Wasm based formatters for targets missing from wasm-fmt
scalar/formatters holds a health index of 78 out of 100, placing it in the Good band. It scores highest on AI Readiness (92/100) and lowest on Community & Adoption (47/100). It was last updated 6 days ago. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 67 is calibrated to 78 on the published index scale (record calibration 2026-08-02).
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | @scalar/php-fmt | 0.4.0 | 110 | 4 | 34 days ago | phpformatterphp-cs-fixerpsr-12wasmtypescript |
| npm | @scalar/java-fmt | 0.4.1 | 36,966 | 5 | 20 days ago | javaformattergoogle-java-formatwasmtypescriptteavm |
| npm | @scalar/ruby-fmt | 0.6.3 | 35,214 | 10 | 6 days ago | rubyformattersyntax-treewasmprettiertypescript |
| npm | @scalar/rust-fmt | 0.2.0 | 39,345 | 2 | 30 days ago | rustformatterrustfmtwasmwebassemblytypescript |
| npm | @scalar/swift-fmt | 0.2.0 | 316 | 2 | 30 days ago | swiftformatterswift-formatwasmswiftwasmtypescript |
| npm | @scalar/csharp-fmt | 0.2.0 | 40,833 | 2 | 30 days ago | csharpc#formattercsharpierroslynwasmdotnettypescript |
| npm | @scalar/kotlin-fmt | 0.4.1 | 38,696 | 5 | 20 days ago | kotlinformatterktfmtwasmtypescriptteavm |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 6 days ago |
| 4.2/36 | Commit cadence — 6/52 weeks with commits |
| 14.8/18 | Commit volume — 44 commits in the last year |
| 0/10 | OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully |
| commits_last_year | 44 |
| human_commit_share | 0.659 |
| days_since_last_push | 6 |
| active_weeks_last_year | 6 |
| 27/27 | Ships releases — 23 releases published |
| 36/36 | Release recency — latest release 6 days ago |
| 27/27 | Release cadence — a release every ~2.5 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 23 |
| latest_release_tag | @scalar/ruby-fmt@0.6.3 |
| releases_from_tags | no |
| days_since_latest_release | 6 |
| mean_days_between_releases | 2.5 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 0/60 | Stars — 1 stars |
| 0/25 | Forks — 0 forks |
| 0/15 | Watchers — 0 watchers |
| forks | 0 |
| stars | 1 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 16.9/22.5 | License — license file present, not a recognized license |
| 18/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 6.3/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | 3 |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | github.com, shields.io |
| has_pull_request_template | yes |
| 70.4/80 | Monthly downloads — 191,480 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | @scalar/php-fmt, @scalar/java-fmt, @scalar/ruby-fmt, @scalar/rust-fmt, @scalar/swift-fmt, @scalar/csharp-fmt, @scalar/kotlin-fmt |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 191,480 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 3.1/22.5 | Commit distribution — top contributor authored 86% of commits |
| 4.1/13.5 | Contributor breadth — 3 contributors |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0.862 |
| 0/42 | Issue resolution — no issues or no data |
| 30/30 | PR acceptance — 38/38 decided PRs merged |
| 13/13 | Newcomer PR acceptance — 3/3 first-time contributors' PRs merged in 30d |
| 12/15 | OpenSSF Scorecard: Code-Review — Found 17/19 approved changesets -- score normalized to 8 |
| merged_prs | 38 |
| open_issues | 0 |
| closed_issues | 0 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 12 |
| prs_decided_30d | 12 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 0 |
| first_time_authors_30d | 1 |
| first_time_prs_merged_30d | 3 |
| first_time_prs_decided_30d | 3 |
| 30/30 | Ownership backing — organization-owned |
| 20/20 | Verified domain |
| 18.8/25 | Owner reach — 414 followers of scalar |
| 23.2/25 | Track record — 33 public repos, account ~16 yr old |
| followers | 414 |
| owner_type | Organization |
| is_verified | yes |
| owner_login | scalar |
| public_repos | 33 |
| account_age_days | 5,944 |
| 25/25 | Published & resolvable — 7 package(s) on npm |
| 35/35 | Publish recency — latest publish 6 days ago |
| 20/20 | Version history — 10 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | @scalar/php-fmt, @scalar/java-fmt, @scalar/ruby-fmt, @scalar/rust-fmt, @scalar/swift-fmt, @scalar/csharp-fmt, @scalar/kotlin-fmt |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 6 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 3 workflow(s) |
| 24/24 | Tests present |
| 16/16 | Linter config — biome.json |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 14/20 | OpenSSF Scorecard: CI-Tests — 21 out of 30 merged PRs checked by a CI test -- score normalized to 7 |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | yes |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 0/10 | Topics |
| 0/10 | Wiki |
| topics | — |
| has_wiki | no |
| homepage | — |
| docs_site | — |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 3.8/7.5 | Branch-Protection — branch protection is not maximal on development and all release branches |
| 1.8/2.5 | CI-Tests — 21 out of 30 merged PRs checked by a CI test -- score normalized to 7 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 6/7.5 | Code-Review — Found 17/19 approved changesets -- score normalized to 8 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.2/2.5 | License — license file detected |
| 0/7.5 | Maintained — project was created within the last 90 days. Please review its contents carefully |
| 0/5 | Packaging — no data |
| 5/5 | Pinned-Dependencies — all dependencies are pinned |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — no data |
| 7.5/7.5 | Token-Permissions — GitHub workflow tokens follow principle of least privilege |
| 5.2/7.5 | Vulnerabilities — 3 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 6.7 |
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 25/25 | Indirect dependencies free of known advisories — no indirect dependency carries a known advisory |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
| source | osv |
| advisories | 0 |
| affected_packages | 0 |
| assessed_packages | 8 |
| unassessed_packages | 0 |
| affected_by_severity | none |
| direct_affected_packages | 0 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 45/45 | Agent instructions — AGENTS.md, CLAUDE.md |
| 0/15 | Machine-readable docs (llms.txt) |
| 40/40 | Legible commit history — 29 of 29 human commits state their intent (structured subject or explanatory body) |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 1 |
| agent_instruction_files | AGENTS.md, CLAUDE.md |
| agent_instruction_max_bytes | 4,823 |
| 12.6/18 | One-command bootstrap — build/csharp_fmt/csharp_fmt.csproj, build/java_fmt_teavm/classlib-probe/pom.xml, build/java_fmt_teavm/kotlin-probe/pom.xml (toolchain convention, no task runner) |
| 22/22 | Automated tests |
| 11/11 | Lint / format config — biome.json |
| 11/11 | Static type checking — packages/csharp/tsconfig.json, packages/java/tsconfig.json, packages/kotlin/tsconfig.json, packages/php/tsconfig.json, packages/ruby/tsconfig.json, packages/rust/tsconfig.json, packages/swift/tsconfig.json, tsconfig.json |
| 10/10 | Reproducible environment — lockfile |
| 10/10 | Demonstrated agent practice — 14 of the last 44 commits agent-authored or agent-credited |
| 8/8 | Automated maintenance — 4 of the last 44 commits are automated dependency updates |
| 10/10 | OpenSSF Scorecard: Pinned-Dependencies — all dependencies are pinned |
| has_nix | no |
| has_tests | yes |
| lockfiles | Gemfile.lock |
| has_dockerfile | no |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | yes |
| typecheck_configs | packages/csharp/tsconfig.json, packages/java/tsconfig.json, packages/kotlin/tsconfig.json, packages/php/tsconfig.json, packages/ruby/tsconfig.json, packages/rust/tsconfig.json, packages/swift/tsconfig.json, tsconfig.json |
| agent_commit_share | 0.318 |
| toolchain_manifests | build/csharp_fmt/csharp_fmt.csproj, build/java_fmt_teavm/classlib-probe/pom.xml, build/java_fmt_teavm/kotlin-probe/pom.xml, build/java_fmt_teavm/kotlin-probe/teavm-bug/pom.xml, build/java_fmt_teavm/pom.xml, build/rust_fmt/crates/rust_fmt/Cargo.toml |
| dependency_bot_commit_share | 0.091 |
| 45/45 | Type-checkable code — TypeScript (statically typed) |
| 54.2/55 | Manageable file sizes — 2/134 source files over 60KB |
| primary_language | TypeScript |
| largest_source_bytes | 220,892 |
| source_files_sampled | 134 |
| oversized_source_files | 2 |
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 5 | Branch-Protection | branch protection is not maximal on development and all release branches |
| 7 | CI-Tests | 21 out of 30 merged PRs checked by a CI test -- score normalized to 7 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 8 | Code-Review | Found 17/19 approved changesets -- score normalized to 8 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 9 | License | license file detected |
| 0 | Maintained | project was created within the last 90 days. Please review its contents carefully |
| n/a | Packaging | packaging workflow not detected |
| 10 | Pinned-Dependencies | all dependencies are pinned |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 10 | Security-Policy | security policy file detected |
| n/a | Signed-Releases | no releases found |
| 10 | Token-Permissions | GitHub workflow tokens follow principle of least privilege |
| 7 | Vulnerabilities | 3 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| npm | lefthook | ^2.1.12 | package.json |
| NuGet | CSharpier.Core | $(CSharpierVersion) | build/csharp_fmt/csharp_fmt.csproj |
| Maven | org.teavm:teavm-classlib | ${teavm.version} | build/java_fmt_teavm/pom.xml |
| Maven | org.teavm:teavm-jso-apis | ${teavm.version} | build/java_fmt_teavm/pom.xml |
| Maven | org.openjdk:jdk-compiler | 21 | build/java_fmt_teavm/pom.xml |
| Maven | local.javafmt:google-java-format-patched | ${gjf.version} | build/java_fmt_teavm/pom.xml |
| Maven | local.javafmt:teavm-stubs | 1 | build/java_fmt_teavm/pom.xml |
| RubyGems | syntax_tree | 6.3.0 | build/ruby_fmt/Gemfile |
| RubyGems | rubocop | 1.81.6 | build/ruby_fmt/Gemfile |
| RubyGems | rubocop-ast | 1.50.0 | build/ruby_fmt/Gemfile |
| RubyGems | json | — | build/ruby_fmt/Gemfile |
| RubyGems | prism | — | build/ruby_fmt/Gemfile |
| RubyGems | js | 2.10.1 | build/ruby_fmt/Gemfile |
| RubyGems | ruby_wasm | 2.10.1 | build/ruby_fmt/Gemfile |
| npm | brotli-dec-wasm | ^2.3.2 | packages/csharp/package.json |
| npm | brotli-dec-wasm | ^2.3.2 | packages/java/package.json |
| npm | brotli-dec-wasm | ^2.3.2 | packages/kotlin/package.json |
| npm | @php-wasm/node-8-4 | 3.1.47 | packages/php/package.json |
| npm | @php-wasm/universal | 3.1.47 | packages/php/package.json |
| npm | @bjorn3/browser_wasi_shim | ^0.4.2 | packages/ruby/package.json |
| npm | @ruby/wasm-wasi | ^2.8.1 | packages/ruby/package.json |
| npm | brotli-dec-wasm | ^2.3.2 | packages/ruby/package.json |
| npm | @bjorn3/browser_wasi_shim | ^0.4.2 | packages/rust/package.json |
| npm | brotli-dec-wasm | ^2.3.2 | packages/rust/package.json |
| npm | @bjorn3/browser_wasi_shim | ^0.4.2 | packages/swift/package.json |
| npm | brotli-dec-wasm | ^2.3.2 | packages/swift/package.json |
The resolved dependency set could not be collected for this report: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Installing npm:@scalar/php-fmt@0.4.0 pulls in 8 packages, direct and transitive: 0 carry known advisories, of which 0 are direct dependencies.
No known advisories affect the assessed dependencies.
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.