Public record
Software health reportschema 0.27.0 · metrics 1.13.0 · 2026-07-22 22:29 UTC

inspect-js / is-data-view

Is this value a JS DataView? This module works cross-realm/iframe, does not depend on instanceof or mutable properties, and despite ES6 Symbol.toStringTag.

JavaScriptMIT★ 2 stars⑂ 1 forksince Jan 2024View on GitHub ↗

inspect-js/is-data-view holds a health index of 45 out of 100, placing it in the At risk band. It scores highest on Engineering Quality (73/100) and lowest on Vitality (17/100). It was last updated 580 days ago. A single contributor accounts for most of its recent work.

45
overall / 100
At risk

Software health index

Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.

45
Excellent85-100Exemplary; meets essentially all checked criteria
Good70-84Healthy; minor gaps
Moderate50-69Acceptable with notable gaps; review recommended
At risk30-49Significant weaknesses; adoption warrants caution
Critical1-29Severe problems (abandoned, single-maintainer, no hygiene)
VitalityCommunity &AdoptionSustainability &GovernanceEngineeringQualitySecurityAI Readiness

Score profile

Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.

Ownership

Inspect JSOrganization
54 followers83 public repossince Aug 2019

This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.

Package ecosystems

RegistryPackageVersionDownloads / moVersionsLast publishTags
npmis-data-view1.0.2280,473,6413587 days agojavascriptecmascriptdataviewdataviewtypedarraytypedarrays

Metrics by category

Vitality

Is the project alive — is code being written and are releases shipping?

17Critical · 22% of overall
How it's scored
0/36Push recency — last push 580 days ago
0/36Commit cadence — 0/52 weeks with commits
0/18Commit volume — 0 commits in the last year
0/10OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
Inputs used
commits_last_year0
human_commit_share1
days_since_last_push580
active_weeks_last_year0
How it's scored
16.2/27Ships releases — 3 version tags (no GitHub releases)
7.2/36Release recency — latest release 587 days ago
12.6/27Release cadence — a release every ~157.7 days
0/10OpenSSF Scorecard: Signed-Releases — no data
Inputs used
releases_count3
latest_release_tagv1.0.2
releases_from_tagsyes
days_since_latest_release587
mean_days_between_releases157.7
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.

Community & Adoption

Does the project have users, downloads, attention, and a welcoming setup for contributors?

55Moderate · 18% of overall
How it's scored
0/60Stars — 2 stars
0/25Forks — 1 forks
0/15Watchers — 1 watchers
Inputs used
forks1
stars2
watchers1
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history

Community health

85Excellent
How it's scored
22.5/22.5README
22.5/22.5License — recognized license (MIT)
18/18CONTRIBUTING guide
13.5/13.5Code of conduct
0/7.2Issue template
0/6.3PR template
Inputs used
has_readmeyes
has_licenseyes
has_contributingyes
has_issue_templateno
has_code_of_conductyes
has_pull_request_templateno
How it's scored
80/80Monthly downloads — 280,473,641 downloads/month across npm
0/20Registry dependents — not reported by this ecosystem
Inputs used
packagesis-data-view
dependents
ecosystemsnpm
total_downloads
monthly_downloads280,473,641
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.

Sustainability & Governance

Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?

37At risk · 24% of overall
How it's scored
9/54Bus factor — 1 contributor(s) cover half of all commits
0/22.5Commit distribution — top contributor authored 100% of commits
1.4/13.5Contributor breadth — 1 contributors
10/10OpenSSF Scorecard: Contributors — project has 31 contributing companies or organizations
Inputs used
bus_factor1
contributors_sampled1
top_contributor_share1
How it's scored
0/46.8Issue resolution — 0% of issues closed
0/38.3PR acceptance — no decided pull requests or no data
0/15OpenSSF Scorecard: Code-Review — Found 0/20 approved changesets -- score normalized to 0
Inputs used
merged_prs0
open_issues1
closed_issues0
issue_closed_ratio0
closed_unmerged_prs0
Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.
How it's scored
30/30Ownership backing — organization-owned
0/20Verified domain
12.5/25Owner reach — 54 followers of inspect-js
25/25Track record — 83 public repos, account ~6 yr old
Inputs used
followers54
owner_typeOrganization
is_verified
owner_logininspect-js
public_repos83
account_age_days2,535
How it's scored
25/25Published & resolvable — 1 package(s) on npm
14/35Publish recency — latest publish 587 days ago
12/20Version history — 3 published versions
20/20Not deprecated — active, not deprecated or yanked
Inputs used
packagesis-data-view
ecosystemsnpm
any_deprecatedno
min_days_since_publish587

Engineering Quality

Are baseline engineering and documentation practices in place?

73Good · 20% of overall
How it's scored
24/24CI workflows — 6 workflow(s)
24/24Tests present
16/16Linter config — .eslintrc
0/9.6Pre-commit hooks
6.4/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — no data
Inputs used
has_ciyes
has_testsyes
has_editorconfigyes
has_linter_configyes
has_precommit_configno
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.

Documentation

50Moderate
How it's scored
30/30README
0/25Documentation directory
0/15Documentation / homepage site
10/10Repository description
10/10Topics — 7 topics
0/10Wiki
Inputs used
topicsdata, dataview, ecmascript, javascript, typedarray, typedarrays, view
has_wikino
homepage
has_readmeyes
has_docs_dirno
has_descriptionyes

Security

Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?

51Moderate · 16% of overall
How it's scored
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
0/2.5CI-Tests — no data
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/20 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 31 contributing companies or organizations
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5License — license file detected
0/7.5Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
0/5Packaging — no data
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — no SAST tool detected
5/5Security-Policy — security policy file detected
0/7.5Signed-Releases — no data
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Inputs used
sourceopenssf_scorecard
checks_evaluated15
scorecard_versionv5.5.0
checks_inconclusive3
scorecard_aggregate3.9
Excluded from scoring (no data or not applicable): ci_tests, packaging, signed_releases. Remaining weights renormalized.
How it's scored
35/35Direct dependencies free of known advisories — no direct dependency carries a known advisory
25/25Indirect dependencies free of known advisories — no indirect dependency carries a known advisory
0/40No advisories left outstanding — no advisory carries a publication date
Inputs used
sourceosv
advisories0
affected_packages0
assessed_packages27
unassessed_packages0
affected_by_severitynone
direct_affected_packages0
Excluded from scoring (no data or not applicable): No advisories left outstanding. Remaining weights renormalized. Matched the npm:is-data-view@1.0.2 runtime dependency closure — what installing the published package pulls in — 27 packages. Reachability is not analyzed.

AI Readiness

How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.

36At risk · 0% of overall
How it's scored
0/45Agent instructions — no CLAUDE.md / AGENTS.md / editor rules
0/15Machine-readable docs (llms.txt)
2.7/40Legible commit history — 1 of 20 human commits state their intent (structured subject or explanatory body)
Inputs used
has_llms_txtno
legible_history_share0.05
agent_instruction_files
agent_instruction_max_bytes
How it's scored
0/18One-command bootstrap
22/22Automated tests
11/11Lint / format config — .eslintrc
11/11Static type checking — tsconfig.json
0/10Reproducible environment
0/10Demonstrated agent practice — no agent-authored commits among the last 20
0/8Automated maintenance — no automated dependency updates observed
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Inputs used
has_nixno
has_testsyes
lockfiles
has_dockerfileno
typed_languageno
bootstrap_files
has_devcontainerno
has_linter_configyes
typecheck_configstsconfig.json
agent_commit_share0
toolchain_manifests
dependency_bot_commit_share0
How it's scored
27/45Type-checkable code — JavaScript with type-check config (tsconfig.json)
55/55Manageable file sizes — 0/3 source files over 60KB
Inputs used
primary_languageJavaScript
largest_source_bytes1,542
source_files_sampled3
oversized_source_files0

Key facts

2GitHub stars
1contributors
0commits, last 12 months
580days since last push
3releases
1bus factor
1open issues
npmpackage ecosystems

Data collection warnings

  • Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token

More detail

OpenSSF Scorecard 3.9 / 10
3.9aggregate

Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).Scorecard v5.5.0 · 2026-07-22 22:29 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
n/aCI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/20 approved changesets -- score normalized to 0
10Contributorsproject has 31 contributing companies or organizations
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintained0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
n/aPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTno SAST tool detected
10Security-Policysecurity policy file detected
n/aSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Direct dependencies 3
RegistryPackageVersion constraintManifest
npmcall-bound^1.0.3package.json
npmget-intrinsic^1.2.6package.json
npmis-typed-array^1.1.15package.json
All dependencies 31

Full resolved dependency set from the GitHub dependency graph: 3 direct and 28 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.

RegistryPackageVersionRelation
npmcall-bound^1.0.3direct
npmget-intrinsic^1.2.6direct
npmis-typed-array^1.1.15direct
npm@arethetypeswrong/cli^0.17.1indirect
npm@ljharb/eslint-config^21.1.1indirect
npm@ljharb/tsconfig^0.2.2indirect
npm@types/call-bind^1.0.5indirect
npm@types/es-value-fixtures^1.4.4indirect
npm@types/for-each^0.3.3indirect
npm@types/make-arrow-function^1.2.2indirect
npm@types/make-generator-function^2.0.3indirect
npm@types/node^20.17.10indirect
npm@types/object-inspect^1.13.0indirect
npm@types/tape^5.8.0indirect
npmauto-changelog^2.5.0indirect
npmavailable-typed-arrays^1.0.7indirect
npmencoding^0.1.13indirect
npmes-value-fixtures^1.5.0indirect
npmeslint8.8.0indirect
npmevalmd^0.0.19indirect
npmfor-each^0.3.3indirect
npmhas-tostringtag^1.0.2indirect
npmin-publish^2.0.1indirect
npmmake-arrow-function^1.2.0indirect
npmmake-generator-function^2.0.0indirect
npmnpmignore^0.3.1indirect
npmnyc^10.3.2indirect
npmobject-inspect^1.13.3indirect
npmsafe-publish-latest^2.0.0indirect
npmtape^5.9.0indirect
npmtypescriptnextindirect
Dependency advisories 0

Installing npm:is-data-view@1.0.2 pulls in 27 packages, direct and transitive: 0 carry known advisories, of which 0 are direct dependencies.

No known advisories affect the assessed dependencies.

An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.

Raw JSON report machine-readable
{
  "data": {
    "repo": {
      "topics": [
        "data",
        "dataview",
        "ecmascript",
        "javascript",
        "typedarray",
        "typedarrays",
        "view"
      ],
      "is_fork": false,
      "size_kb": 37,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 2389
      },
      "pushed_at": "2024-12-19T19:53:26Z",
      "created_at": "2024-01-31T20:38:09Z",
      "owner_type": "Organization",
      "updated_at": "2024-12-19T19:53:29Z",
      "description": "Is this value a JS DataView? This module works cross-realm/iframe, does not depend on instanceof or mutable properties, and despite ES6 Symbol.toStringTag.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript"
      ]
    },
    "owner": {
      "blog": null,
      "name": "Inspect JS",
      "type": "Organization",
      "login": "inspect-js",
      "company": null,
      "location": null,
      "followers": 54,
      "avatar_url": "https://avatars.githubusercontent.com/u/54056128?v=4",
      "created_at": "2019-08-13T06:36:36Z",
      "is_verified": null,
      "public_repos": 83,
      "account_age_days": 2535
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.0.2",
          "kind": "patch",
          "published_at": "2024-12-12T05:43:44Z"
        },
        {
          "tag": "v1.0.1",
          "kind": "patch",
          "published_at": "2024-02-02T16:51:22Z"
        },
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2024-01-31T22:16:28Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "bd9c914704dfdcea50dc61fc5c4e43d30e50e34d",
          "body": null,
          "is_bot": false,
          "headline": "[Deps] update `call-bound`, `is-typed-array`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-19T19:52:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0f248fc4ff1ab521149267f682f024f41c06c58d",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@types/tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-19T19:52:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "30aa89d46be4424bd6370f4b470810d3955b737a",
          "body": null,
          "is_bot": false,
          "headline": "[Tests] add attw",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-19T19:51:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e8a4943b72a33a075c6f9fd31f4e9e8a53e15b02",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.2",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T05:43:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34de4b5f5448ca1bb95c34686c51b5351904a317",
          "body": null,
          "is_bot": false,
          "headline": "[Fix] add missing dependencies; use `call-bound` directly",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:35:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3d302d7dbf99d75fcf4a3de14687e423ec88728f",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] add missing peer dep",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:34:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6f8e9dda376e421d30dd94e891bea3fbae7967ee",
          "body": "…s/node`, `@types/object-inspect`, `@types/tape`, `auto-changelog`, `es-value-fixtures`, `object-inspect`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `@ljharb/eslint-config`, `@ljharb/tsconfig`, `@type…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:33:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e2f37fdf421c4629730406c2b61d5481dce4e448",
          "body": null,
          "is_bot": false,
          "headline": "[actions] split out node 10-20, and 20+",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:32:39Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "aa7060ad77c9ba2d500b124b73662c3b069fc721",
          "body": null,
          "is_bot": false,
          "headline": "[Tests] replace `aud` with `npm audit`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:32:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3a800720dd322ea4656f29d28f1d28117fb94537",
          "body": null,
          "is_bot": false,
          "headline": "[types] use shared config",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-03-11T04:59:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "37be59163c8df9abb016bbb4c7d76f3af549f1d2",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@types/node`, `available-typed-arrays`, `tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-03-11T04:56:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2a35354be23b672154070c766bdf857eb4e8990b",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.1",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T16:51:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c2728ef20064bba2588eed503a0c2e36985b638a",
          "body": null,
          "is_bot": false,
          "headline": "[patch] add types",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T05:23:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2ca9333516afac321431ddae02d6791d50e8d5c2",
          "body": null,
          "is_bot": false,
          "headline": "[Deps] update `is-typed-array`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T05:05:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e7f9ebccf9aacdc112dd4f665271c96417ddfa64",
          "body": "… `npmignore`, `object-inspect`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `aud`, `available-typed-arrays`, `has-tostringtag`,…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T05:05:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "684361510ea1ac6ccbdd7b1fe5940d828af8fb76",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.0",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T22:16:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6f7e4244ae9d766309b8f050c0b786e9c0692825",
          "body": null,
          "is_bot": false,
          "headline": "Initial implementation, tests, readme",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T21:51:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18cde474201a292ebdaa704d232127c814cb1d0e",
          "body": null,
          "is_bot": false,
          "headline": "Only apps should have lockfiles",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T20:42:16Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "25130e2dbecc91d398cf74c39878aa89f5e604ab",
          "body": null,
          "is_bot": false,
          "headline": "npm init",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T20:41:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b7ea57d6942dd268bcda990a96b8cd663b19eb8",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T20:38:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 3,
      "commits_last_year": 0,
      "latest_release_at": "2024-12-12T05:43:44Z",
      "latest_release_tag": "v1.0.2",
      "releases_from_tags": true,
      "days_since_last_push": 580,
      "active_weeks_last_year": 0,
      "days_since_latest_release": 587,
      "mean_days_between_releases": 157.7
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": true,
      "health_percentage": 75,
      "has_issue_template": false,
      "has_code_of_conduct": true,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "is-data-view",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "javascript",
            "ecmascript",
            "dataview",
            "data",
            "view",
            "typedarray",
            "typedarrays"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/is-data-view",
          "is_deprecated": false,
          "latest_version": "1.0.2",
          "repository_url": "https://github.com/inspect-js/is-data-view",
          "versions_count": 3,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 280473641,
          "first_published_at": "2024-01-31T22:20:28.929000Z",
          "latest_published_at": "2024-12-12T05:43:54.162000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 587
        }
      ]
    },
    "popularity": {
      "forks": 1,
      "stars": 2,
      "watchers": 1,
      "fork_history": {
        "days": [
          {
            "date": "2026-05-03",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_forks": 1
      },
      "star_history": null,
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "toolchain_manifests": [],
      "largest_source_bytes": 1542,
      "source_files_sampled": 3,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "published_package",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 27,
        "malicious_count": 0,
        "assessed_package": "npm:is-data-view@1.0.2",
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [
        {
          "name": "call-bound",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^1.0.3"
        },
        {
          "name": "get-intrinsic",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^1.2.6"
        },
        {
          "name": "is-typed-array",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^1.1.15"
        }
      ],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "call-bound",
            "direct": true,
            "version": "^1.0.3",
            "ecosystem": "npm"
          },
          {
            "name": "get-intrinsic",
            "direct": true,
            "version": "^1.2.6",
            "ecosystem": "npm"
          },
          {
            "name": "is-typed-array",
            "direct": true,
            "version": "^1.1.15",
            "ecosystem": "npm"
          },
          {
            "name": "@arethetypeswrong/cli",
            "direct": false,
            "version": "^0.17.1",
            "ecosystem": "npm"
          },
          {
            "name": "@ljharb/eslint-config",
            "direct": false,
            "version": "^21.1.1",
            "ecosystem": "npm"
          },
          {
            "name": "@ljharb/tsconfig",
            "direct": false,
            "version": "^0.2.2",
            "ecosystem": "npm"
          },
          {
            "name": "@types/call-bind",
            "direct": false,
            "version": "^1.0.5",
            "ecosystem": "npm"
          },
          {
            "name": "@types/es-value-fixtures",
            "direct": false,
            "version": "^1.4.4",
            "ecosystem": "npm"
          },
          {
            "name": "@types/for-each",
            "direct": false,
            "version": "^0.3.3",
            "ecosystem": "npm"
          },
          {
            "name": "@types/make-arrow-function",
            "direct": false,
            "version": "^1.2.2",
            "ecosystem": "npm"
          },
          {
            "name": "@types/make-generator-function",
            "direct": false,
            "version": "^2.0.3",
            "ecosystem": "npm"
          },
          {
            "name": "@types/node",
            "direct": false,
            "version": "^20.17.10",
            "ecosystem": "npm"
          },
          {
            "name": "@types/object-inspect",
            "direct": false,
            "version": "^1.13.0",
            "ecosystem": "npm"
          },
          {
            "name": "@types/tape",
            "direct": false,
            "version": "^5.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "auto-changelog",
            "direct": false,
            "version": "^2.5.0",
            "ecosystem": "npm"
          },
          {
            "name": "available-typed-arrays",
            "direct": false,
            "version": "^1.0.7",
            "ecosystem": "npm"
          },
          {
            "name": "encoding",
            "direct": false,
            "version": "^0.1.13",
            "ecosystem": "npm"
          },
          {
            "name": "es-value-fixtures",
            "direct": false,
            "version": "^1.5.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint",
            "direct": false,
            "version": "8.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "evalmd",
            "direct": false,
            "version": "^0.0.19",
            "ecosystem": "npm"
          },
          {
            "name": "for-each",
            "direct": false,
            "version": "^0.3.3",
            "ecosystem": "npm"
          },
          {
            "name": "has-tostringtag",
            "direct": false,
            "version": "^1.0.2",
            "ecosystem": "npm"
          },
          {
            "name": "in-publish",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "make-arrow-function",
            "direct": false,
            "version": "^1.2.0",
            "ecosystem": "npm"
          },
          {
            "name": "make-generator-function",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "npmignore",
            "direct": false,
            "version": "^0.3.1",
            "ecosystem": "npm"
          },
          {
            "name": "nyc",
            "direct": false,
            "version": "^10.3.2",
            "ecosystem": "npm"
          },
          {
            "name": "object-inspect",
            "direct": false,
            "version": "^1.13.3",
            "ecosystem": "npm"
          },
          {
            "name": "safe-publish-latest",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "tape",
            "direct": false,
            "version": "^5.9.0",
            "ecosystem": "npm"
          },
          {
            "name": "typescript",
            "direct": false,
            "version": "next",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 31,
        "direct_count": 3,
        "indirect_count": 28
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 0,
        "open_issues": 1,
        "closed_ratio": 0,
        "closed_issues": 0,
        "closed_unmerged_prs": 0
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "ljharb",
          "commits": 20,
          "avatar_url": "https://avatars.githubusercontent.com/u/45469?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "node-aught.yml",
        "node-pretest.yml",
        "node-tens.yml",
        "node-twenties.yml",
        "rebase.yml",
        "require-allow-edits.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [
        ".eslintrc"
      ],
      "has_editorconfig": true,
      "has_linter_config": true,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/20 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 31 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 10,
            "reason": "security policy file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "bd9c914704dfdcea50dc61fc5c4e43d30e50e34d",
        "ran_at": "2026-07-22T22:29:23Z",
        "aggregate_score": 3.9,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-16T06:53:55Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": null,
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": [
        {
          "number": 1,
          "created_at": "2024-01-31T20:38:24Z",
          "last_comment_at": null,
          "last_comment_author": null
        }
      ]
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/inspect-js/is-data-view",
    "host": "github.com",
    "name": "is-data-view",
    "owner": "inspect-js"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 45,
      "inputs": {
        "security": 51,
        "vitality": 17,
        "community": 55,
        "governance": 37,
        "engineering": 73
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "critical",
        "name": "Vitality",
        "value": 17,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "critical",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "commits_last_year": 0,
              "human_commit_share": 1,
              "days_since_last_push": 580,
              "active_weeks_last_year": 0
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 580 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 580
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "0/52 weeks with commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "0 commits in the last year",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "at_risk",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "releases_count": 3,
              "latest_release_tag": "v1.0.2",
              "releases_from_tags": true,
              "days_since_latest_release": 587,
              "mean_days_between_releases": 157.7
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "3 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 587 days ago",
                "points": 7.2,
                "status": "partial",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 587
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~157.7 days",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 157.7
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "dormant",
              "guards": [
                "no_open_demand",
                "dependencies_clean"
              ],
              "signals": [
                "scorecard_unmaintained"
              ],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": 0,
              "unanswered_open_issues": 1,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 580,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "no human commit for 580 days, with nothing left unanswered; held at dormant by nothing open to answer, no affected dependency",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_quiet",
                    "params": {
                      "days": 580
                    }
                  },
                  {
                    "code": "abandonment_guarded",
                    "params": {
                      "guards": "nothing open to answer, no affected dependency"
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 55,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 1,
              "stars": 2,
              "watchers": 1,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "2 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "1 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "1 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "excellent",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 85,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": true,
              "has_issue_template": false,
              "has_code_of_conduct": true,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 18,
                "status": "met",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 13.5,
                "status": "met",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "excellent",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "packages": [
                "is-data-view"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 280473641
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "280,473,641 downloads/month across npm",
                "points": 80,
                "status": "met",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 280473641,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 37,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "pr_acceptance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 1,
              "closed_issues": 0,
              "issue_closed_ratio": 0,
              "closed_unmerged_prs": 0
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "0% of issues closed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 0
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "no decided pull requests or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_decided_prs_or_data",
                    "params": {}
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/20 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "followers": 54,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "inspect-js",
              "public_repos": 83,
              "account_age_days": 2535
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "54 followers of inspect-js",
                "points": 12.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 54,
                      "login": "inspect-js"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "83 public repos, account ~6 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 83
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 6
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "good",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 71,
            "inputs": {
              "packages": [
                "is-data-view"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 587
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 587 days ago",
                "points": 14,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 587
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "3 published versions",
                "points": 12,
                "status": "partial",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "good",
        "name": "Engineering Quality",
        "value": 73,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "excellent",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 88,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": true,
              "has_linter_config": true,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "6 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 6
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": ".eslintrc",
                "points": 16,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 6.4,
                "status": "met",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "data",
                "dataview",
                "ecmascript",
                "javascript",
                "typedarray",
                "typedarrays",
                "view"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "7 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 7
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 51,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 39,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 15,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 3,
              "scorecard_aggregate": 3.9
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/20 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): No advisories left outstanding. Remaining weights renormalized. Matched the npm:is-data-view@1.0.2 runtime dependency closure — what installing the published package pulls in — 27 packages. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_published",
                "params": {
                  "package": "npm:is-data-view@1.0.2",
                  "assessed": 27
                }
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 27,
              "unassessed_packages": 0,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "no indirect dependency carries a known advisory",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "no_indirect_advisories",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 27,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 10
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "at_risk",
        "name": "AI Readiness",
        "value": 36,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 3,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0.05,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "1 of 20 human commits state their intent (structured subject or explanatory body)",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 1,
                      "sampled": 20
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": true,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": 0,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": ".eslintrc",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no agent-authored commits among the last 20",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_authored_commits",
                    "params": {
                      "sampled": 20
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no automated dependency updates observed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_dependency_automation",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "good",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 82,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 1542,
              "source_files_sampled": 3,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript with type-check config (tsconfig.json)",
                "points": 27,
                "status": "partial",
                "details": [
                  {
                    "code": "typecheck_config_language",
                    "params": {
                      "files": "tsconfig.json",
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/3 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 3,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T22:29:28.427257Z",
  "schema_version": "0.27.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/i/inspect-js/is-data-view.svg",
  "full_name": "inspect-js/is-data-view",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.

Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.27.0 — full methodology · metrics wiki.

How one result sits in the wider record: aggregate statisticsnpm.