Composable Pi coding agent with MCP, LSP, agent chains, prompt presets, and local eval telemetry
spences10/my-pi holds a health index of 62 out of 100, placing it in the Moderate band. It scores highest on Engineering Quality (81/100) and lowest on Vitality (45/100). It was last updated today. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 58 is calibrated to 62 on the published index scale (record calibration 2026-08-02).
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | my-pi | 0.1.114 | 5,088 | 127 | 0 days ago | clicoding-agentevalslspmcppisqlitetelemetry |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 0 days ago |
| 9.7/36 | Commit cadence — 14/52 weeks with commits |
| 18/18 | Commit volume — 1,004 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 1,004 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 14 |
| 0/27 | Ships releases — no releases published |
| 0/36 | Release recency — no releases |
| 0/27 | Release cadence — no releases |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 0 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 31.5/60 | Stars — 88 stars |
| 9.3/25 | Forks — 14 forks |
| 0/15 | Watchers — 1 watchers |
| forks | 14 |
| stars | 88 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | — |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | — |
| has_pull_request_template | no |
| 49.4/80 | Monthly downloads — 5,088 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | my-pi |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 5,088 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 3.8/22.5 | Commit distribution — top contributor authored 83% of commits |
| 4.1/13.5 | Contributor breadth — 3 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0.829 |
| 34.9/42 | Issue resolution — 83% of issues closed |
| 26/30 | PR acceptance — 177/204 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/6 approved changesets -- score normalized to 0 |
| merged_prs | 177 |
| open_issues | 27 |
| closed_issues | 132 |
| prs_merged_7d | — |
| prs_decided_7d | — |
| prs_merged_30d | — |
| prs_decided_30d | — |
| issue_closed_ratio | 0.83 |
| closed_unmerged_prs | 27 |
| first_time_authors_30d | — |
| first_time_prs_merged_30d | — |
| first_time_prs_decided_30d | — |
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 21.5/25 | Owner reach — 966 followers of spences10 |
| 25/25 | Track record — 288 public repos, account ~16 yr old |
| followers | 966 |
| owner_type | User |
| is_verified | — |
| owner_login | spences10 |
| public_repos | 288 |
| account_age_days | 5,952 |
| 25/25 | Published & resolvable — 1 package(s) on npm |
| 35/35 | Publish recency — latest publish 0 days ago |
| 20/20 | Version history — 127 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | my-pi |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 0 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 3 workflow(s) |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 10 out of 10 merged PRs checked by a CI test -- score normalized to 10 |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 25/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://my-pi.dev |
| 10/10 | Repository description |
| 10/10 | Topics — 11 topics |
| 10/10 | Wiki |
| topics | cli, coding-agent, llm, mcp, pi, typescript, evals, lsp, pi-package, sqlite, telemetry |
| has_wiki | yes |
| homepage | https://my-pi.dev |
| docs_site | https://my-pi.dev |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 2.5/2.5 | CI-Tests — 10 out of 10 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/6 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 5.2/7.5 | Vulnerabilities — 3 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 4.9 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 45/45 | Agent instructions — AGENTS.md |
| 0/15 | Machine-readable docs (llms.txt) |
| 0/40 | Legible commit history — no data |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | AGENTS.md |
| agent_instruction_max_bytes | 2,643 |
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — apps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json |
| 10/10 | Reproducible environment — lockfile |
| 0/10 | Demonstrated agent practice — no data |
| 0/8 | Automated maintenance — no data |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | no |
| has_tests | yes |
| lockfiles | pnpm-lock.yaml |
| has_dockerfile | no |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | apps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 45/45 | Type-checkable code — TypeScript (statically typed) |
| 54.9/55 | Manageable file sizes — 1/477 source files over 60KB |
| primary_language | TypeScript |
| largest_source_bytes | 541,138 |
| source_files_sampled | 477 |
| oversized_source_files | 1 |
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 10 | CI-Tests | 10 out of 10 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/6 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10 |
| n/a | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 7 | Vulnerabilities | 3 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| npm | @earendil-works/pi-ai | catalog: | package.json |
| npm | @earendil-works/pi-coding-agent | catalog: | package.json |
| npm | @earendil-works/pi-tui | catalog: | package.json |
| npm | @spences10/pi-project-trust | workspace:* | package.json |
| npm | @spences10/pi-settings | workspace:* | package.json |
| npm | @spences10/pi-themes | workspace:* | package.json |
| npm | @spences10/pi-tui-modal | workspace:* | package.json |
| npm | citty | ^0.2.2 | package.json |
The resolved dependency set could not be collected for this report: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.12.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.