Registro públicoEn riesgo
Informe de salud del softwareesquema 0.27.0 · métricas 1.13.0 · 2026-07-26 01:16 UTC
OjasKord / data-compliance-mcp
Classify data safety before your agent stores or shares it. GDPR, HIPAA, PCI-DSS, CCPA. AI-powered
OjasKord/data-compliance-mcp tiene un índice de salud de 39 sobre 100, lo que lo sitúa en la banda En riesgo. Su puntuación más alta es Vitality (70/100) y la más baja, AI Readiness (18/100). Se actualizó por última vez hace 6 días. Una sola persona concentra la mayor parte del trabajo reciente.
39
global / 100Índice de salud del software
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
39
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
Perfil de puntuación
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Titularidad
OjasKordCuenta personal
0 seguidores11 repositorios públicosdesde mar 2026
Este repositorio pertenece a una cuenta personal. Un proyecto con un único propietario conlleva más riesgo de continuidad que uno respaldado por una organización.
Ecosistemas de paquetes
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| npm | data-compliance-mcp | 1.0.32 | 2197 | 28 | hace 5 días | mcpgdprhipaapci-dssccpadata-compliancepiiphidata-safetyprivacycomplianceai-agentsdata-classificationregulatory-compliance |
Métricas por categoría
Vitalidad
¿Está vivo el proyecto: se escribe código y se publican versiones?
70
Actividad de desarrollo
68Moderado
Cómo se puntúa
| 36/36 | Recencia de push — último push hace 6 días |
| 6.2/36 | Cadencia de commits — 9/52 semanas con commits |
| 15.6/18 | Volumen de commits — 54 commits en el último año |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Datos de entrada utilizados
| commits_last_year | 54 |
| human_commit_share | 1 |
| days_since_last_push | 6 |
| active_weeks_last_year | 9 |
Disciplina de publicación
72Bueno
Cómo se puntúa
| 16.2/27 | Publica versiones — 1 etiquetas de versión (sin releases de GitHub) |
| 36/36 | Recencia de las versiones — última versión hace 31 días |
| 12.6/27 | Cadencia de publicación — cadencia desconocida (una sola versión) |
| 0/10 | OpenSSF Scorecard: Signed-Releases — sin datos |
Datos de entrada utilizados
| releases_count | 1 |
| latest_release_tag | v1.0.24 |
| releases_from_tags | sí |
| days_since_latest_release | 31 |
| mean_days_between_releases | — |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.
Comunidad y Adopción
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
32
Popularidad y adopción
1Crítico
Cómo se puntúa
| 0/60 | Estrellas — 0 estrellas |
| 0/25 | Forks — 0 forks |
| 0/15 | Observadores — 0 observadores |
Datos de entrada utilizados
| forks | 0 |
| stars | 0 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Salud de la comunidad
50Moderado
Cómo se puntúa
| 22.5/22.5 | README |
| 22.5/22.5 | Licencia — licencia reconocida (MIT) |
| 0/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 0/6.3 | Plantilla de PR |
Datos de entrada utilizados
| has_readme | sí |
| has_license | sí |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
Adopción en el ecosistema (descargas)
56Moderado
Cómo se puntúa
| 44.6/80 | Descargas mensuales — 2197 descargas/mes en npm |
| 0/20 | Dependientes en el registro — no lo informa este ecosistema |
Datos de entrada utilizados
| packages | data-compliance-mcp |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 2197 |
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.
Sostenibilidad y Gobernanza
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
29
Cómo se puntúa
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 0/22.5 | Distribución de commits — el principal contribuyente firma el 100% de los commits |
| 1.4/13.5 | Amplitud de contribuyentes — 1 contribuyentes |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
Datos de entrada utilizados
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
Cómo se puntúa
| 0/46.8 | Resolución de issues — sin issues o sin datos |
| 0/38.3 | Aceptación de PR — sin PR decididos o sin datos |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Datos de entrada utilizados
| merged_prs | 0 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 0 |
Excluidos de la puntuación (sin datos o no aplicable): Resolución de issues, Aceptación de PR. Los pesos restantes se han renormalizado.
Propiedad y custodia
23Crítico
Cómo se puntúa
| 10/30 | Respaldo de la propiedad — cuenta personal (usuario) |
| 0/20 | Dominio verificado — no aplicable a cuentas de usuario |
| 0/25 | Alcance del propietario — 0 seguidores de OjasKord |
| 8.5/25 | Trayectoria — 11 repos públicos, cuenta de ~0 años |
Datos de entrada utilizados
| followers | 0 |
| owner_type | User |
| is_verified | — |
| owner_login | OjasKord |
| public_repos | 11 |
| account_age_days | 120 |
Excluidos de la puntuación (sin datos o no aplicable): Dominio verificado. Los pesos restantes se han renormalizado.
Mantenimiento de paquetes
100Excelente
Cómo se puntúa
| 25/25 | Publicado y resoluble — 1 paquete(s) en npm |
| 35/35 | Recencia de publicación — última publicación hace 5 días |
| 20/20 | Historial de versiones — 28 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
Datos de entrada utilizados
| packages | data-compliance-mcp |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 5 |
Calidad de Ingeniería
¿Existen unas prácticas mínimas de ingeniería y documentación?
27
Prácticas de ingeniería
1Crítico
Cómo se puntúa
| 0/24 | Flujos de trabajo de CI |
| 0/24 | Pruebas presentes |
| 0/16 | Configuración de linter |
| 0/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — sin datos |
Datos de entrada utilizados
| has_ci | no |
| has_tests | no |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: CI-Tests. Los pesos restantes se han renormalizado.
Documentación
65Moderado
Cómo se puntúa
| 30/30 | README |
| 0/25 | Directorio de documentación |
| 15/15 | Sitio de documentación / página del proyecto — https://kordagencies.com |
| 10/10 | Descripción del repositorio |
| 10/10 | Topics — 12 topics |
| 0/10 | Wiki |
Datos de entrada utilizados
| topics | compliance, data-classification, data-privacy, data-safety, gdpr, hipaa, mcp-agent, pci-dss, pii, pii-detection, privacy, sensitive-data-validator |
| has_wiki | no |
| homepage | https://kordagencies.com |
| has_readme | sí |
| has_docs_dir | no |
| has_description | sí |
Seguridad
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
37
Postura de seguridad
37En riesgo
Cómo se puntúa
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — sin datos |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 0/10 | Dangerous-Workflow — sin datos |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Licencia — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — sin datos |
| 0/5 | Pinned-Dependencies — sin datos |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — sin datos |
| 0/7.5 | Token-Permissions — sin datos |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Datos de entrada utilizados
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 3,7 |
Excluidos de la puntuación (sin datos o no aplicable): ci_tests, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Los pesos restantes se han renormalizado.
Preparación para IA
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
18
Contexto y guía para agentes
21Crítico
Cómo se puntúa
| 0/45 | Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 20.7/40 | Historial de commits legible — 21 de 54 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo) |
Datos de entrada utilizados
| has_llms_txt | no |
| legible_history_share | 0,389 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Cómo se puntúa
| 0/18 | Arranque con un solo comando |
| 0/22 | Pruebas automatizadas |
| 0/11 | Configuración de lint / formato |
| 0/11 | Verificación estática de tipos |
| 10/10 | Entorno reproducible — lockfile |
| 10/10 | Práctica demostrada con agentes — 7 de los últimos 54 commits con autoría o crédito de agente |
| 0/8 | Mantenimiento automatizado — no se observan actualizaciones automáticas de dependencias |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — sin datos |
Datos de entrada utilizados
| has_nix | no |
| has_tests | no |
| lockfiles | package-lock.json |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0,13 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Pinned-Dependencies. Los pesos restantes se han renormalizado.
Cómo se puntúa
| 0/45 | Código verificable por tipos — JavaScript sin configuración de verificación de tipos |
| 0/55 | Tamaños de archivo manejables — 1/1 archivos fuente de más de 60 KB |
Datos de entrada utilizados
| primary_language | JavaScript |
| largest_source_bytes | 87.407 |
| source_files_sampled | 1 |
| oversized_source_files | 1 |
Datos clave
0estrellas de GitHub
1contribuidores
54commits en los últimos 12 meses
6días desde el último push
1versiones publicadas
1factor bus
0issues abiertas
npmecosistemas de paquetes
Advertencias de recopilación de datos
- GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Más detalle
OpenSSF Scorecard 3.7 / 10
3.7agregado
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/d | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| n/d | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| n/d | Packaging | packaging workflow not detected |
| n/d | Pinned-Dependencies | no dependencies found |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/d | Signed-Releases | no releases found |
| n/d | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Todas las dependencias no recopilado
No fue posible recopilar el conjunto de dependencias resuelto para este informe: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Informe JSON sin procesar legible por máquina
{
"data": {
"repo": {
"topics": [
"compliance",
"data-classification",
"data-privacy",
"data-safety",
"gdpr",
"hipaa",
"mcp-agent",
"pci-dss",
"pii",
"pii-detection",
"privacy",
"sensitive-data-validator"
],
"is_fork": false,
"size_kb": 147,
"has_wiki": false,
"homepage": "https://kordagencies.com",
"languages": {
"JavaScript": 87407
},
"pushed_at": "2026-07-20T01:03:00Z",
"created_at": "2026-04-21T09:53:12Z",
"owner_type": "User",
"updated_at": "2026-07-20T01:03:04Z",
"description": "Classify data safety before your agent stores or shares it. GDPR, HIPAA, PCI-DSS, CCPA. AI-powered",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "JavaScript",
"significant_languages": [
"JavaScript"
]
},
"owner": {
"blog": null,
"name": null,
"type": "User",
"login": "OjasKord",
"company": null,
"location": null,
"followers": 0,
"avatar_url": "https://avatars.githubusercontent.com/u/271656763?v=4",
"created_at": "2026-03-28T00:28:05Z",
"is_verified": null,
"public_repos": 11,
"account_age_days": 120
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v1.0.24",
"kind": "patch",
"published_at": "2026-06-24T08:17:25Z"
}
],
"recent_commits": [
{
"oid": "ccd1b0447d466e9e9a7addeea5e1c40e98507cf3",
"body": null,
"is_bot": false,
"headline": "v1.0.32 fix redisSet Upstash env var bypass",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-07-20T01:02:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "188c4c46114775b41f16a8944d35669dbc72d134",
"body": null,
"is_bot": false,
"headline": "1.0.31",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-07-03T02:03:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5d2b2821562cc3726d1b2dfecca662af1aeef229",
"body": "…ety_lite consequence sentences",
"is_bot": false,
"headline": "v1.0.31 fix description gaps: get_safety_report and validate_data_saf…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-07-03T01:38:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0f788143eac9a8b7dee4870944bfa80a167bd06e",
"body": null,
"is_bot": false,
"headline": "1.0.30",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-29T03:53:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b8f3ba6fc891f6d5fd841932b136715df28b81f",
"body": null,
"is_bot": false,
"headline": "feat: add /.well-known/glama.json ownership endpoint v1.0.29",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-29T03:40:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "adbdd7019dbe802c1ba4eaac93691a5f6a6d5e0c",
"body": null,
"is_bot": false,
"headline": "fix: glama.json — add schema, remote.url, categories for Glama indexing",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-29T02:55:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0af50650eb29ba549f033b9e11ed0911f6ac8dd",
"body": null,
"is_bot": false,
"headline": "1.0.28",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T08:00:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ab21a21a72471ec41dc1bd9eb4f117e8c71e9494",
"body": "…ructured field (v1.0.28)\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "fix: gate email dedup, HALT_WORKFLOW agent_action, trial_extension st…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T07:52:54Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "947e716969a5c5430da6f79518f8aa3904acbf00",
"body": null,
"is_bot": false,
"headline": "1.0.27",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T07:41:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db2a5507484d2ad8bb1136df802cabe6a6df6073",
"body": "Co-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "1.0.27 feat: owner key bypass for fleet owner (OWNER_KEY env var)",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-28T01:26:18Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "01f9bbfd2df0e96ba47d3c9848610c93fa31a08a",
"body": null,
"is_bot": false,
"headline": "1.0.26",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-26T08:28:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "06927dac5a6aef95d0d5d7c7c3bfe14231cf7ce8",
"body": "…r permanent audit trail",
"is_bot": false,
"headline": "v1.0.26 fix: persist trial extensions to Redis (dcc:trial:{email}) fo…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-26T08:26:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "62a662ca02fdc31e8c80567a3819dc1ebdc32a43",
"body": "Task 1 (purpose verb + required fields) confirmed already done on all 3 tools\nfrom a prior ATO optimisation pass -- no changes needed. Tasks 2-4 implemented\nfollowing the bizfile-mcp v4.10.47 reference pattern.",
"is_bot": false,
"headline": "v1.0.25 — calls_remaining, verdict_ttl, data_source_status fields",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-25T04:18:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a5d8856d8e694b517cb6408426e7047ccf41596",
"body": null,
"is_bot": false,
"headline": "chore: sync server.json version to match published npm version",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-24T08:27:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f0dc1317f2ceb6e77fee2a94a444c38fb9d4fa38",
"body": null,
"is_bot": false,
"headline": "1.0.24",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-24T08:17:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0c97a9446d20ea1a003d38ca85378d3e01056cd3",
"body": "…n followups, outputSchema, accuracy fixes\n\nAdds unauthenticated /public-stats (lifetime calls, uptime %, first_deployed,\nversion) for agent orchestrators. Gate responses are now self-contained\n(server + workflow impact + upgrade path in one sentence) and detect\ncross-server operators via shared fleet Redis. Added outputSchema to all 3\ntools (additive). smithery.yaml claimed \"2 focused tools\" -- corrected to 3.\nglama.json and README were missing validate_data_safety_lite from their\ntool lists.",
"is_bot": false,
"headline": "v1.0.24 -- public-stats, fleet-wide gate improvements, trial-extensio…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-24T06:42:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9d7fb5c2e4e5d2fbab3b8b650d481d04f49f7ec6",
"body": "Bump to v1.0.23. Add agentRole to smithery.yaml.",
"is_bot": false,
"headline": "fix: gate returns HTTP 402 (x402 standard for non-transient quota)",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-23T08:01:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1ddf2d14066717fe5fae23bcb1940cb6863cc772",
"body": null,
"is_bot": false,
"headline": "feat: email notification on free tier gate hit",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-20T15:09:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a9e62c7a1474f941feb33759f4a8338242fe99d2",
"body": "Add charge.refunded webhook handler: looks up the checkout session by\npayment_intent via the Stripe REST API, matches the customer email\nagainst issued API keys, and deletes the key from Redis, the in-memory\nmap, and the on-disk snapshot.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "feat: revoke API key on Stripe refund",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-18T03:14:54Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "e27a8cd7e68594553db187144d61b3c64fd755d1",
"body": "… provisioning",
"is_bot": false,
"headline": "fix: Stripe webhook validates payment_link ID to prevent cross-server…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-17T08:53:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9f526f74bf1add9dbd811685eac397dcfadff2cd",
"body": null,
"is_bot": false,
"headline": "fix: sync server.json version to 1.0.19",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-17T07:18:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "657637a621d65d655d90a506c866cd315840c4fb",
"body": "…, ToolRank badge\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "feat: ATO optimisation — purpose verb, usage context, required fields…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-16T01:52:25Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "27e18c7a0f2907c7d65071da3fae4acdc049d63e",
"body": "…FE verdict responses",
"is_bot": false,
"headline": "v1.0.18 feat: add hold_reason, retry_after, escalation_path to non-SA…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-15T10:06:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "16196c58f03795ee6a8213b4a4490cc41fee5515",
"body": "…iscovery",
"is_bot": false,
"headline": "v1.0.17 feat: reposition tool descriptions for agentic payment rail d…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-15T09:48:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4a2388716ebf280fbb1c799f6be3ed1f4e6fc20f",
"body": null,
"is_bot": false,
"headline": "v1.0.16 feat: server-card.json static metadata",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T07:27:44Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4d83b91e48288c15bf4123f8bfdfff0460b0dd08",
"body": null,
"is_bot": false,
"headline": "fix: bump to v1.0.15 past existing npm publish",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T06:54:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ad3d52d9aa529288a592dbc04c46a1b29ee11f04",
"body": null,
"is_bot": false,
"headline": "feat: add Smithery icon",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T06:44:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a93dcd95af46cebe8bb631687bf98b9d5e29b98",
"body": null,
"is_bot": false,
"headline": "v1.0.14 feat: kill switch + per-minute rate limiting",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-11T03:12:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f19e62559f51d7c767f25b7f984f15c1e99667cf",
"body": null,
"is_bot": false,
"headline": "v1.0.13 fix: BEFORE trigger language + consequence-first limit error",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-08T01:30:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ede879e43850280da9f61877e53d3b0d28aac961",
"body": null,
"is_bot": false,
"headline": "v1.0.12 feat: Smithery score optimisation",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-05T02:33:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c1d4db1600b68730a1864a3aa51a9ba58ed9af0",
"body": null,
"is_bot": false,
"headline": "v1.0.11 feat: daily-report endpoint",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-04T04:35:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5e4907f776b8610105887e8e9c734cdeaf28c655",
"body": "…criptions\n\n- Upstash Redis helpers (redisGet/Set/Expire/Keys) verbatim from bizfile pattern\n- Free tier persistence: loadFreeTierFromRedis/saveFreeTierToRedis with Math.max merge\n- API key persistence: saveKeyToRedis/loadApiKeysFromRedis with prefix dcc\n- appendSessionLog with 24h TTL; /session-log\n[…]\nlisten: async + await loadApiKeysFromRedis + loadFreeTierFromRedis\n- Three tool descriptions rewritten for orchestral agent runtime selection\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "v1.0.10 feat: Redis persistence, session logging, agent-optimised des…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-04T00:56:21Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "03b910572899d1f335d8bee9601cbda1c0086313",
"body": null,
"is_bot": false,
"headline": "fix: sync VERSION constant to match package.json",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-02T06:33:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "acc29b2362327b383d584d25c9fa953904c54d29",
"body": null,
"is_bot": false,
"headline": "v1.0.9 fix: IP extraction Cloudflare fix",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-06-02T02:40:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4113db77ea238b9789e92154157a8655fc28bc71",
"body": null,
"is_bot": false,
"headline": "add Harness Integration section to README",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-05T02:56:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0fdda7b7b4291c33114bd698d8316343791eef19",
"body": null,
"is_bot": false,
"headline": "bump to v1.0.7",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-03T09:35:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0e94773b2c08db9e7b9958271daf0967fef74ed",
"body": "… and monthly free tier reset",
"is_bot": false,
"headline": "v1.0.7 update descriptions, add REPORT mode, fix paid key persistence…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-03T09:35:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ef719752fcea27c4345ff9498c59359a60120380",
"body": null,
"is_bot": false,
"headline": "fix: update README pricing to prepaid bundles",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-02T12:16:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4d1fd2b8885a8d35d0baa1546198e355cadd5b51",
"body": null,
"is_bot": false,
"headline": "chore: bump package.json version to 1.0.6",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-02T11:35:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc644426a87e180a4bccf0cadc269e1ca48cc322",
"body": "Co-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "chore: budget ledger + idempotency + error improvements",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-05-02T00:08:02Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "24d8f5524008d0954982a51cc90e6678ef3f5cc4",
"body": null,
"is_bot": false,
"headline": "add Smithery badge to README",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-29T23:14:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "372d3af25462f7754096da65abff16ac5f4827e5",
"body": null,
"is_bot": false,
"headline": "v1.0.5 -- bump server.json version",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-28T02:26:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5508d517bffaf2197d0e11e5664cf19a5f2b654f",
"body": "STRIPE_PRO_URL updated to new prepaid bundle link, ENTERPRISE_UPGRADE_URL added.\nFree tier limit errors now direct agents to prepaid bundle links\n(500 calls for $24, calls never expire).\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "v1.0.5 -- update payment links to prepaid bundle URLs",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-28T02:24:16Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "54e980a7600b7adbd5adac7afa47611a9871b758",
"body": null,
"is_bot": false,
"headline": "add MIT license",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-28T00:20:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "55edca336a17186d63efec02367da72674388678",
"body": "…alidate_data_safety_lite",
"is_bot": false,
"headline": "v1.0.4 budget-aware: token_count, /ready endpoint, enhanced errors, v…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T16:38:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f7bb4f3ec138d13b583c41c2d073d74120d6db0d",
"body": null,
"is_bot": false,
"headline": "v1.0.3 Smithery metadata fix -- description, systemPrompt added",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T06:34:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "82af17671517d0e6a1e9ec7844aa5dcf23d9a274",
"body": null,
"is_bot": false,
"headline": "v1.0.3 -- TCO description rewrite, ICO fine consequence, bundle pricing",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T01:09:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "735c2a66a24849451c01cab3acf2a6b2d9c6006f",
"body": null,
"is_bot": false,
"headline": "chore: add v1.0.2 changelog entry",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-26T00:14:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "28ea38c4918f90ceb60b9747c2a7bff759eb3654",
"body": "…ths, source_url, match_verdict",
"is_bot": false,
"headline": "v1.0.2: VERSION constant, stdio handler, agent_action in all error pa…",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-25T23:15:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3df561f07dee1455819cd4e40f6eba69b6e34622",
"body": null,
"is_bot": false,
"headline": "v1.0.1 improve tool descriptions for agent discoverability",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-23T08:33:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f5787744b114f262bc3a7d0267cb016f1b9bcc5d",
"body": null,
"is_bot": false,
"headline": "publish to official MCP registry v1.0.1",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-23T06:27:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa9137f4f2cfb1ed9c7a2711881b759303f39abb",
"body": null,
"is_bot": false,
"headline": "fix package.json: keywords, bugs, engines, author",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-23T05:35:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "810ce1be583df97d260b1ecb28fe7d5795e43db5",
"body": null,
"is_bot": false,
"headline": "v1.0.0 add Stripe payment links",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-21T10:27:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c2e27b14738594a8b11c024e670128541e54668",
"body": null,
"is_bot": false,
"headline": "v1.0.0 initial release",
"author_name": "Ojas",
"author_login": "OjasKord",
"committed_at": "2026-04-21T09:51:34Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 1,
"commits_last_year": 54,
"latest_release_at": "2026-06-24T08:17:25Z",
"latest_release_tag": "v1.0.24",
"releases_from_tags": true,
"days_since_last_push": 6,
"active_weeks_last_year": 9,
"days_since_latest_release": 31,
"mean_days_between_releases": null
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 42,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "data-compliance-mcp",
"exists": true,
"license": "MIT",
"keywords": [
"mcp",
"gdpr",
"hipaa",
"pci-dss",
"ccpa",
"data-compliance",
"pii",
"phi",
"data-safety",
"privacy",
"compliance",
"ai-agents",
"data-classification",
"regulatory-compliance"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/data-compliance-mcp",
"is_deprecated": false,
"latest_version": "1.0.32",
"repository_url": "https://github.com/OjasKord/data-compliance-mcp",
"versions_count": 28,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 2197,
"first_published_at": "2026-04-21T10:06:37.334000Z",
"latest_published_at": "2026-07-20T01:24:11.498000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 5
}
]
},
"popularity": {
"forks": 0,
"stars": 0,
"watchers": 0,
"fork_history": {
"days": [],
"complete": true,
"collected": 0,
"total_forks": 0
},
"star_history": {
"days": [],
"complete": true,
"collected": 0,
"total_stars": 0,
"collected_at": null
},
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 87407,
"source_files_sampled": 1,
"oversized_source_files": 1,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"package.json"
],
"advisories": {
"error": null,
"scope": null,
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm"
],
"dependencies": [],
"all_dependencies": {
"error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"source": null,
"packages": [],
"collected": false,
"truncated": false,
"total_count": null,
"direct_count": null,
"indirect_count": null
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 0,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 0
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "OjasKord",
"commits": 54,
"avatar_url": "https://avatars.githubusercontent.com/u/271656763?v=4"
}
],
"contributors_sampled": 1,
"top_contributor_share": 1
},
"quality_signals": {
"has_ci": false,
"has_tests": false,
"ci_workflows": [],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "ccd1b0447d466e9e9a7addeea5e1c40e98507cf3",
"ran_at": "2026-07-26T01:16:15Z",
"aggregate_score": 3.7,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-20T01:03:02Z",
"oldest_open_prs": [],
"last_merged_pr_at": null,
"ci_last_conclusion": null,
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/OjasKord/data-compliance-mcp",
"host": "github.com",
"name": "data-compliance-mcp",
"owner": "OjasKord"
},
"metrics": {
"overall": {
"key": "overall",
"band": "at_risk",
"name": "Overall health",
"note": null,
"notes": [],
"value": 39,
"inputs": {
"security": 37,
"vitality": 70,
"community": 32,
"governance": 29,
"engineering": 27
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 70,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 68,
"inputs": {
"commits_last_year": 54,
"human_commit_share": 1,
"days_since_last_push": 6,
"active_weeks_last_year": 9
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 6 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 6
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "9/52 weeks with commits",
"points": 6.2,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 9
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "54 commits in the last year",
"points": 15.6,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 54
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "good",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 72,
"inputs": {
"releases_count": 1,
"latest_release_tag": "v1.0.24",
"releases_from_tags": true,
"days_since_latest_release": 31,
"mean_days_between_releases": null
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "1 version tags (no GitHub releases)",
"points": 16.2,
"status": "partial",
"details": [
{
"code": "version_tags_no_releases",
"params": {
"count": 1
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 31 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 31
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "cadence unknown (single release)",
"points": 12.6,
"status": "partial",
"details": [
{
"code": "release_cadence_unknown",
"params": {}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "repository_too_young",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 32,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 0,
"stars": 0,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "0 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 0
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "0 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 0
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 56,
"inputs": {
"packages": [
"data-compliance-mcp"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 2197
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "2,197 downloads/month across npm",
"points": 44.6,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 2197,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "critical",
"name": "Sustainability & Governance",
"value": 29,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 10,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 1,
"top_contributor_share": 1
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 100% of commits",
"points": 0,
"status": "missed",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 100
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "1 contributors",
"points": 1.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 1
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution, PR acceptance. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution",
"pr_acceptance"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 0
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "no decided pull requests or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_decided_prs_or_data",
"params": {}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "critical",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 23,
"inputs": {
"followers": 0,
"owner_type": "User",
"is_verified": null,
"owner_login": "OjasKord",
"public_repos": 11,
"account_age_days": 120
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "0 followers of OjasKord",
"points": 0,
"status": "missed",
"details": [
{
"code": "owner_followers",
"params": {
"count": 0,
"login": "OjasKord"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "11 public repos, account ~0 yr old",
"points": 8.5,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 11
}
},
{
"code": "account_age_years",
"params": {
"years": 0
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"data-compliance-mcp"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 5
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 5 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 5
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "28 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 28
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "critical",
"name": "Engineering Quality",
"value": 27,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "critical",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_ci": false,
"has_tests": false,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 65,
"inputs": {
"topics": [
"compliance",
"data-classification",
"data-privacy",
"data-safety",
"gdpr",
"hipaa",
"mcp-agent",
"pci-dss",
"pii",
"pii-detection",
"privacy",
"sensitive-data-validator"
],
"has_wiki": false,
"homepage": "https://kordagencies.com",
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://kordagencies.com",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "12 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 12
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 37,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 37,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 12,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 6,
"scorecard_aggregate": 3.7
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 18,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 21,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.389,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "21 of 54 human commits state their intent (structured subject or explanatory body)",
"points": 20.7,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 21,
"sampled": 54
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "critical",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 22,
"inputs": {
"has_nix": false,
"has_tests": false,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0.13,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "7 of the last 54 commits agent-authored or agent-credited",
"points": 10,
"status": "met",
"details": [
{
"code": "agent_authored_commits",
"params": {
"count": 7,
"sampled": 54
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "critical",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"primary_language": "JavaScript",
"largest_source_bytes": 87407,
"source_files_sampled": 1,
"oversized_source_files": 1
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "JavaScript without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "JavaScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "1/1 source files over 60KB",
"points": 0,
"status": "missed",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 1,
"oversized": 1
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
],
"report_type": "repository",
"generated_at": "2026-07-26T01:16:18.779674Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/o/OjasKord/data-compliance-mcp.svg",
"full_name": "OjasKord/data-compliance-mcp",
"license_state": "standard",
"license_spdx": "MIT"
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.27.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — npm.