",
            "direct": false,
            "version": "2.12.0",
            "ecosystem": "nuget"
          },
          {
            "name": "MailKitSimplified.Sender",
            "direct": false,
            "version": "2.12.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.EntityFrameworkCore.Sqlite",
            "direct": false,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Configuration.CommandLine",
            "direct": false,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.DependencyInjection.Abstractions",
            "direct": false,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Hosting",
            "direct": false,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Http.Polly",
            "direct": false,
            "version": "10.0.3",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Extensions.Http.Resilience",
            "direct": false,
            "version": "10.3.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.Identity.Web",
            "direct": false,
            "version": "4.5.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.NET.Test.Sdk",
            "direct": false,
            "version": "18.3.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Microsoft.VisualStudio.Azure.Containers.Tools.Targets",
            "direct": false,
            "version": "1.23.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Moq",
            "direct": false,
            "version": "4.20.72",
            "ecosystem": "nuget"
          },
          {
            "name": "Newtonsoft.Json",
            "direct": false,
            "version": "13.0.4",
            "ecosystem": "nuget"
          },
          {
            "name": "NSwag.ApiDescription.Client",
            "direct": false,
            "version": "14.6.3",
            "ecosystem": "nuget"
          },
          {
            "name": "OpenTelemetry.Exporter.Console",
            "direct": false,
            "version": "1.15.0",
            "ecosystem": "nuget"
          },
          {
            "name": "OpenTelemetry.Exporter.OpenTelemetryProtocol",
            "direct": false,
            "version": "1.15.0",
            "ecosystem": "nuget"
          },
          {
            "name": "OpenTelemetry.Extensions.Hosting",
            "direct": false,
            "version": "1.15.0",
            "ecosystem": "nuget"
          },
          {
            "name": "OpenTelemetry.Instrumentation.AspNetCore",
            "direct": false,
            "version": "1.15.0",
            "ecosystem": "nuget"
          },
          {
            "name": "OpenTelemetry.Instrumentation.Http",
            "direct": false,
            "version": "1.15.0",
            "ecosystem": "nuget"
          },
          {
            "name": "OpenTelemetry.Instrumentation.Runtime",
            "direct": false,
            "version": "1.15.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Polly",
            "direct": false,
            "version": "8.6.6",
            "ecosystem": "nuget"
          },
          {
            "name": "Polly.Contrib.WaitAndRetry",
            "direct": false,
            "version": "1.1.1",
            "ecosystem": "nuget"
          },
          {
            "name": "Serilog.AspNetCore",
            "direct": false,
            "version": "10.0.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Serilog.Enrichers.Environment",
            "direct": false,
            "version": "3.0.1",
            "ecosystem": "nuget"
          },
          {
            "name": "Serilog.Extensions.Logging",
            "direct": false,
            "version": "10.0.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Serilog.Sinks.Async",
            "direct": false,
            "version": "2.1.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Serilog.Sinks.OpenTelemetry",
            "direct": false,
            "version": "4.2.0",
            "ecosystem": "nuget"
          },
          {
            "name": "Swashbuckle.AspNetCore",
            "direct": false,
            "version": "10.1.4",
            "ecosystem": "nuget"
          },
          {
            "name": "System.IO.Abstractions.TestingHelpers",
            "direct": false,
            "version": "22.1.0",
            "ecosystem": "nuget"
          },
          {
            "name": "xunit.runner.visualstudio",
            "direct": false,
            "version": "3.1.5",
            "ecosystem": "nuget"
          },
          {
            "name": "xunit.v3",
            "direct": false,
            "version": "3.2.2",
            "ecosystem": "nuget"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 54,
        "direct_count": 16,
        "indirect_count": 38
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 60,
        "open_issues": 0,
        "closed_ratio": 1,
        "closed_issues": 33,
        "closed_unmerged_prs": 18
      },
      "bus_factor": 1,
      "bot_contributors": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "danzuep",
          "commits": 363,
          "avatar_url": "https://avatars.githubusercontent.com/u/82693586?v=4"
        },
        {
          "type": "User",
          "login": "OsamaAlRashed",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/61357303?v=4"
        },
        {
          "type": "User",
          "login": "Sylar-A",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/76655052?v=4"
        },
        {
          "type": "User",
          "login": "staoran",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/7844538?v=4"
        }
      ],
      "contributors_sampled": 4,
      "top_contributor_share": 0.992
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "_build-layered.yml",
        "_build-test.yml",
        "_build.yml",
        "_codeql.yml",
        "_deploy-nuget.yml",
        "_pipeline.yml",
        "_version.yml",
        "_version_layered.yml",
        "codeql.yml",
        "development.yml",
        "devops.yml",
        "feature.yml",
        "release.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 3,
            "reason": "branch protection is not maximal on development and all release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "15 out of 15 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/15 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 0,
            "reason": "project has 0 contributing companies or organizations -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 5,
            "reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 7,
            "reason": "SAST tool detected but not run on all commits",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "57416fa62b20b3b0a33bb474b59277b6ac45b572",
        "ran_at": "2026-07-26T01:39:09Z",
        "aggregate_score": 5.1,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": true,
      "has_security_policy": false,
      "has_dependabot_config": true
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-04T19:00:10Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": "2026-07-02T14:52:29Z",
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": []
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/danzuep/MailKitSimplified",
    "host": "github.com",
    "name": "MailKitSimplified",
    "owner": "danzuep"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 62,
      "inputs": {
        "security": 61,
        "vitality": 72,
        "community": 52,
        "governance": 57,
        "engineering": 65
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 72,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 58,
            "inputs": {
              "commits_last_year": 28,
              "human_commit_share": 0.61,
              "days_since_last_push": 21,
              "active_weeks_last_year": 16
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 21 days ago",
                "points": 28.8,
                "status": "partial",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 21
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "16/52 weeks with commits",
                "points": 11.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 16
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "28 commits in the last year",
                "points": 13.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 28
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 5,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 92,
            "inputs": {
              "releases_count": 36,
              "latest_release_tag": "v2.13.1",
              "releases_from_tags": false,
              "days_since_latest_release": 21,
              "mean_days_between_releases": 77.4
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "36 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 36
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 21 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 21
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~77.4 days",
                "points": 19.8,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 77.4
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "maintained",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 139,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "last human commit 139 days ago",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_maintained",
                    "params": {
                      "days": 139
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 52,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "at_risk",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "forks": 13,
              "stars": 95,
              "watchers": 4,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "95 stars",
                "points": 32,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 95
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "13 forks",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 13
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "4 watchers",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 66,
            "inputs": {
              "packages": [
                "MailKitSimplified.Sender",
                "MailKitSimplified.Receiver"
              ],
              "dependents": null,
              "ecosystems": "nuget",
              "total_downloads": 127600,
              "monthly_downloads": null
            },
            "components": [
              {
                "key": "total_downloads",
                "name": "Total downloads",
                "detail": "127,600 downloads all-time across nuget",
                "points": 53.1,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_total",
                    "params": {
                      "count": 127600,
                      "ecosystems": "nuget"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 57,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 15,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 4,
              "top_contributor_share": 0.992
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 99% of commits",
                "points": 0.2,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 99
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "4 contributors",
                "points": 5.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "good",
            "name": "Issue & PR responsiveness",
            "note": null,
            "notes": [],
            "value": 76,
            "inputs": {
              "merged_prs": 60,
              "open_issues": 0,
              "closed_issues": 33,
              "issue_closed_ratio": 1,
              "closed_unmerged_prs": 18
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "100% of issues closed",
                "points": 46.8,
                "status": "met",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "60/78 decided PRs merged",
                "points": 29.4,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 60,
                      "decided": 78
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/15 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "verified_domain"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 53,
            "inputs": {
              "followers": 24,
              "owner_type": "User",
              "is_verified": null,
              "owner_login": "danzuep",
              "public_repos": 41,
              "account_age_days": 1925
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "personal (user) account",
                "points": 10,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_personal",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": "not applicable to user accounts",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_applicable_to_user_accounts",
                    "params": {}
                  }
                ],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "24 followers of danzuep",
                "points": 10.1,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 24,
                      "login": "danzuep"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "41 public repos, account ~5 yr old",
                "points": 22.4,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 41
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 5
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "MailKitSimplified.Sender",
                "MailKitSimplified.Receiver"
              ],
              "ecosystems": "nuget",
              "any_deprecated": false,
              "min_days_since_publish": 21
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "2 package(s) on nuget",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 2,
                      "ecosystems": "nuget"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 21 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 21
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "45 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 45
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "moderate",
        "name": "Engineering Quality",
        "value": 65,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "moderate",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "13 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 13
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "15 out of 15 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 60,
            "inputs": {
              "topics": [
                "email",
                "fluent",
                "imap",
                "mail",
                "smtp",
                "asynchronous",
                "csharp",
                "dependency-injection",
                "devops-enabled",
                "unit-tested",
                "imap-client",
                "smtp-client",
                "email-reader",
                "email-receiver",
                "email-sender",
                "mailer"
              ],
              "has_wiki": true,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "16 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 16
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 61,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "moderate",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 51,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 16,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 2,
              "scorecard_aggregate": 5.1
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection is not maximal on development and all release branches",
                "points": 2.2,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "15 out of 15 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/15 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 3.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool detected but not run on all commits",
                "points": 3.5,
                "status": "partial",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 42 resolved dependencies against OSV; 12 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 42
                }
              },
              {
                "code": "advisories_unassessed",
                "params": {
                  "count": 12
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 3,
              "affected_packages": 1,
              "assessed_packages": 42,
              "unassessed_packages": 12,
              "affected_by_severity": "moderate 1",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 42,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 2
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 52,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 18,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0.344,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "21 of 61 human commits state their intent (structured subject or explanatory body)",
                "points": 18.4,
                "status": "partial",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 21,
                      "sampled": 61
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "moderate",
            "name": "Verify loop (build / test / typecheck)",
            "note": null,
            "notes": [],
            "value": 64,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": true,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": true,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": 0,
              "toolchain_manifests": [
                "samples/ConsoleServiceExample/ConsoleServiceExample.csproj",
                "samples/EmailWpfApp/EmailWpfApp.csproj",
                "samples/ExporterExample/ExporterExample.csproj",
                "samples/MonitorMultipleMailFolders/MonitorMultipleMailFolders.csproj",
                "samples/WebApiExample/WebApiExample.csproj",
                "samples/WorkerServiceExample/WorkerServiceExample.csproj",
                "source/MailKitSimplified.Receiver/MailKitSimplified.Receiver.csproj",
                "source/MailKitSimplified.Sender/MailKitSimplified.Sender.csproj",
                "tests/MailKitSimplified.Receiver.Tests/MailKitSimplified.Receiver.Tests.csproj",
                "tests/MailKitSimplified.Sender.Tests/MailKitSimplified.Sender.Tests.csproj"
              ],
              "dependency_bot_commit_share": 0.39
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": "samples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj (toolchain convention, no task runner)",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "toolchain_convention",
                    "params": {
                      "files": "samples/ConsoleServiceExample/ConsoleServiceExample.csproj, samples/EmailWpfApp/EmailWpfApp.csproj, samples/ExporterExample/ExporterExample.csproj"
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "C# (statically typed)",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "C#"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "devcontainer, Dockerfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "devcontainer, Dockerfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no agent-authored commits among the last 100",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_authored_commits",
                    "params": {
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "39 of the last 100 commits are automated dependency updates",
                "points": 8,
                "status": "met",
                "details": [
                  {
                    "code": "dependency_bot_commits",
                    "params": {
                      "count": 39,
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "primary_language": "C#",
              "largest_source_bytes": 35241,
              "source_files_sampled": 105,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "C# (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "C#"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/105 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 105,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          },
          {
            "key": "ai_interfaces",
            "band": "at_risk",
            "name": "Machine-readable interfaces",
            "note": null,
            "notes": [],
            "value": 40,
            "inputs": {
              "example_dirs": [
                "samples"
              ],
              "has_mcp_signal": false,
              "api_schema_files": []
            },
            "components": [
              {
                "key": "api_schema_openapi_graphql_proto",
                "name": "API schema (OpenAPI/GraphQL/proto)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 40
              },
              {
                "key": "mcp_server",
                "name": "MCP server",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "runnable_examples",
                "name": "Runnable examples",
                "detail": "samples",
                "points": 40,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "samples"
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-26T01:39:21.140661Z",
  "schema_version": "0.27.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/d/danzuep/MailKitSimplified.svg",
  "full_name": "danzuep/MailKitSimplified",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.27.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasNuGet.