Öffentliches Register
Software-GesundheitsberichtSchema 0.12.0 · Metriken 1.13.0 · 2026-07-18 10:42 UTC

spences10 / my-pi

Composable Pi coding agent with MCP, LSP, agent chains, prompt presets, and local eval telemetry

TypeScriptMIT★ 88 Sterne⑂ 14 Forksseit Apr. 2026Auf GitHub ansehen ↗

spences10/my-pi erreicht einen Gesundheitsindex von 58 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Engineering Quality (81/100) ab, am schwächsten bei Vitality (45/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.

58
gesamt / 100
Mittel

Software-Gesundheitsindex

Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.

58
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
VitalitätCommunity &VerbreitungNachhaltigkeit &GovernanceEngineering-QualitätSicherheitAI Readiness

Bewertungsprofil

Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.

Eigentümerschaft

Scott SpencePersönliches Konto
966 Follower288 öffentliche Reposseit Apr. 2010

Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.

Paket-Ökosysteme

RegistryPaketVersionDownloads / MonatVersionenZuletzt veröffentlichtTags
npmmy-pi0.1.1145.088127vor 0 Tagenclicoding-agentevalslspmcppisqlitetelemetry

Metriken nach Kategorie

Vitalität

Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?

45Gefährdet · 22 % des Gesamtindex
Wie die Bewertung erfolgt
36/36Push-Aktualität — letzter Push vor 0 Tagen
9.7/36Commit-Rhythmus — 14/52 Wochen mit Commits
18/18Commit-Volumen — 1.004 Commits im letzten Jahr
10/10OpenSSF Scorecard: Maintained — 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10
Verwendete Eingangsdaten
commits_last_year1.004
human_commit_share
days_since_last_push0
active_weeks_last_year14
Wie die Bewertung erfolgt
0/27Liefert Releases aus — keine Releases veröffentlicht
0/36Release-Aktualität — keine Releases
0/27Release-Rhythmus — keine Releases
0/10OpenSSF Scorecard: Signed-Releases — keine Daten
Verwendete Eingangsdaten
releases_count0
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.

Community & Verbreitung

Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?

49Gefährdet · 18 % des Gesamtindex
Wie die Bewertung erfolgt
31.5/60Stars — 88 Stars
9.3/25Forks — 14 Forks
0/15Watcher — 1 Watcher
Verwendete Eingangsdaten
forks14
stars88
watchers1
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Wie die Bewertung erfolgt
22.5/22.5README
22.5/22.5Lizenz — anerkannte Lizenz (MIT)
0/18CONTRIBUTING-Leitfaden
0/13.5Verhaltenskodex
0/7.2Issue-Vorlage
0/6.3PR-Vorlage
Verwendete Eingangsdaten
has_readmeja
has_licenseja
has_contributingnein
has_issue_templatenein
has_code_of_conductnein
has_pull_request_templatenein
Wie die Bewertung erfolgt
49.4/80Downloads pro Monat — 5.088 Downloads/Monat über npm
0/20Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen
Verwendete Eingangsdaten
packagesmy-pi
dependents
ecosystemsnpm
total_downloads
monthly_downloads5.088
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.

Nachhaltigkeit & Governance

Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?

64Mittel · 24 % des Gesamtindex
Wie die Bewertung erfolgt
9/54Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab
3.8/22.5Commit-Verteilung — wichtigste beitragende Person verfasste 83 % der Commits
4.1/13.5Breite der Beitragenden — 3 Beitragende
10/10OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations
Verwendete Eingangsdaten
bus_factor1
contributors_sampled3
top_contributor_share0,829
Wie die Bewertung erfolgt
38.8/46.8Issue-Lösungsquote — 83 % der Issues geschlossen
33.2/38.3PR-Annahme — 177/204 entschiedene PRs gemergt
0/15OpenSSF Scorecard: Code-Review — Found 0/6 approved changesets -- score normalized to 0
Verwendete Eingangsdaten
merged_prs177
open_issues27
closed_issues132
issue_closed_ratio0,83
closed_unmerged_prs27
Wie die Bewertung erfolgt
10/30Organisatorische Trägerschaft — persönliches (Nutzer-)Konto
0/20Verifizierte Domain — für Nutzerkonten nicht anwendbar
21.5/25Reichweite des Inhabers — 966 Follower von spences10
25/25Kontohistorie — 288 öffentliche Repos, Kontoalter ca. 16 Jahre
Verwendete Eingangsdaten
followers966
owner_typeUser
is_verified
owner_loginspences10
public_repos288
account_age_days5.952
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Verifizierte Domain. Die verbleibenden Gewichte wurden renormalisiert.

Paketpflege

100Exzellent
Wie die Bewertung erfolgt
25/25Veröffentlicht & auflösbar — 1 Paket(e) auf npm
35/35Veröffentlichungsaktualität — letzte Veröffentlichung vor 0 Tagen
20/20Versionshistorie — 127 veröffentlichte Versionen
20/20Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen
Verwendete Eingangsdaten
packagesmy-pi
ecosystemsnpm
any_deprecatednein
min_days_since_publish0

Engineering-Qualität

Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?

81Gut · 20 % des Gesamtindex
Wie die Bewertung erfolgt
24/24CI-Workflows — 3 Workflow(s)
24/24Tests vorhanden
0/16Linter-Konfiguration
0/9.6Pre-Commit-Hooks
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 10 out of 10 merged PRs checked by a CI test -- score normalized to 10
Verwendete Eingangsdaten
has_cija
has_testsja
has_editorconfignein
has_linter_confignein
has_precommit_confignein

Dokumentation

100Exzellent
Wie die Bewertung erfolgt
30/30README
25/25Dokumentationsverzeichnis
15/15Dokumentations-/Homepage-Site — https://my-pi.dev
10/10Repository-Beschreibung
10/10Topics — 11 Topics
10/10Wiki
Verwendete Eingangsdaten
topicscli, coding-agent, llm, mcp, pi, typescript, evals, lsp, pi-package, sqlite, telemetry
has_wikija
homepagehttps://my-pi.dev
has_readmeja
has_docs_dirja
has_descriptionja

Sicherheit

Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?

49Gefährdet · 16 % des Gesamtindex

Sicherheitslage

49Gefährdet
Wie die Bewertung erfolgt
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
2.5/2.5CI-Tests — 10 out of 10 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/6 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 6 contributing companies or organizations
10/10Dangerous-Workflow — no dangerous workflow patterns detected
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Lizenz — license file detected
7.5/7.5Maintained — 30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10
0/5Packaging — keine Daten
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — keine Daten
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
5.2/7.5Vulnerabilities — 3 existing vulnerabilities detected
Verwendete Eingangsdaten
sourceopenssf_scorecard
checks_evaluated16
scorecard_versionv5.5.0
checks_inconclusive2
scorecard_aggregate4,9
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): packaging, signed_releases. Die verbleibenden Gewichte wurden renormalisiert.

AI Readiness

Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.

69Mittel · 0 % des Gesamtindex
Wie die Bewertung erfolgt
45/45Agentenanweisungen — AGENTS.md
0/15Maschinenlesbare Doku (llms.txt)
0/40Lesbare Commit-Historie — keine Daten
Verwendete Eingangsdaten
has_llms_txtnein
legible_history_share
agent_instruction_filesAGENTS.md
agent_instruction_max_bytes2.643
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Lesbare Commit-Historie. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
0/18Bootstrap mit einem Befehl
22/22Automatisierte Tests
0/11Lint-/Format-Konfiguration
11/11Statische Typprüfung — apps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json
10/10Reproduzierbare Umgebung — lockfile
0/10Belegte Agentenpraxis — keine Daten
0/8Automatisierte Wartung — keine Daten
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Verwendete Eingangsdaten
has_nixnein
has_testsja
lockfilespnpm-lock.yaml
has_dockerfilenein
typed_languageja
bootstrap_files
has_devcontainernein
has_linter_confignein
typecheck_configsapps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Belegte Agentenpraxis, Automatisierte Wartung. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
45/45Typprüfbarer Code — TypeScript (statisch typisiert)
54.9/55Handhabbare Dateigrößen — 1/477 Quelldateien über 60 KB
Verwendete Eingangsdaten
primary_languageTypeScript
largest_source_bytes541.138
source_files_sampled477
oversized_source_files1

Eckdaten

88GitHub-Sterne
3Mitwirkende
1.004Commits, letzte 12 Monate
0Tage seit letztem Push
0Releases
1Bus-Faktor
27offene Issues
npmPaket-Ökosysteme

Warnungen zur Datenerhebung

  • GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

Weitere Details

OpenSSF Scorecard 4.9 / 10
4.9Gesamtwert

Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).Scorecard v5.5.0 · 2026-07-18 10:42 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
10CI-Tests10 out of 10 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/6 approved changesets -- score normalized to 0
10Contributorsproject has 6 contributing companies or organizations
10Dangerous-Workflowno dangerous workflow patterns detected
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
10Maintained30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10
k. A.Packagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
k. A.Signed-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
7Vulnerabilities3 existing vulnerabilities detected
Direkte Abhängigkeiten 8
RegistryPaketVersionsvorgabeManifest
npm@earendil-works/pi-aicatalog:package.json
npm@earendil-works/pi-coding-agentcatalog:package.json
npm@earendil-works/pi-tuicatalog:package.json
npm@spences10/pi-project-trustworkspace:*package.json
npm@spences10/pi-settingsworkspace:*package.json
npm@spences10/pi-themesworkspace:*package.json
npm@spences10/pi-tui-modalworkspace:*package.json
npmcitty^0.2.2package.json
Alle Abhängigkeiten nicht erhoben

Der aufgelöste Abhängigkeitssatz konnte für diesen Bericht nicht erhoben werden: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

JSON-Rohbericht maschinenlesbar
{
  "data": {
    "repo": {
      "topics": [
        "cli",
        "coding-agent",
        "llm",
        "mcp",
        "pi",
        "typescript",
        "evals",
        "lsp",
        "pi-package",
        "sqlite",
        "telemetry"
      ],
      "is_fork": false,
      "size_kb": 6840,
      "has_wiki": true,
      "homepage": "https://my-pi.dev",
      "languages": {
        "CSS": 13364,
        "HTML": 634,
        "Svelte": 104133,
        "JavaScript": 44080,
        "TypeScript": 2008254
      },
      "pushed_at": "2026-07-18T08:26:09Z",
      "created_at": "2026-04-11T21:23:11Z",
      "owner_type": "User",
      "updated_at": "2026-07-18T08:24:41Z",
      "description": "Composable Pi coding agent with MCP, LSP, agent chains, prompt presets, and local eval telemetry",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "primary_language": "TypeScript",
      "significant_languages": [
        "TypeScript"
      ]
    },
    "owner": {
      "blog": "https://scottspence.com",
      "name": "Scott Spence",
      "type": "User",
      "login": "spences10",
      "company": null,
      "location": "London, United Kingdom",
      "followers": 966,
      "avatar_url": "https://avatars.githubusercontent.com/u/234708?v=4",
      "created_at": "2010-04-01T05:52:38Z",
      "is_verified": null,
      "public_repos": 288,
      "account_age_days": 5952
    },
    "activity": {
      "releases_count": 0,
      "commits_last_year": 1004,
      "latest_release_at": null,
      "latest_release_tag": null,
      "releases_from_tags": false,
      "days_since_last_push": 0,
      "active_weeks_last_year": 14,
      "days_since_latest_release": null,
      "mean_days_between_releases": null
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 42,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "my-pi",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "cli",
            "coding-agent",
            "evals",
            "lsp",
            "mcp",
            "pi",
            "sqlite",
            "telemetry"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/my-pi",
          "is_deprecated": false,
          "latest_version": "0.1.114",
          "repository_url": "git+https://github.com/spences10/my-pi.git",
          "versions_count": 127,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 5088,
          "first_published_at": "2026-04-11T22:08:14.069000Z",
          "latest_published_at": "2026-07-17T12:28:36.689000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 0
        }
      ]
    },
    "popularity": {
      "forks": 14,
      "stars": 88,
      "watchers": 1,
      "open_issues_and_prs": 30
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "apps/web/tsconfig.json",
        "packages/pi-child-env/tsconfig.json",
        "packages/pi-codex-usage/tsconfig.json",
        "packages/pi-coding-preferences/tsconfig.json",
        "packages/pi-confirm-destructive/tsconfig.json",
        "packages/pi-context/tsconfig.json",
        "packages/pi-factory/tsconfig.json",
        "packages/pi-footer/tsconfig.json",
        "packages/pi-git-ui/tsconfig.json",
        "packages/pi-harness/tsconfig.json",
        "packages/pi-lsp/tsconfig.json",
        "packages/pi-mcp/tsconfig.json",
        "packages/pi-nopeek/tsconfig.json",
        "packages/pi-observability/src/web/tsconfig.json",
        "packages/pi-observability/tsconfig.json",
        "packages/pi-omnisearch/tsconfig.json",
        "packages/pi-project-trust/tsconfig.json",
        "packages/pi-recall/tsconfig.json",
        "packages/pi-redact/tsconfig.json",
        "packages/pi-settings/tsconfig.json",
        "packages/pi-skill-importer/tsconfig.json",
        "packages/pi-skills/tsconfig.json",
        "packages/pi-sqlite-core/tsconfig.json",
        "packages/pi-sqlite-tools/tsconfig.json",
        "packages/pi-svelte-guardrails/tsconfig.json",
        "packages/pi-team-mode/tsconfig.json",
        "packages/pi-telemetry/tsconfig.json",
        "packages/pi-tui-modal/tsconfig.json",
        "tsconfig.json"
      ],
      "largest_source_bytes": 541138,
      "source_files_sampled": 477,
      "oversized_source_files": 1,
      "agent_instruction_files": [
        "AGENTS.md"
      ],
      "agent_instruction_max_bytes": 2643
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "ecosystems": [
        "npm"
      ],
      "dependencies": [
        {
          "name": "@earendil-works/pi-ai",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "catalog:"
        },
        {
          "name": "@earendil-works/pi-coding-agent",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "catalog:"
        },
        {
          "name": "@earendil-works/pi-tui",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "catalog:"
        },
        {
          "name": "@spences10/pi-project-trust",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "workspace:*"
        },
        {
          "name": "@spences10/pi-settings",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "workspace:*"
        },
        {
          "name": "@spences10/pi-themes",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "workspace:*"
        },
        {
          "name": "@spences10/pi-tui-modal",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "workspace:*"
        },
        {
          "name": "citty",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^0.2.2"
        }
      ],
      "all_dependencies": {
        "error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
        "source": null,
        "packages": [],
        "collected": false,
        "truncated": false,
        "total_count": null,
        "direct_count": null,
        "indirect_count": null
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 3,
        "merged_prs": 177,
        "open_issues": 27,
        "closed_ratio": 0.83,
        "closed_issues": 132,
        "closed_unmerged_prs": 27
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "spences10",
          "commits": 831,
          "avatar_url": "https://avatars.githubusercontent.com/u/234708?u=b5aa0cca1b3134278a8a2ab99ff1ff8b405ebffd&v=4"
        },
        {
          "type": "Bot",
          "login": "renovate[bot]",
          "commits": 152,
          "avatar_url": "https://avatars.githubusercontent.com/in/2740?v=4"
        },
        {
          "type": "User",
          "login": "ImgBotApp",
          "commits": 20,
          "avatar_url": "https://avatars.githubusercontent.com/u/31427850?u=464006d20c236f7bbec4ae1b2ae80bf4c1ebd57a&v=4"
        }
      ],
      "contributors_sampled": 3,
      "top_contributor_share": 0.829
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "ci.yml",
        "semgrep.yml",
        "web.yml"
      ],
      "has_docs_dir": true,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "pnpm-lock.yaml"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "10 out of 10 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/6 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 6 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 10,
            "reason": "30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 7,
            "reason": "3 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "7a8f7f2ec7a02d9e99b3d80a5c0000228b5a6449",
        "ran_at": "2026-07-18T10:42:15Z",
        "aggregate_score": 4.9,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/spences10/my-pi",
    "host": "github.com",
    "name": "my-pi",
    "owner": "spences10"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 58,
      "inputs": {
        "security": 49,
        "vitality": 45,
        "community": 49,
        "governance": 64,
        "engineering": 81
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "at_risk",
        "name": "Vitality",
        "value": 45,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "good",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 74,
            "inputs": {
              "commits_last_year": 1004,
              "human_commit_share": null,
              "days_since_last_push": 0,
              "active_weeks_last_year": 14
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "14/52 weeks with commits",
                "points": 9.7,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 14
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "1004 commits in the last year",
                "points": 18,
                "status": "met",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 1004
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "critical",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "releases_count": 0
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "no releases published",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_releases_published",
                    "params": {}
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "no releases",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_releases",
                    "params": {}
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "no releases",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_releases",
                    "params": {}
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 49,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "at_risk",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 41,
            "inputs": {
              "forks": 14,
              "stars": 88,
              "watchers": 1,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "88 stars",
                "points": 31.5,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 88
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "14 forks",
                "points": 9.3,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 14
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "1 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 62,
            "inputs": {
              "packages": [
                "my-pi"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 5088
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "5,088 downloads/month across npm",
                "points": 49.4,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 5088,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 64,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 27,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 3,
              "top_contributor_share": 0.829
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 83% of commits",
                "points": 3.8,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 83
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "3 contributors",
                "points": 4.1,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 6 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "good",
            "name": "Issue & PR responsiveness",
            "note": null,
            "notes": [],
            "value": 72,
            "inputs": {
              "merged_prs": 177,
              "open_issues": 27,
              "closed_issues": 132,
              "issue_closed_ratio": 0.83,
              "closed_unmerged_prs": 27
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "83% of issues closed",
                "points": 38.8,
                "status": "partial",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 83
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "177/204 decided PRs merged",
                "points": 33.2,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 177,
                      "decided": 204
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/6 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "good",
            "name": "Ownership & stewardship",
            "note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "verified_domain"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 71,
            "inputs": {
              "followers": 966,
              "owner_type": "User",
              "is_verified": null,
              "owner_login": "spences10",
              "public_repos": 288,
              "account_age_days": 5952
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "personal (user) account",
                "points": 10,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_personal",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": "not applicable to user accounts",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_applicable_to_user_accounts",
                    "params": {}
                  }
                ],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "966 followers of spences10",
                "points": 21.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 966,
                      "login": "spences10"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "288 public repos, account ~16 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 288
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 16
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "my-pi"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 0
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 0 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "127 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 127
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "good",
        "name": "Engineering Quality",
        "value": 81,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "moderate",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "3 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "10 out of 10 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "excellent",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "topics": [
                "cli",
                "coding-agent",
                "llm",
                "mcp",
                "pi",
                "typescript",
                "evals",
                "lsp",
                "pi-package",
                "sqlite",
                "telemetry"
              ],
              "has_wiki": true,
              "homepage": "https://my-pi.dev",
              "has_readme": true,
              "has_docs_dir": true,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 25,
                "status": "met",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": "https://my-pi.dev",
                "points": 15,
                "status": "met",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "11 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 11
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 49,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 49,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 16,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 2,
              "scorecard_aggregate": 4.9
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "10 out of 10 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/6 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 6 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "30 commit(s) and 29 issue activity found in the last 90 days -- score normalized to 10",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "3 existing vulnerabilities detected",
                "points": 5.2,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 3
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 69,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "good",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 75,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [
                "AGENTS.md"
              ],
              "agent_instruction_max_bytes": 2643
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "AGENTS.md",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "AGENTS.md"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "moderate",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 52,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [
                "pnpm-lock.yaml"
              ],
              "has_dockerfile": false,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [
                "apps/web/tsconfig.json",
                "packages/pi-child-env/tsconfig.json",
                "packages/pi-codex-usage/tsconfig.json",
                "packages/pi-coding-preferences/tsconfig.json",
                "packages/pi-confirm-destructive/tsconfig.json",
                "packages/pi-context/tsconfig.json",
                "packages/pi-factory/tsconfig.json",
                "packages/pi-footer/tsconfig.json",
                "packages/pi-git-ui/tsconfig.json",
                "packages/pi-harness/tsconfig.json",
                "packages/pi-lsp/tsconfig.json",
                "packages/pi-mcp/tsconfig.json",
                "packages/pi-nopeek/tsconfig.json",
                "packages/pi-observability/src/web/tsconfig.json",
                "packages/pi-observability/tsconfig.json",
                "packages/pi-omnisearch/tsconfig.json",
                "packages/pi-project-trust/tsconfig.json",
                "packages/pi-recall/tsconfig.json",
                "packages/pi-redact/tsconfig.json",
                "packages/pi-settings/tsconfig.json",
                "packages/pi-skill-importer/tsconfig.json",
                "packages/pi-skills/tsconfig.json",
                "packages/pi-sqlite-core/tsconfig.json",
                "packages/pi-sqlite-tools/tsconfig.json",
                "packages/pi-svelte-guardrails/tsconfig.json",
                "packages/pi-team-mode/tsconfig.json",
                "packages/pi-telemetry/tsconfig.json",
                "packages/pi-tui-modal/tsconfig.json",
                "tsconfig.json"
              ],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "apps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "apps/web/tsconfig.json, packages/pi-child-env/tsconfig.json, packages/pi-codex-usage/tsconfig.json, packages/pi-coding-preferences/tsconfig.json, packages/pi-confirm-destructive/tsconfig.json, packages/pi-context/tsconfig.json, packages/pi-factory/tsconfig.json, packages/pi-footer/tsconfig.json, packages/pi-git-ui/tsconfig.json, packages/pi-harness/tsconfig.json, packages/pi-lsp/tsconfig.json, packages/pi-mcp/tsconfig.json, packages/pi-nopeek/tsconfig.json, packages/pi-observability/src/web/tsconfig.json, packages/pi-observability/tsconfig.json, packages/pi-omnisearch/tsconfig.json, packages/pi-project-trust/tsconfig.json, packages/pi-recall/tsconfig.json, packages/pi-redact/tsconfig.json, packages/pi-settings/tsconfig.json, packages/pi-skill-importer/tsconfig.json, packages/pi-skills/tsconfig.json, packages/pi-sqlite-core/tsconfig.json, packages/pi-sqlite-tools/tsconfig.json, packages/pi-svelte-guardrails/tsconfig.json, packages/pi-team-mode/tsconfig.json, packages/pi-telemetry/tsconfig.json, packages/pi-tui-modal/tsconfig.json, tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "primary_language": "TypeScript",
              "largest_source_bytes": 541138,
              "source_files_sampled": 477,
              "oversized_source_files": 1
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "TypeScript (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "TypeScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "1/477 source files over 60KB",
                "points": 54.9,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 477,
                      "oversized": 1
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-18T10:42:27.442225Z",
  "schema_version": "0.12.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/s/spences10/my-pi.svg",
  "full_name": "spences10/my-pi",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.

Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.12.0 — vollständige Methodik · Metriken-Wiki.

Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistikennpm.