Öffentliches RegisterGefährdet
Software-GesundheitsberichtSchema 0.27.0 · Metriken 1.13.0 · 2026-07-26 01:16 UTC
OjasKord / data-compliance-mcp
Classify data safety before your agent stores or shares it. GDPR, HIPAA, PCI-DSS, CCPA. AI-powered
OjasKord/data-compliance-mcp erreicht einen Gesundheitsindex von 39 von 100 und liegt damit im Bereich Gefährdet. Am stärksten schneidet es bei Vitality (70/100) ab, am schwächsten bei AI Readiness (18/100). Zuletzt vor 6 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
39
gesamt / 100Software-Gesundheitsindex
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
39
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
Bewertungsprofil
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Eigentümerschaft
OjasKordPersönliches Konto
0 Follower11 öffentliche Reposseit März 2026
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
Paket-Ökosysteme
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | data-compliance-mcp | 1.0.32 | 2.197 | 28 | vor 5 Tagen | mcpgdprhipaapci-dssccpadata-compliancepiiphidata-safetyprivacycomplianceai-agentsdata-classificationregulatory-compliance |
Metriken nach Kategorie
Vitalität
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
70
Entwicklungsaktivität
68Mittel
Wie die Bewertung erfolgt
| 36/36 | Push-Aktualität — letzter Push vor 6 Tagen |
| 6.2/36 | Commit-Rhythmus — 9/52 Wochen mit Commits |
| 15.6/18 | Commit-Volumen — 54 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Verwendete Eingangsdaten
| commits_last_year | 54 |
| human_commit_share | 1 |
| days_since_last_push | 6 |
| active_weeks_last_year | 9 |
Release-Disziplin
72Gut
Wie die Bewertung erfolgt
| 16.2/27 | Liefert Releases aus — 1 Versions-Tags (keine GitHub-Releases) |
| 36/36 | Release-Aktualität — letztes Release vor 31 Tagen |
| 12.6/27 | Release-Rhythmus — Rhythmus unbekannt (nur ein Release) |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
Verwendete Eingangsdaten
| releases_count | 1 |
| latest_release_tag | v1.0.24 |
| releases_from_tags | ja |
| days_since_latest_release | 31 |
| mean_days_between_releases | — |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.
Community & Verbreitung
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
32
Popularität & Verbreitung
1Kritisch
Wie die Bewertung erfolgt
| 0/60 | Stars — 0 Stars |
| 0/25 | Forks — 0 Forks |
| 0/15 | Watcher — 0 Watcher |
Verwendete Eingangsdaten
| forks | 0 |
| stars | 0 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community-Gesundheit
50Mittel
Wie die Bewertung erfolgt
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
Verwendete Eingangsdaten
| has_readme | ja |
| has_license | ja |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | nein |
Wie die Bewertung erfolgt
| 44.6/80 | Downloads pro Monat — 2.197 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
Verwendete Eingangsdaten
| packages | data-compliance-mcp |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 2.197 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.
Nachhaltigkeit & Governance
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
29
Maintainer-Resilienz (Bus-Faktor)
10Kritisch
Wie die Bewertung erfolgt
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 0/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 100 % der Commits |
| 1.4/13.5 | Breite der Beitragenden — 1 Beitragende |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
Verwendete Eingangsdaten
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
Reaktionsfähigkeit bei Issues & PRs
1Kritisch
Wie die Bewertung erfolgt
| 0/46.8 | Issue-Lösungsquote — keine Issues oder keine Daten |
| 0/38.3 | PR-Annahme — keine entschiedenen Pull Requests oder keine Daten |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Verwendete Eingangsdaten
| merged_prs | 0 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 0 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Issue-Lösungsquote, PR-Annahme. Die verbleibenden Gewichte wurden renormalisiert.
Eigentümerschaft & Trägerschaft
23Kritisch
Wie die Bewertung erfolgt
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 0/25 | Reichweite des Inhabers — 0 Follower von OjasKord |
| 8.5/25 | Kontohistorie — 11 öffentliche Repos, Kontoalter ca. 0 Jahre |
Verwendete Eingangsdaten
| followers | 0 |
| owner_type | User |
| is_verified | — |
| owner_login | OjasKord |
| public_repos | 11 |
| account_age_days | 120 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Verifizierte Domain. Die verbleibenden Gewichte wurden renormalisiert.
Paketpflege
100Exzellent
Wie die Bewertung erfolgt
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 5 Tagen |
| 20/20 | Versionshistorie — 28 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
Verwendete Eingangsdaten
| packages | data-compliance-mcp |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 5 |
Engineering-Qualität
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
27
Engineering-Praktiken
1Kritisch
Wie die Bewertung erfolgt
| 0/24 | CI-Workflows |
| 0/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — keine Daten |
Verwendete Eingangsdaten
| has_ci | nein |
| has_tests | nein |
| has_editorconfig | nein |
| has_linter_config | nein |
| has_precommit_config | nein |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: CI-Tests. Die verbleibenden Gewichte wurden renormalisiert.
Dokumentation
65Mittel
Wie die Bewertung erfolgt
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://kordagencies.com |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 12 Topics |
| 0/10 | Wiki |
Verwendete Eingangsdaten
| topics | compliance, data-classification, data-privacy, data-safety, gdpr, hipaa, mcp-agent, pci-dss, pii, pii-detection, privacy, sensitive-data-validator |
| has_wiki | nein |
| homepage | https://kordagencies.com |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sicherheit
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
37
Sicherheitslage
37Gefährdet
Wie die Bewertung erfolgt
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — keine Daten |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 0/10 | Dangerous-Workflow — keine Daten |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — keine Daten |
| 0/5 | Pinned-Dependencies — keine Daten |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — keine Daten |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Verwendete Eingangsdaten
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 3,7 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): ci_tests, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Die verbleibenden Gewichte wurden renormalisiert.
AI Readiness
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
18
AI-Agentenkontext & Leitlinien
21Kritisch
Wie die Bewertung erfolgt
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 20.7/40 | Lesbare Commit-Historie — 21 von 54 menschlichen Commits benennen ihre Absicht (strukturierter Betreff oder erläuternder Text) |
Verwendete Eingangsdaten
| has_llms_txt | nein |
| legible_history_share | 0,389 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Wie die Bewertung erfolgt
| 0/18 | Bootstrap mit einem Befehl |
| 0/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 0/11 | Statische Typprüfung |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 10/10 | Belegte Agentenpraxis — 7 der letzten 54 Commits von Agenten verfasst oder ihnen zugeschrieben |
| 0/8 | Automatisierte Wartung — keine automatisierten Abhängigkeits-Updates beobachtet |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — keine Daten |
Verwendete Eingangsdaten
| has_nix | nein |
| has_tests | nein |
| lockfiles | package-lock.json |
| has_dockerfile | nein |
| typed_language | nein |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | — |
| agent_commit_share | 0,13 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Pinned-Dependencies. Die verbleibenden Gewichte wurden renormalisiert.
AI-Code-Lesbarkeit für Modelle
1Kritisch
Wie die Bewertung erfolgt
| 0/45 | Typprüfbarer Code — JavaScript ohne Typprüfungs-Konfiguration |
| 0/55 | Handhabbare Dateigrößen — 1/1 Quelldateien über 60 KB |
Verwendete Eingangsdaten
| primary_language | JavaScript |
| largest_source_bytes | 87.407 |
| source_files_sampled | 1 |
| oversized_source_files | 1 |
Eckdaten
0GitHub-Sterne
1Mitwirkende
54Commits, letzte 12 Monate
6Tage seit letztem Push
1Releases
1Bus-Faktor
0offene Issues
npmPaket-Ökosysteme
Warnungen zur Datenerhebung
- GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Weitere Details
OpenSSF Scorecard 3.7 / 10
3.7Gesamtwert
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| k. A. | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| k. A. | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| k. A. | Packaging | packaging workflow not detected |
| k. A. | Pinned-Dependencies | no dependencies found |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| k. A. | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Alle Abhängigkeiten nicht erhoben
Der aufgelöste Abhängigkeitssatz konnte für diesen Bericht nicht erhoben werden: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
JSON-Rohbericht maschinenlesbar
{
"data": {
"repo": {
"topics": [
"compliance",
"data-classification",
"data-privacy",
"data-safety",
"gdpr",
"hipaa",
"mcp-agent",
"pci-dss",
"pii",
"pii-detection",
"privacy",
"sensitive-data-validator"
],
"is_fork": false,
"size_kb": 147,
"has_wiki": false,
"homepage": "https://kordagencies.com",
"languages": {
"JavaScript": 87407
},
"pushed_at": "2026-07-20T01:03:00Z",
"created_at": "2026-04-21T09:53:12Z",
"owner_type": "User",
"updated_at": "2026-07-20T01:03:04Z",
"description": "Classify data safety before your agent stores or shares it. GDPR, HIPAA, PCI-DSS, CCPA. AI-powered",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "JavaScript",
"significant_languages": [
"JavaScript"
]
},
"owner": {
"blog": null,
"name": null,
"type": "User",
"login": "OjasKord",
"company": null,
"location": null,
"followers": 0,
"avatar_url": "https://avatars.githubusercontent.com/u/271656763?v=4",
"created_at": "2026-03-28T00:28:05Z",
"is_verified": null,
"public_repos": 11,
"account_age_days": 120
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v1.0.24",
"kind": "patch",
"published_at": "2026-06-24T08:17:25Z"
}
],
"recent_commits": [
{
"oid": "ccd1b0447d466e9e9a7addeea5e1c40e98507cf3",
"body": null,
"is_bot": false,
"headline": "v1.0.32 fix redisSet Upstash env var bypass",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-07-20T01:02:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "188c4c46114775b41f16a8944d35669dbc72d134",
"body": null,
"is_bot": false,
"headline": "1.0.31",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-07-03T02:03:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5d2b2821562cc3726d1b2dfecca662af1aeef229",
"body": "…ety_lite consequence sentences",
"is_bot": false,
"headline": "v1.0.31 fix description gaps: get_safety_report and validate_data_saf…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-07-03T01:38:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0f788143eac9a8b7dee4870944bfa80a167bd06e",
"body": null,
"is_bot": false,
"headline": "1.0.30",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-29T03:53:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b8f3ba6fc891f6d5fd841932b136715df28b81f",
"body": null,
"is_bot": false,
"headline": "feat: add /.well-known/glama.json ownership endpoint v1.0.29",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-29T03:40:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "adbdd7019dbe802c1ba4eaac93691a5f6a6d5e0c",
"body": null,
"is_bot": false,
"headline": "fix: glama.json — add schema, remote.url, categories for Glama indexing",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-29T02:55:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0af50650eb29ba549f033b9e11ed0911f6ac8dd",
"body": null,
"is_bot": false,
"headline": "1.0.28",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T08:00:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ab21a21a72471ec41dc1bd9eb4f117e8c71e9494",
"body": "…ructured field (v1.0.28)\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "fix: gate email dedup, HALT_WORKFLOW agent_action, trial_extension st…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T07:52:54Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "947e716969a5c5430da6f79518f8aa3904acbf00",
"body": null,
"is_bot": false,
"headline": "1.0.27",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T07:41:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db2a5507484d2ad8bb1136df802cabe6a6df6073",
"body": "Co-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "1.0.27 feat: owner key bypass for fleet owner (OWNER_KEY env var)",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T01:26:18Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "01f9bbfd2df0e96ba47d3c9848610c93fa31a08a",
"body": null,
"is_bot": false,
"headline": "1.0.26",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-26T08:28:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "06927dac5a6aef95d0d5d7c7c3bfe14231cf7ce8",
"body": "…r permanent audit trail",
"is_bot": false,
"headline": "v1.0.26 fix: persist trial extensions to Redis (dcc:trial:{email}) fo…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-26T08:26:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "62a662ca02fdc31e8c80567a3819dc1ebdc32a43",
"body": "Task 1 (purpose verb + required fields) confirmed already done on all 3 tools\nfrom a prior ATO optimisation pass -- no changes needed. Tasks 2-4 implemented\nfollowing the bizfile-mcp v4.10.47 reference pattern.",
"is_bot": false,
"headline": "v1.0.25 — calls_remaining, verdict_ttl, data_source_status fields",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-25T04:18:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a5d8856d8e694b517cb6408426e7047ccf41596",
"body": null,
"is_bot": false,
"headline": "chore: sync server.json version to match published npm version",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-24T08:27:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f0dc1317f2ceb6e77fee2a94a444c38fb9d4fa38",
"body": null,
"is_bot": false,
"headline": "1.0.24",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-24T08:17:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0c97a9446d20ea1a003d38ca85378d3e01056cd3",
"body": "…n followups, outputSchema, accuracy fixes\n\nAdds unauthenticated /public-stats (lifetime calls, uptime %, first_deployed,\nversion) for agent orchestrators. Gate responses are now self-contained\n(server + workflow impact + upgrade path in one sentence) and detect\ncross-server operators via shared fleet Redis. Added outputSchema to all 3\ntools (additive). smithery.yaml claimed \"2 focused tools\" -- corrected to 3.\nglama.json and README were missing validate_data_safety_lite from their\ntool lists.",
"is_bot": false,
"headline": "v1.0.24 -- public-stats, fleet-wide gate improvements, trial-extensio…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-24T06:42:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9d7fb5c2e4e5d2fbab3b8b650d481d04f49f7ec6",
"body": "Bump to v1.0.23. Add agentRole to smithery.yaml.",
"is_bot": false,
"headline": "fix: gate returns HTTP 402 (x402 standard for non-transient quota)",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-23T08:01:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1ddf2d14066717fe5fae23bcb1940cb6863cc772",
"body": null,
"is_bot": false,
"headline": "feat: email notification on free tier gate hit",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-20T15:09:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a9e62c7a1474f941feb33759f4a8338242fe99d2",
"body": "Add charge.refunded webhook handler: looks up the checkout session by\npayment_intent via the Stripe REST API, matches the customer email\nagainst issued API keys, and deletes the key from Redis, the in-memory\nmap, and the on-disk snapshot.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "feat: revoke API key on Stripe refund",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-18T03:14:54Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "e27a8cd7e68594553db187144d61b3c64fd755d1",
"body": "… provisioning",
"is_bot": false,
"headline": "fix: Stripe webhook validates payment_link ID to prevent cross-server…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-17T08:53:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9f526f74bf1add9dbd811685eac397dcfadff2cd",
"body": null,
"is_bot": false,
"headline": "fix: sync server.json version to 1.0.19",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-17T07:18:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "657637a621d65d655d90a506c866cd315840c4fb",
"body": "…, ToolRank badge\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "feat: ATO optimisation — purpose verb, usage context, required fields…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-16T01:52:25Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "27e18c7a0f2907c7d65071da3fae4acdc049d63e",
"body": "…FE verdict responses",
"is_bot": false,
"headline": "v1.0.18 feat: add hold_reason, retry_after, escalation_path to non-SA…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-15T10:06:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "16196c58f03795ee6a8213b4a4490cc41fee5515",
"body": "…iscovery",
"is_bot": false,
"headline": "v1.0.17 feat: reposition tool descriptions for agentic payment rail d…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-15T09:48:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4a2388716ebf280fbb1c799f6be3ed1f4e6fc20f",
"body": null,
"is_bot": false,
"headline": "v1.0.16 feat: server-card.json static metadata",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T07:27:44Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4d83b91e48288c15bf4123f8bfdfff0460b0dd08",
"body": null,
"is_bot": false,
"headline": "fix: bump to v1.0.15 past existing npm publish",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T06:54:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ad3d52d9aa529288a592dbc04c46a1b29ee11f04",
"body": null,
"is_bot": false,
"headline": "feat: add Smithery icon",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T06:44:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a93dcd95af46cebe8bb631687bf98b9d5e29b98",
"body": null,
"is_bot": false,
"headline": "v1.0.14 feat: kill switch + per-minute rate limiting",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T03:12:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f19e62559f51d7c767f25b7f984f15c1e99667cf",
"body": null,
"is_bot": false,
"headline": "v1.0.13 fix: BEFORE trigger language + consequence-first limit error",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-08T01:30:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ede879e43850280da9f61877e53d3b0d28aac961",
"body": null,
"is_bot": false,
"headline": "v1.0.12 feat: Smithery score optimisation",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-05T02:33:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c1d4db1600b68730a1864a3aa51a9ba58ed9af0",
"body": null,
"is_bot": false,
"headline": "v1.0.11 feat: daily-report endpoint",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-04T04:35:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5e4907f776b8610105887e8e9c734cdeaf28c655",
"body": "…criptions\n\n- Upstash Redis helpers (redisGet/Set/Expire/Keys) verbatim from bizfile pattern\n- Free tier persistence: loadFreeTierFromRedis/saveFreeTierToRedis with Math.max merge\n- API key persistence: saveKeyToRedis/loadApiKeysFromRedis with prefix dcc\n- appendSessionLog with 24h TTL; /session-log\n[…]\nlisten: async + await loadApiKeysFromRedis + loadFreeTierFromRedis\n- Three tool descriptions rewritten for orchestral agent runtime selection\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "v1.0.10 feat: Redis persistence, session logging, agent-optimised des…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-04T00:56:21Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "03b910572899d1f335d8bee9601cbda1c0086313",
"body": null,
"is_bot": false,
"headline": "fix: sync VERSION constant to match package.json",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-02T06:33:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "acc29b2362327b383d584d25c9fa953904c54d29",
"body": null,
"is_bot": false,
"headline": "v1.0.9 fix: IP extraction Cloudflare fix",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-02T02:40:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4113db77ea238b9789e92154157a8655fc28bc71",
"body": null,
"is_bot": false,
"headline": "add Harness Integration section to README",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-05T02:56:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0fdda7b7b4291c33114bd698d8316343791eef19",
"body": null,
"is_bot": false,
"headline": "bump to v1.0.7",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-03T09:35:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0e94773b2c08db9e7b9958271daf0967fef74ed",
"body": "… and monthly free tier reset",
"is_bot": false,
"headline": "v1.0.7 update descriptions, add REPORT mode, fix paid key persistence…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-03T09:35:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ef719752fcea27c4345ff9498c59359a60120380",
"body": null,
"is_bot": false,
"headline": "fix: update README pricing to prepaid bundles",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-02T12:16:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4d1fd2b8885a8d35d0baa1546198e355cadd5b51",
"body": null,
"is_bot": false,
"headline": "chore: bump package.json version to 1.0.6",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-02T11:35:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc644426a87e180a4bccf0cadc269e1ca48cc322",
"body": "Co-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "chore: budget ledger + idempotency + error improvements",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-02T00:08:02Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "24d8f5524008d0954982a51cc90e6678ef3f5cc4",
"body": null,
"is_bot": false,
"headline": "add Smithery badge to README",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-29T23:14:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "372d3af25462f7754096da65abff16ac5f4827e5",
"body": null,
"is_bot": false,
"headline": "v1.0.5 -- bump server.json version",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-28T02:26:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5508d517bffaf2197d0e11e5664cf19a5f2b654f",
"body": "STRIPE_PRO_URL updated to new prepaid bundle link, ENTERPRISE_UPGRADE_URL added.\nFree tier limit errors now direct agents to prepaid bundle links\n(500 calls for $24, calls never expire).\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "v1.0.5 -- update payment links to prepaid bundle URLs",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-28T02:24:16Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "54e980a7600b7adbd5adac7afa47611a9871b758",
"body": null,
"is_bot": false,
"headline": "add MIT license",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-28T00:20:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "55edca336a17186d63efec02367da72674388678",
"body": "…alidate_data_safety_lite",
"is_bot": false,
"headline": "v1.0.4 budget-aware: token_count, /ready endpoint, enhanced errors, v…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T16:38:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f7bb4f3ec138d13b583c41c2d073d74120d6db0d",
"body": null,
"is_bot": false,
"headline": "v1.0.3 Smithery metadata fix -- description, systemPrompt added",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T06:34:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "82af17671517d0e6a1e9ec7844aa5dcf23d9a274",
"body": null,
"is_bot": false,
"headline": "v1.0.3 -- TCO description rewrite, ICO fine consequence, bundle pricing",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T01:09:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "735c2a66a24849451c01cab3acf2a6b2d9c6006f",
"body": null,
"is_bot": false,
"headline": "chore: add v1.0.2 changelog entry",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T00:14:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "28ea38c4918f90ceb60b9747c2a7bff759eb3654",
"body": "…ths, source_url, match_verdict",
"is_bot": false,
"headline": "v1.0.2: VERSION constant, stdio handler, agent_action in all error pa…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-25T23:15:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3df561f07dee1455819cd4e40f6eba69b6e34622",
"body": null,
"is_bot": false,
"headline": "v1.0.1 improve tool descriptions for agent discoverability",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-23T08:33:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f5787744b114f262bc3a7d0267cb016f1b9bcc5d",
"body": null,
"is_bot": false,
"headline": "publish to official MCP registry v1.0.1",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-23T06:27:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa9137f4f2cfb1ed9c7a2711881b759303f39abb",
"body": null,
"is_bot": false,
"headline": "fix package.json: keywords, bugs, engines, author",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-23T05:35:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "810ce1be583df97d260b1ecb28fe7d5795e43db5",
"body": null,
"is_bot": false,
"headline": "v1.0.0 add Stripe payment links",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-21T10:27:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c2e27b14738594a8b11c024e670128541e54668",
"body": null,
"is_bot": false,
"headline": "v1.0.0 initial release",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-21T09:51:34Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 1,
"commits_last_year": 54,
"latest_release_at": "2026-06-24T08:17:25Z",
"latest_release_tag": "v1.0.24",
"releases_from_tags": true,
"days_since_last_push": 6,
"active_weeks_last_year": 9,
"days_since_latest_release": 31,
"mean_days_between_releases": null
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 42,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "data-compliance-mcp",
"exists": true,
"license": "MIT",
"keywords": [
"mcp",
"gdpr",
"hipaa",
"pci-dss",
"ccpa",
"data-compliance",
"pii",
"phi",
"data-safety",
"privacy",
"compliance",
"ai-agents",
"data-classification",
"regulatory-compliance"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/data-compliance-mcp",
"is_deprecated": false,
"latest_version": "1.0.32",
"repository_url": "https://github.com/OjasKord/data-compliance-mcp",
"versions_count": 28,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 2197,
"first_published_at": "2026-04-21T10:06:37.334000Z",
"latest_published_at": "2026-07-20T01:24:11.498000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 5
}
]
},
"popularity": {
"forks": 0,
"stars": 0,
"watchers": 0,
"fork_history": {
"days": [],
"complete": true,
"collected": 0,
"total_forks": 0
},
"star_history": {
"days": [],
"complete": true,
"collected": 0,
"total_stars": 0,
"collected_at": null
},
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 87407,
"source_files_sampled": 1,
"oversized_source_files": 1,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"package.json"
],
"advisories": {
"error": null,
"scope": null,
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm"
],
"dependencies": [],
"all_dependencies": {
"error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"source": null,
"packages": [],
"collected": false,
"truncated": false,
"total_count": null,
"direct_count": null,
"indirect_count": null
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 0,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 0
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "OjasKord",
"commits": 54,
"avatar_url": "https://avatars.githubusercontent.com/u/271656763?v=4"
}
],
"contributors_sampled": 1,
"top_contributor_share": 1
},
"quality_signals": {
"has_ci": false,
"has_tests": false,
"ci_workflows": [],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "ccd1b0447d466e9e9a7addeea5e1c40e98507cf3",
"ran_at": "2026-07-26T01:16:15Z",
"aggregate_score": 3.7,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-20T01:03:02Z",
"oldest_open_prs": [],
"last_merged_pr_at": null,
"ci_last_conclusion": null,
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/OjasKord/data-compliance-mcp",
"host": "github.com",
"name": "data-compliance-mcp",
"owner": "OjasKord"
},
"metrics": {
"overall": {
"key": "overall",
"band": "at_risk",
"name": "Overall health",
"note": null,
"notes": [],
"value": 39,
"inputs": {
"security": 37,
"vitality": 70,
"community": 32,
"governance": 29,
"engineering": 27
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 70,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 68,
"inputs": {
"commits_last_year": 54,
"human_commit_share": 1,
"days_since_last_push": 6,
"active_weeks_last_year": 9
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 6 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 6
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "9/52 weeks with commits",
"points": 6.2,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 9
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "54 commits in the last year",
"points": 15.6,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 54
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "good",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 72,
"inputs": {
"releases_count": 1,
"latest_release_tag": "v1.0.24",
"releases_from_tags": true,
"days_since_latest_release": 31,
"mean_days_between_releases": null
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "1 version tags (no GitHub releases)",
"points": 16.2,
"status": "partial",
"details": [
{
"code": "version_tags_no_releases",
"params": {
"count": 1
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 31 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 31
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "cadence unknown (single release)",
"points": 12.6,
"status": "partial",
"details": [
{
"code": "release_cadence_unknown",
"params": {}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "repository_too_young",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 32,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 0,
"stars": 0,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "0 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 0
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "0 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 0
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 56,
"inputs": {
"packages": [
"data-compliance-mcp"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 2197
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "2,197 downloads/month across npm",
"points": 44.6,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 2197,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "critical",
"name": "Sustainability & Governance",
"value": 29,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 10,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 1,
"top_contributor_share": 1
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 100% of commits",
"points": 0,
"status": "missed",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 100
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "1 contributors",
"points": 1.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 1
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution, PR acceptance. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution",
"pr_acceptance"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 0
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "no decided pull requests or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_decided_prs_or_data",
"params": {}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "critical",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 23,
"inputs": {
"followers": 0,
"owner_type": "User",
"is_verified": null,
"owner_login": "OjasKord",
"public_repos": 11,
"account_age_days": 120
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "0 followers of OjasKord",
"points": 0,
"status": "missed",
"details": [
{
"code": "owner_followers",
"params": {
"count": 0,
"login": "OjasKord"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "11 public repos, account ~0 yr old",
"points": 8.5,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 11
}
},
{
"code": "account_age_years",
"params": {
"years": 0
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"data-compliance-mcp"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 5
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 5 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 5
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "28 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 28
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "critical",
"name": "Engineering Quality",
"value": 27,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "critical",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_ci": false,
"has_tests": false,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 65,
"inputs": {
"topics": [
"compliance",
"data-classification",
"data-privacy",
"data-safety",
"gdpr",
"hipaa",
"mcp-agent",
"pci-dss",
"pii",
"pii-detection",
"privacy",
"sensitive-data-validator"
],
"has_wiki": false,
"homepage": "https://kordagencies.com",
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://kordagencies.com",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "12 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 12
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 37,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 37,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 12,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 6,
"scorecard_aggregate": 3.7
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 18,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 21,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.389,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "21 of 54 human commits state their intent (structured subject or explanatory body)",
"points": 20.7,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 21,
"sampled": 54
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "critical",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 22,
"inputs": {
"has_nix": false,
"has_tests": false,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0.13,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "7 of the last 54 commits agent-authored or agent-credited",
"points": 10,
"status": "met",
"details": [
{
"code": "agent_authored_commits",
"params": {
"count": 7,
"sampled": 54
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "critical",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"primary_language": "JavaScript",
"largest_source_bytes": 87407,
"source_files_sampled": 1,
"oversized_source_files": 1
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "JavaScript without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "JavaScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "1/1 source files over 60KB",
"points": 0,
"status": "missed",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 1,
"oversized": 1
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
],
"report_type": "repository",
"generated_at": "2026-07-26T01:16:18.779674Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/o/OjasKord/data-compliance-mcp.svg",
"full_name": "OjasKord/data-compliance-mcp",
"license_state": "standard",
"license_spdx": "MIT"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.27.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm.