Публічний реєстр
Звіт про здоров'я програмного забезпеченнясхема 0.27.0 · метрики 1.13.0 · 2026-07-22 22:29 UTC

inspect-js / is-data-view

Is this value a JS DataView? This module works cross-realm/iframe, does not depend on instanceof or mutable properties, and despite ES6 Symbol.toStringTag.

JavaScriptMIT★ 2 зірки⑂ 1 форкз січ. 2024 р.Переглянути на GitHub ↗

inspect-js/is-data-view має індекс здоров’я 45 зі 100, що відповідає смузі «У зоні ризику». Найвищий показник — Engineering Quality (73/100), найнижчий — Vitality (17/100). Останнє оновлення було 580 днів тому. Більшість нещодавньої роботи виконує один учасник.

45
загалом / 100
У зоні ризику

Індекс здоров'я програмного забезпечення

Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.

45
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
ЖиттєздатністьСпільнота тавпровадженняСталість таврядуванняІнженернаякістьБезпекаГотовність доШІ

Профіль оцінок

Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.

Власність

Inspect JSОрганізація
54 підписники83 публічні репозиторіїз серп. 2019 р.

За цим репозиторієм стоїть організація — спільна, підзвітна опіка, здатна пережити будь-якого окремого мейнтейнера.

Пакетні екосистеми

РеєстрПакетВерсіяЗавантажень / місВерсіїОстання публікаціяТеги
npmis-data-view1.0.2280 473 6413587 днів томуjavascriptecmascriptdataviewdataviewtypedarraytypedarrays

Метрики за категоріями

Життєздатність

Чи живий проєкт — чи пишеться код і чи виходять релізи?

17Критичний · 22% загального індексу
Як обчислюється оцінка
0/36Свіжість push — останній push 580 дн. тому
0/36Ритм комітів — 0/52 тижнів із комітами
0/18Обсяг комітів — 0 комітів за останній рік
0/10OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
Використані вхідні дані
commits_last_year0
human_commit_share1
days_since_last_push580
active_weeks_last_year0

Дисципліна релізів

40У зоні ризику
Як обчислюється оцінка
16.2/27Випускає релізи — 3 тегів версій (без релізів GitHub)
7.2/36Свіжість релізів — останній реліз 587 дн. тому
12.6/27Ритм релізів — реліз кожні ~157,7 дн.
0/10OpenSSF Scorecard: Signed-Releases — немає даних
Використані вхідні дані
releases_count3
latest_release_tagv1.0.2
releases_from_tagsтак
days_since_latest_release587
mean_days_between_releases157,7
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Signed-Releases. Залишкові ваги перенормовано.

Спільнота та впровадження

Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?

55Помірний · 18% загального індексу
Як обчислюється оцінка
0/60Зірки — 2 зірок
0/25Форки — 1 форків
0/15Спостерігачі — 1 спостерігачів
Використані вхідні дані
forks1
stars2
watchers1
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Як обчислюється оцінка
22.5/22.5README
22.5/22.5Ліцензія — визнана ліцензія (MIT)
18/18Настанови CONTRIBUTING
13.5/13.5Кодекс поведінки
0/7.2Шаблон issue
0/6.3Шаблон PR
Використані вхідні дані
has_readmeтак
has_licenseтак
has_contributingтак
has_issue_templateні
has_code_of_conductтак
has_pull_request_templateні
Як обчислюється оцінка
80/80Щомісячні завантаження — 280 473 641 завантажень/місяць у npm
0/20Залежні пакети в реєстрі — ця екосистема цього не повідомляє
Використані вхідні дані
packagesis-data-view
dependents
ecosystemsnpm
total_downloads
monthly_downloads280 473 641
Виключено з оцінювання (немає даних або не застосовно): Залежні пакети в реєстрі. Залишкові ваги перенормовано.

Сталість та врядування

Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?

37У зоні ризику · 24% загального індексу
Як обчислюється оцінка
9/54Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів
0/22.5Розподіл комітів — головний контриб’ютор — автор 100% комітів
1.4/13.5Широта контриб’юторів — 1 контриб’юторів
10/10OpenSSF Scorecard: Contributors — project has 31 contributing companies or organizations
Використані вхідні дані
bus_factor1
contributors_sampled1
top_contributor_share1
Як обчислюється оцінка
0/46.8Вирішення issue — закрито 0% issue
0/38.3Прийняття PR — немає вирішених pull request-ів або даних
0/15OpenSSF Scorecard: Code-Review — Found 0/20 approved changesets -- score normalized to 0
Використані вхідні дані
merged_prs0
open_issues1
closed_issues0
issue_closed_ratio0
closed_unmerged_prs0
Виключено з оцінювання (немає даних або не застосовно): Прийняття PR. Залишкові ваги перенормовано.
Як обчислюється оцінка
30/30Підтримка власника — у власності організації
0/20Верифікований домен
12.5/25Охоплення власника — 54 підписників у inspect-js
25/25Послужний список — 83 публічних репозиторіїв, вік облікового запису ~6 р.
Використані вхідні дані
followers54
owner_typeOrganization
is_verified
owner_logininspect-js
public_repos83
account_age_days2 535
Як обчислюється оцінка
25/25Опубліковано й доступно — 1 пакет(ів) у npm
14/35Свіжість публікацій — остання публікація 587 дн. тому
12/20Історія версій — 3 опублікованих версій
20/20Не застарілий — активний, не deprecated і не yanked
Використані вхідні дані
packagesis-data-view
ecosystemsnpm
any_deprecatedні
min_days_since_publish587

Інженерна якість

Чи наявні базові інженерні практики та документація?

73Добрий · 20% загального індексу
Як обчислюється оцінка
24/24Процеси CI — 6 процес(ів) CI
24/24Наявні тести
16/16Конфігурація лінтера — .eslintrc
0/9.6Pre-commit-хуки
6.4/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — немає даних
Використані вхідні дані
has_ciтак
has_testsтак
has_editorconfigтак
has_linter_configтак
has_precommit_configні
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: CI-Tests. Залишкові ваги перенормовано.

Документація

50Помірний
Як обчислюється оцінка
30/30README
0/25Каталог документації
0/15Сайт документації / домашня сторінка
10/10Опис репозиторію
10/10Теми — 7 тем
0/10Wiki
Використані вхідні дані
topicsdata, dataview, ecmascript, javascript, typedarray, typedarrays, view
has_wikiні
homepage
has_readmeтак
has_docs_dirні
has_descriptionтак

Безпека

Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?

51Помірний · 16% загального індексу

Стан безпеки

39У зоні ризику
Як обчислюється оцінка
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
0/2.5CI-Tests — немає даних
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/20 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 31 contributing companies or organizations
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Ліцензія — license file detected
0/7.5Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
0/5Packaging — немає даних
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — no SAST tool detected
5/5Security-Policy — security policy file detected
0/7.5Signed-Releases — немає даних
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Використані вхідні дані
sourceopenssf_scorecard
checks_evaluated15
scorecard_versionv5.5.0
checks_inconclusive3
scorecard_aggregate3,9
Виключено з оцінювання (немає даних або не застосовно): ci_tests, packaging, signed_releases. Залишкові ваги перенормовано.
Як обчислюється оцінка
35/35Прямі залежності без відомих сповіщень — жодна пряма залежність не має відомих сповіщень
25/25Непрямі залежності без відомих сповіщень — жодна непряма залежність не має відомих сповіщень
0/40Немає задавнених сповіщень — жодне сповіщення не має дати публікації
Використані вхідні дані
sourceosv
advisories0
affected_packages0
assessed_packages27
unassessed_packages0
affected_by_severitynone
direct_affected_packages0
Виключено з оцінювання (немає даних або не застосовно): Немає задавнених сповіщень. Залишкові ваги перенормовано. Звірено з runtime-замиканням залежностей npm:is-data-view@1.0.2 — тим, що тягне за собою встановлення опублікованого пакета, — 27 пакетів. Досяжність не аналізується.

Готовність до ШІ

Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.

36У зоні ризику · 0% загального індексу
Як обчислюється оцінка
0/45Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора
0/15Машиночитана документація (llms.txt)
2.7/40Читабельна історія комітів — намір зазначено у 1 з 20 людських комітів (структурований заголовок або пояснювальний текст)
Використані вхідні дані
has_llms_txtні
legible_history_share0,05
agent_instruction_files
agent_instruction_max_bytes
Як обчислюється оцінка
0/18Розгортання однією командою
22/22Автоматизовані тести
11/11Конфігурація лінтера / форматера — .eslintrc
11/11Статична перевірка типів — tsconfig.json
0/10Відтворюване середовище
0/10Підтверджена практика роботи з агентами — серед останніх 20 комітів немає створених агентом
0/8Автоматизоване супроводження — автоматичних оновлень залежностей не виявлено
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Використані вхідні дані
has_nixні
has_testsтак
lockfiles
has_dockerfileні
typed_languageні
bootstrap_files
has_devcontainerні
has_linter_configтак
typecheck_configstsconfig.json
agent_commit_share0
toolchain_manifests
dependency_bot_commit_share0
Як обчислюється оцінка
27/45Типізований код — JavaScript з конфігурацією перевірки типів (tsconfig.json)
55/55Керовані розміри файлів — 0/3 файлів вихідного коду понад 60 КБ
Використані вхідні дані
primary_languageJavaScript
largest_source_bytes1 542
source_files_sampled3
oversized_source_files0

Ключові факти

2зірок GitHub
1контриб'юторів
0комітів за останні 12 місяців
580днів від останнього пушу
3релізів
1бас-фактор
1відкритих issue
npmпакетних екосистем

Попередження щодо збору даних

  • Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token

Докладніше

OpenSSF Scorecard 3.9 / 10
3.9сукупно

Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).Scorecard v5.5.0 · 2026-07-22 22:29 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
н/дCI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/20 approved changesets -- score normalized to 0
10Contributorsproject has 31 contributing companies or organizations
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintained0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
н/дPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTno SAST tool detected
10Security-Policysecurity policy file detected
н/дSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Прямі залежності 3
РеєстрПакетОбмеження версіїМаніфест
npmcall-bound^1.0.3package.json
npmget-intrinsic^1.2.6package.json
npmis-typed-array^1.1.15package.json
Усі залежності 31

Повний розв'язаний набір залежностей із графа залежностей GitHub: 3 прямих і 28 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.

РеєстрПакетВерсіяЗв'язок
npmcall-bound^1.0.3пряма
npmget-intrinsic^1.2.6пряма
npmis-typed-array^1.1.15пряма
npm@arethetypeswrong/cli^0.17.1непряма
npm@ljharb/eslint-config^21.1.1непряма
npm@ljharb/tsconfig^0.2.2непряма
npm@types/call-bind^1.0.5непряма
npm@types/es-value-fixtures^1.4.4непряма
npm@types/for-each^0.3.3непряма
npm@types/make-arrow-function^1.2.2непряма
npm@types/make-generator-function^2.0.3непряма
npm@types/node^20.17.10непряма
npm@types/object-inspect^1.13.0непряма
npm@types/tape^5.8.0непряма
npmauto-changelog^2.5.0непряма
npmavailable-typed-arrays^1.0.7непряма
npmencoding^0.1.13непряма
npmes-value-fixtures^1.5.0непряма
npmeslint8.8.0непряма
npmevalmd^0.0.19непряма
npmfor-each^0.3.3непряма
npmhas-tostringtag^1.0.2непряма
npmin-publish^2.0.1непряма
npmmake-arrow-function^1.2.0непряма
npmmake-generator-function^2.0.0непряма
npmnpmignore^0.3.1непряма
npmnyc^10.3.2непряма
npmobject-inspect^1.13.3непряма
npmsafe-publish-latest^2.0.0непряма
npmtape^5.9.0непряма
npmtypescriptnextнепряма
Сповіщення про залежності 0

Встановлення npm:is-data-view@1.0.2 тягне 27 пакетів, прямих і транзитивних: 0 мають відомі сповіщення, з них 0 — прямі залежності.

Жодне відоме сповіщення не стосується оцінених залежностей.

Сповіщення означає, що версія, записана в графі залежностей, потрапляє в уражений діапазон. Досяжність не аналізується, а граф містить піниї розробки й тестування — знахідка може стосуватися інструментів, а не поставленого коду.

Звіт у форматі JSON машиночитний
{
  "data": {
    "repo": {
      "topics": [
        "data",
        "dataview",
        "ecmascript",
        "javascript",
        "typedarray",
        "typedarrays",
        "view"
      ],
      "is_fork": false,
      "size_kb": 37,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 2389
      },
      "pushed_at": "2024-12-19T19:53:26Z",
      "created_at": "2024-01-31T20:38:09Z",
      "owner_type": "Organization",
      "updated_at": "2024-12-19T19:53:29Z",
      "description": "Is this value a JS DataView? This module works cross-realm/iframe, does not depend on instanceof or mutable properties, and despite ES6 Symbol.toStringTag.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript"
      ]
    },
    "owner": {
      "blog": null,
      "name": "Inspect JS",
      "type": "Organization",
      "login": "inspect-js",
      "company": null,
      "location": null,
      "followers": 54,
      "avatar_url": "https://avatars.githubusercontent.com/u/54056128?v=4",
      "created_at": "2019-08-13T06:36:36Z",
      "is_verified": null,
      "public_repos": 83,
      "account_age_days": 2535
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.0.2",
          "kind": "patch",
          "published_at": "2024-12-12T05:43:44Z"
        },
        {
          "tag": "v1.0.1",
          "kind": "patch",
          "published_at": "2024-02-02T16:51:22Z"
        },
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2024-01-31T22:16:28Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "bd9c914704dfdcea50dc61fc5c4e43d30e50e34d",
          "body": null,
          "is_bot": false,
          "headline": "[Deps] update `call-bound`, `is-typed-array`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-19T19:52:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0f248fc4ff1ab521149267f682f024f41c06c58d",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@types/tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-19T19:52:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "30aa89d46be4424bd6370f4b470810d3955b737a",
          "body": null,
          "is_bot": false,
          "headline": "[Tests] add attw",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-19T19:51:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e8a4943b72a33a075c6f9fd31f4e9e8a53e15b02",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.2",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T05:43:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34de4b5f5448ca1bb95c34686c51b5351904a317",
          "body": null,
          "is_bot": false,
          "headline": "[Fix] add missing dependencies; use `call-bound` directly",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:35:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3d302d7dbf99d75fcf4a3de14687e423ec88728f",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] add missing peer dep",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:34:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6f8e9dda376e421d30dd94e891bea3fbae7967ee",
          "body": "…s/node`, `@types/object-inspect`, `@types/tape`, `auto-changelog`, `es-value-fixtures`, `object-inspect`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `@ljharb/eslint-config`, `@ljharb/tsconfig`, `@type…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:33:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e2f37fdf421c4629730406c2b61d5481dce4e448",
          "body": null,
          "is_bot": false,
          "headline": "[actions] split out node 10-20, and 20+",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:32:39Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "aa7060ad77c9ba2d500b124b73662c3b069fc721",
          "body": null,
          "is_bot": false,
          "headline": "[Tests] replace `aud` with `npm audit`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-12-12T00:32:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3a800720dd322ea4656f29d28f1d28117fb94537",
          "body": null,
          "is_bot": false,
          "headline": "[types] use shared config",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-03-11T04:59:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "37be59163c8df9abb016bbb4c7d76f3af549f1d2",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@types/node`, `available-typed-arrays`, `tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-03-11T04:56:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2a35354be23b672154070c766bdf857eb4e8990b",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.1",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T16:51:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c2728ef20064bba2588eed503a0c2e36985b638a",
          "body": null,
          "is_bot": false,
          "headline": "[patch] add types",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T05:23:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2ca9333516afac321431ddae02d6791d50e8d5c2",
          "body": null,
          "is_bot": false,
          "headline": "[Deps] update `is-typed-array`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T05:05:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e7f9ebccf9aacdc112dd4f665271c96417ddfa64",
          "body": "… `npmignore`, `object-inspect`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `aud`, `available-typed-arrays`, `has-tostringtag`,…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-02-02T05:05:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "684361510ea1ac6ccbdd7b1fe5940d828af8fb76",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.0",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T22:16:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6f7e4244ae9d766309b8f050c0b786e9c0692825",
          "body": null,
          "is_bot": false,
          "headline": "Initial implementation, tests, readme",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T21:51:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18cde474201a292ebdaa704d232127c814cb1d0e",
          "body": null,
          "is_bot": false,
          "headline": "Only apps should have lockfiles",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T20:42:16Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "25130e2dbecc91d398cf74c39878aa89f5e604ab",
          "body": null,
          "is_bot": false,
          "headline": "npm init",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T20:41:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b7ea57d6942dd268bcda990a96b8cd663b19eb8",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2024-01-31T20:38:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 3,
      "commits_last_year": 0,
      "latest_release_at": "2024-12-12T05:43:44Z",
      "latest_release_tag": "v1.0.2",
      "releases_from_tags": true,
      "days_since_last_push": 580,
      "active_weeks_last_year": 0,
      "days_since_latest_release": 587,
      "mean_days_between_releases": 157.7
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": true,
      "health_percentage": 75,
      "has_issue_template": false,
      "has_code_of_conduct": true,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "is-data-view",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "javascript",
            "ecmascript",
            "dataview",
            "data",
            "view",
            "typedarray",
            "typedarrays"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/is-data-view",
          "is_deprecated": false,
          "latest_version": "1.0.2",
          "repository_url": "https://github.com/inspect-js/is-data-view",
          "versions_count": 3,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 280473641,
          "first_published_at": "2024-01-31T22:20:28.929000Z",
          "latest_published_at": "2024-12-12T05:43:54.162000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 587
        }
      ]
    },
    "popularity": {
      "forks": 1,
      "stars": 2,
      "watchers": 1,
      "fork_history": {
        "days": [
          {
            "date": "2026-05-03",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_forks": 1
      },
      "star_history": null,
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "toolchain_manifests": [],
      "largest_source_bytes": 1542,
      "source_files_sampled": 3,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "published_package",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 27,
        "malicious_count": 0,
        "assessed_package": "npm:is-data-view@1.0.2",
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [
        {
          "name": "call-bound",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^1.0.3"
        },
        {
          "name": "get-intrinsic",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^1.2.6"
        },
        {
          "name": "is-typed-array",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^1.1.15"
        }
      ],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "call-bound",
            "direct": true,
            "version": "^1.0.3",
            "ecosystem": "npm"
          },
          {
            "name": "get-intrinsic",
            "direct": true,
            "version": "^1.2.6",
            "ecosystem": "npm"
          },
          {
            "name": "is-typed-array",
            "direct": true,
            "version": "^1.1.15",
            "ecosystem": "npm"
          },
          {
            "name": "@arethetypeswrong/cli",
            "direct": false,
            "version": "^0.17.1",
            "ecosystem": "npm"
          },
          {
            "name": "@ljharb/eslint-config",
            "direct": false,
            "version": "^21.1.1",
            "ecosystem": "npm"
          },
          {
            "name": "@ljharb/tsconfig",
            "direct": false,
            "version": "^0.2.2",
            "ecosystem": "npm"
          },
          {
            "name": "@types/call-bind",
            "direct": false,
            "version": "^1.0.5",
            "ecosystem": "npm"
          },
          {
            "name": "@types/es-value-fixtures",
            "direct": false,
            "version": "^1.4.4",
            "ecosystem": "npm"
          },
          {
            "name": "@types/for-each",
            "direct": false,
            "version": "^0.3.3",
            "ecosystem": "npm"
          },
          {
            "name": "@types/make-arrow-function",
            "direct": false,
            "version": "^1.2.2",
            "ecosystem": "npm"
          },
          {
            "name": "@types/make-generator-function",
            "direct": false,
            "version": "^2.0.3",
            "ecosystem": "npm"
          },
          {
            "name": "@types/node",
            "direct": false,
            "version": "^20.17.10",
            "ecosystem": "npm"
          },
          {
            "name": "@types/object-inspect",
            "direct": false,
            "version": "^1.13.0",
            "ecosystem": "npm"
          },
          {
            "name": "@types/tape",
            "direct": false,
            "version": "^5.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "auto-changelog",
            "direct": false,
            "version": "^2.5.0",
            "ecosystem": "npm"
          },
          {
            "name": "available-typed-arrays",
            "direct": false,
            "version": "^1.0.7",
            "ecosystem": "npm"
          },
          {
            "name": "encoding",
            "direct": false,
            "version": "^0.1.13",
            "ecosystem": "npm"
          },
          {
            "name": "es-value-fixtures",
            "direct": false,
            "version": "^1.5.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint",
            "direct": false,
            "version": "8.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "evalmd",
            "direct": false,
            "version": "^0.0.19",
            "ecosystem": "npm"
          },
          {
            "name": "for-each",
            "direct": false,
            "version": "^0.3.3",
            "ecosystem": "npm"
          },
          {
            "name": "has-tostringtag",
            "direct": false,
            "version": "^1.0.2",
            "ecosystem": "npm"
          },
          {
            "name": "in-publish",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "make-arrow-function",
            "direct": false,
            "version": "^1.2.0",
            "ecosystem": "npm"
          },
          {
            "name": "make-generator-function",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "npmignore",
            "direct": false,
            "version": "^0.3.1",
            "ecosystem": "npm"
          },
          {
            "name": "nyc",
            "direct": false,
            "version": "^10.3.2",
            "ecosystem": "npm"
          },
          {
            "name": "object-inspect",
            "direct": false,
            "version": "^1.13.3",
            "ecosystem": "npm"
          },
          {
            "name": "safe-publish-latest",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "tape",
            "direct": false,
            "version": "^5.9.0",
            "ecosystem": "npm"
          },
          {
            "name": "typescript",
            "direct": false,
            "version": "next",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 31,
        "direct_count": 3,
        "indirect_count": 28
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 0,
        "open_issues": 1,
        "closed_ratio": 0,
        "closed_issues": 0,
        "closed_unmerged_prs": 0
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "ljharb",
          "commits": 20,
          "avatar_url": "https://avatars.githubusercontent.com/u/45469?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "node-aught.yml",
        "node-pretest.yml",
        "node-tens.yml",
        "node-twenties.yml",
        "rebase.yml",
        "require-allow-edits.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [
        ".eslintrc"
      ],
      "has_editorconfig": true,
      "has_linter_config": true,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/20 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 31 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 10,
            "reason": "security policy file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "bd9c914704dfdcea50dc61fc5c4e43d30e50e34d",
        "ran_at": "2026-07-22T22:29:23Z",
        "aggregate_score": 3.9,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-16T06:53:55Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": null,
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": [
        {
          "number": 1,
          "created_at": "2024-01-31T20:38:24Z",
          "last_comment_at": null,
          "last_comment_author": null
        }
      ]
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/inspect-js/is-data-view",
    "host": "github.com",
    "name": "is-data-view",
    "owner": "inspect-js"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 45,
      "inputs": {
        "security": 51,
        "vitality": 17,
        "community": 55,
        "governance": 37,
        "engineering": 73
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "critical",
        "name": "Vitality",
        "value": 17,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "critical",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "commits_last_year": 0,
              "human_commit_share": 1,
              "days_since_last_push": 580,
              "active_weeks_last_year": 0
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 580 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 580
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "0/52 weeks with commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "0 commits in the last year",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "at_risk",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "releases_count": 3,
              "latest_release_tag": "v1.0.2",
              "releases_from_tags": true,
              "days_since_latest_release": 587,
              "mean_days_between_releases": 157.7
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "3 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 587 days ago",
                "points": 7.2,
                "status": "partial",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 587
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~157.7 days",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 157.7
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "dormant",
              "guards": [
                "no_open_demand",
                "dependencies_clean"
              ],
              "signals": [
                "scorecard_unmaintained"
              ],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": 0,
              "unanswered_open_issues": 1,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 580,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "no human commit for 580 days, with nothing left unanswered; held at dormant by nothing open to answer, no affected dependency",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_quiet",
                    "params": {
                      "days": 580
                    }
                  },
                  {
                    "code": "abandonment_guarded",
                    "params": {
                      "guards": "nothing open to answer, no affected dependency"
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 55,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 1,
              "stars": 2,
              "watchers": 1,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "2 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "1 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "1 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "excellent",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 85,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": true,
              "has_issue_template": false,
              "has_code_of_conduct": true,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 18,
                "status": "met",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 13.5,
                "status": "met",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "excellent",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "packages": [
                "is-data-view"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 280473641
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "280,473,641 downloads/month across npm",
                "points": 80,
                "status": "met",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 280473641,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 37,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "pr_acceptance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 1,
              "closed_issues": 0,
              "issue_closed_ratio": 0,
              "closed_unmerged_prs": 0
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "0% of issues closed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 0
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "no decided pull requests or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_decided_prs_or_data",
                    "params": {}
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/20 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "followers": 54,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "inspect-js",
              "public_repos": 83,
              "account_age_days": 2535
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "54 followers of inspect-js",
                "points": 12.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 54,
                      "login": "inspect-js"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "83 public repos, account ~6 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 83
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 6
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "good",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 71,
            "inputs": {
              "packages": [
                "is-data-view"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 587
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 587 days ago",
                "points": 14,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 587
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "3 published versions",
                "points": 12,
                "status": "partial",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "good",
        "name": "Engineering Quality",
        "value": 73,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "excellent",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 88,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": true,
              "has_linter_config": true,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "6 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 6
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": ".eslintrc",
                "points": 16,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 6.4,
                "status": "met",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "data",
                "dataview",
                "ecmascript",
                "javascript",
                "typedarray",
                "typedarrays",
                "view"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "7 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 7
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 51,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 39,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 15,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 3,
              "scorecard_aggregate": 3.9
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/20 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): No advisories left outstanding. Remaining weights renormalized. Matched the npm:is-data-view@1.0.2 runtime dependency closure — what installing the published package pulls in — 27 packages. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_published",
                "params": {
                  "package": "npm:is-data-view@1.0.2",
                  "assessed": 27
                }
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 27,
              "unassessed_packages": 0,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "no indirect dependency carries a known advisory",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "no_indirect_advisories",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 27,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 10
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "at_risk",
        "name": "AI Readiness",
        "value": 36,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 3,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0.05,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "1 of 20 human commits state their intent (structured subject or explanatory body)",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 1,
                      "sampled": 20
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": true,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": 0,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": ".eslintrc",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no agent-authored commits among the last 20",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_authored_commits",
                    "params": {
                      "sampled": 20
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no automated dependency updates observed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_dependency_automation",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "good",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 82,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 1542,
              "source_files_sampled": 3,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript with type-check config (tsconfig.json)",
                "points": 27,
                "status": "partial",
                "details": [
                  {
                    "code": "typecheck_config_language",
                    "params": {
                      "files": "tsconfig.json",
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/3 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 3,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T22:29:28.427257Z",
  "schema_version": "0.27.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/i/inspect-js/is-data-view.svg",
  "full_name": "inspect-js/is-data-view",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.

Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.27.0 — повна методологія · вікі метрик.

Як окремий результат виглядає на тлі всього реєстру: сукупна статистикаnpm.