Composable Pi coding agent with MCP, LSP, agent chains, prompt presets, and local eval telemetry
spences10/my-pi erreicht einen Gesundheitsindex von 62 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Engineering Quality (81/100) ab, am schwächsten bei Vitality (45/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
Metriken werden auf einer standardisierten Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr gewichtetes Mittel, kalibriert auf die Verteilung des öffentlichen Registers, sodass die Stufen Perzentilbedeutung tragen; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze Gefährdet von 34.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Der gewichtete Gesamtwert 58 wird auf der veröffentlichten Indexskala auf 62 kalibriert (Register-Kalibrierung 2026-08-02).
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | my-pi | 0.1.114 | 5.088 | 127 | vor 0 Tagen | clicoding-agentevalslspmcppisqlitetelemetry |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 9.7/36 | Commit-Rhythmus — 14/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 1.004 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 1.004 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 14 |
| 0/27 | Liefert Releases aus — keine Releases veröffentlicht |
| 0/36 | Release-Aktualität — keine Releases |
| 0/27 | Release-Rhythmus — keine Releases |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
| releases_count | 0 |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 31.5/60 | Stars — 88 Stars |
| 9.3/25 | Forks — 14 Forks |
| 0/15 | Watcher — 1 Watcher |
| forks | 14 |
| stars | 88 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
| has_readme | ja |
| has_license | ja |
| readme_badges | — |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| readme_badge_services | — |
| has_pull_request_template | nein |
| 49.4/80 | Downloads pro Monat — 5.088 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
| packages | my-pi |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 5.088 |
| unverified_packages_excluded | — |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 3.8/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 83 % der Commits |
| 4.1/13.5 | Breite der Beitragenden — 3 Beitragende |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0,829 |
| 34.9/42 | Issue-Lösungsquote — 83 % der Issues geschlossen |
| 26/30 | PR-Annahme — 177/204 entschiedene PRs gemergt |
| 0/13 | Newcomer PR acceptance — kein PR eines Erstbeitragenden in 30 Tagen entschieden |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/6 approved changesets -- score normalized to 0 |
| merged_prs | 177 |
| open_issues | 27 |
| closed_issues | 132 |
| prs_merged_7d | — |
| prs_decided_7d | — |
| prs_merged_30d | — |
| prs_decided_30d | — |
| issue_closed_ratio | 0,83 |
| closed_unmerged_prs | 27 |
| first_time_authors_30d | — |
| first_time_prs_merged_30d | — |
| first_time_prs_decided_30d | — |
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 21.5/25 | Reichweite des Inhabers — 966 Follower von spences10 |
| 25/25 | Kontohistorie — 288 öffentliche Repos, Kontoalter ca. 16 Jahre |
| followers | 966 |
| owner_type | User |
| is_verified | — |
| owner_login | spences10 |
| public_repos | 288 |
| account_age_days | 5.952 |
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 0 Tagen |
| 20/20 | Versionshistorie — 127 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | my-pi |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 0 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 24/24 | CI-Workflows — 3 Workflow(s) |
| 24/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 10 out of 10 merged PRs checked by a CI test -- score normalized to 10 |
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | nein |
| has_precommit_config | nein |
| 30/30 | README |
| 25/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://my-pi.dev |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 11 Topics |
| 10/10 | Wiki |
| topics | cli, coding-agent, llm, mcp, pi, typescript, evals, lsp, pi-package, sqlite, telemetry |
| has_wiki | ja |
| homepage | https://my-pi.dev |
| docs_site | https://my-pi.dev |
| has_readme | ja |
| has_docs_dir | ja |
| has_description | ja |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 2.5/2.5 | CI-Tests — 10 out of 10 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/6 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — keine Daten |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 5.2/7.5 | Vulnerabilities — 3 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 4,9 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Trägt ein bewusst kleines Gewicht (4 %): Agenten-Tooling ist ein echtes Pflegesignal, doch ein Repository ohne jedes Signal kann weiterhin 100/100 erreichen.
| 45/45 | Agentenanweisungen — AGENTS.md |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
| has_llms_txt | nein |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | AGENTS.md |
| agent_instruction_max_bytes | 2.643 |
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 11/11 | Statische Typprüfung — apps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 0/8 | Automatisierte Wartung — keine Daten |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | nein |
| has_tests | ja |
| lockfiles | pnpm-lock.yaml |
| has_dockerfile | nein |
| typed_language | ja |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | apps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 45/45 | Typprüfbarer Code — TypeScript (statisch typisiert) |
| 54.9/55 | Handhabbare Dateigrößen — 1/477 Quelldateien über 60 KB |
| primary_language | TypeScript |
| largest_source_bytes | 541.138 |
| source_files_sampled | 477 |
| oversized_source_files | 1 |
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 10 | CI-Tests | 10 out of 10 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/6 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10 |
| k. A. | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 7 | Vulnerabilities | 3 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| npm | @earendil-works/pi-ai | catalog: | package.json |
| npm | @earendil-works/pi-coding-agent | catalog: | package.json |
| npm | @earendil-works/pi-tui | catalog: | package.json |
| npm | @spences10/pi-project-trust | workspace:* | package.json |
| npm | @spences10/pi-settings | workspace:* | package.json |
| npm | @spences10/pi-themes | workspace:* | package.json |
| npm | @spences10/pi-tui-modal | workspace:* | package.json |
| npm | citty | ^0.2.2 | package.json |
Der aufgelöste Abhängigkeitssatz konnte für diesen Bericht nicht erhoben werden: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Stimmt etwas in diesem Bericht nicht, oder gibt es Gedanken dazu? Falsche Messungen, übersehene Tools, Ideen, Fragen — alles ist willkommen. Jede Nachricht wird gelesen und beantwortet.
Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v2.10.0, Schema v0.12.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm.