Pi coding agent extension packages — tools, skills, and integrations.
bacnh85/pi-extensions erreicht einen Gesundheitsindex von 57 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei AI Readiness (72/100) ab, am schwächsten bei Community & Adoption (33/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
Metriken werden auf einer standardisierten Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr gewichtetes Mittel, kalibriert auf die Verteilung des öffentlichen Registers, sodass die Stufen Perzentilbedeutung tragen; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze Gefährdet von 34.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Der gewichtete Gesamtwert 55 wird auf der veröffentlichten Indexskala auf 57 kalibriert (Register-Kalibrierung 2026-08-02).
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | @bacnh85/pi-ux | 0.4.5 | 774 | 5 | vor 0 Tagen | pi-packagepiuxuidesignanti-slopskills |
| npm | @bacnh85/pi-a2a | 0.7.1 | 1.158 | 9 | vor 0 Tagen | pi-packagepi-extensiona2aagent-to-agentagent-interopmulti-agenttask-distribution |
| npm | @bacnh85/pi-agy | 0.3.2 | 950 | 7 | vor 10 Tagen | pi-packagepi-extensionpi-skillagyantigravitygeminigoogle-aicli |
| npm | @bacnh85/pi-fff | 0.7.10 | 620 | 12 | vor 0 Tagen | pi-packagepi-extensionfffsearchgrepfuzzy-searchai-agent |
| npm | @bacnh85/pi-hub | 0.1.3 | 489 | 4 | vor 1 Tag | pi-packagepicoding-agentcliinstallerextensionspackage-manager |
| npm | @bacnh85/pi-rtk | 0.1.13 | 628 | 14 | vor 0 Tagen | pi-packagepi-extensionrtktoken-optimization |
| npm | @bacnh85/pi-sub | 0.1.33 | 2.449 | 33 | vor 0 Tagen | pi-packagepi-extensionsubscriptionusagecodexopenai |
| npm | @bacnh85/pi-web | 0.6.0 | 929 | 20 | vor 22 Tagen | pi-packagepi-extensionweb-searchbrave-searchfirecrawlcrawl4aiscrapingcrawling |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 6.2/36 | Commit-Rhythmus — 9/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 274 Commits im letzten Jahr |
| 0/10 | OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully |
| commits_last_year | 274 |
| human_commit_share | 1 |
| days_since_last_push | 0 |
| active_weeks_last_year | 9 |
| 16.2/27 | Liefert Releases aus — 1 Versions-Tags (keine GitHub-Releases) |
| 36/36 | Release-Aktualität — letztes Release vor 57 Tagen |
| 12.6/27 | Release-Rhythmus — Rhythmus unbekannt (nur ein Release) |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
| releases_count | 1 |
| latest_release_tag | v0.1.0 |
| releases_from_tags | ja |
| days_since_latest_release | 57 |
| mean_days_between_releases | — |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 14.6/60 | Stars — 9 Stars |
| 6.5/25 | Forks — 7 Forks |
| 0/15 | Watcher — 1 Watcher |
| forks | 7 |
| stars | 9 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 0/22.5 | Lizenz — keine Lizenzdatei erkannt |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
| has_readme | ja |
| has_license | nein |
| readme_badges | 0 |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| readme_badge_services | — |
| has_pull_request_template | nein |
| 52/80 | Downloads pro Monat — 7.997 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
| packages | @bacnh85/pi-ux, @bacnh85/pi-a2a, @bacnh85/pi-agy, @bacnh85/pi-fff, @bacnh85/pi-hub, @bacnh85/pi-rtk, @bacnh85/pi-sub, @bacnh85/pi-web |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 7.997 |
| unverified_packages_excluded | — |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 0.2/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 99 % der Commits |
| 4.1/13.5 | Breite der Beitragenden — 3 Beitragende |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0,989 |
| 42/42 | Issue-Lösungsquote — 100 % der Issues geschlossen |
| 26.7/30 | PR-Annahme — 8/9 entschiedene PRs gemergt |
| 11.6/13 | Newcomer PR acceptance — 8/9 PRs von Erstbeitragenden in 30 Tagen gemergt |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 8 |
| open_issues | 0 |
| closed_issues | 16 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 8 |
| prs_decided_30d | 9 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 1 |
| first_time_authors_30d | 3 |
| first_time_prs_merged_30d | 8 |
| first_time_prs_decided_30d | 9 |
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 14.6/25 | Reichweite des Inhabers — 105 Follower von bacnh85 |
| 25/25 | Kontohistorie — 63 öffentliche Repos, Kontoalter ca. 13 Jahre |
| followers | 105 |
| owner_type | User |
| is_verified | — |
| owner_login | bacnh85 |
| public_repos | 63 |
| account_age_days | 4.914 |
| 25/25 | Veröffentlicht & auflösbar — 8 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 0 Tagen |
| 20/20 | Versionshistorie — 33 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | @bacnh85/pi-ux, @bacnh85/pi-a2a, @bacnh85/pi-agy, @bacnh85/pi-fff, @bacnh85/pi-hub, @bacnh85/pi-rtk, @bacnh85/pi-sub, @bacnh85/pi-web |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 0 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 24/24 | CI-Workflows — 1 Workflow(s) |
| 24/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — keine Daten |
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | ja |
| has_linter_config | nein |
| has_precommit_config | nein |
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 0/15 | Dokumentations-/Homepage-Site |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 8 Topics |
| 0/10 | Wiki |
| topics | ai-agents, code-review-assistant-active, coding-agent, long-term-memory, obsidian, pi-coding-agent, pi-extension, typescript |
| has_wiki | nein |
| homepage | — |
| docs_site | — |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — keine Daten |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 0/2.5 | Lizenz — license file not detected |
| 0/7.5 | Maintained — project was created within the last 90 days. Please review its contents carefully |
| 5/5 | Packaging — packaging workflow detected |
| 5/5 | Pinned-Dependencies — all dependencies are pinned |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 3/7.5 | Vulnerabilities — 6 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 3,2 |
| 35/35 | Direkte Abhängigkeiten ohne bekannte Advisories — keine direkte Abhängigkeit trägt ein bekanntes Advisory |
| 0/25 | Indirekte Abhängigkeiten ohne bekannte Advisories — transitive Menge in diesem Bereich nicht von Entwicklungs- und Test-Abhängigkeiten trennbar |
| 0/40 | Keine offenen Advisories — kein Advisory trägt ein Veröffentlichungsdatum |
| source | osv |
| advisories | 6 |
| affected_packages | 4 |
| assessed_packages | 431 |
| unassessed_packages | 0 |
| affected_by_severity | high 3, moderate 1 |
| direct_affected_packages | 0 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Trägt ein bewusst kleines Gewicht (4 %): Agenten-Tooling ist ein echtes Pflegesignal, doch ein Repository ohne jedes Signal kann weiterhin 100/100 erreichen.
| 45/45 | Agentenanweisungen — AGENTS.md, pi-ponytail/AGENTS.md, pi-ux/AGENTS.md |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 38.9/40 | Lesbare Commit-Historie — 73 von 100 menschlichen Commits benennen ihre Absicht (strukturierter Betreff oder erläuternder Text) |
| has_llms_txt | nein |
| llms_txt_url | — |
| legible_history_share | 0,73 |
| agent_instruction_files | AGENTS.md, pi-ponytail/AGENTS.md, pi-ux/AGENTS.md |
| agent_instruction_max_bytes | 19.974 |
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 11/11 | Statische Typprüfung — pi-a2a/tsconfig.json, pi-advisor/tsconfig.json, pi-agy/tsconfig.json, pi-chatgpt-web/tsconfig.json, pi-commandcode/tsconfig.json, pi-config-panel/tsconfig.json, pi-fff/tsconfig.json, pi-kicad/tsconfig.json, pi-model-tools/tsconfig.json, pi-notebooklm/tsconfig.json, pi-obsidian/tsconfig.json, pi-plan/tsconfig.json, pi-review/tsconfig.json, pi-router/tsconfig.json, pi-subagent/tsconfig.json, pi-windows-tools/tsconfig.json |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 0/10 | Belegte Agentenpraxis — keine von Agenten verfassten Commits unter den letzten 100 |
| 0/8 | Automatisierte Wartung — keine automatisierten Abhängigkeits-Updates beobachtet |
| 10/10 | OpenSSF Scorecard: Pinned-Dependencies — all dependencies are pinned |
| has_nix | nein |
| has_tests | ja |
| lockfiles | package-lock.json |
| has_dockerfile | nein |
| typed_language | ja |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | pi-a2a/tsconfig.json, pi-advisor/tsconfig.json, pi-agy/tsconfig.json, pi-chatgpt-web/tsconfig.json, pi-commandcode/tsconfig.json, pi-config-panel/tsconfig.json, pi-fff/tsconfig.json, pi-kicad/tsconfig.json, pi-model-tools/tsconfig.json, pi-notebooklm/tsconfig.json, pi-obsidian/tsconfig.json, pi-plan/tsconfig.json, pi-review/tsconfig.json, pi-router/tsconfig.json, pi-subagent/tsconfig.json, pi-windows-tools/tsconfig.json |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 45/45 | Typprüfbarer Code — TypeScript (statisch typisiert) |
| 53.9/55 | Handhabbare Dateigrößen — 5/242 Quelldateien über 60 KB |
| primary_language | TypeScript |
| largest_source_bytes | 162.131 |
| source_files_sampled | 242 |
| oversized_source_files | 5 |
Wann jeder Stern und Fork hinzugefügt wurde, von GitHub erfasst und nach Tagen gruppiert. Das kumulierte Wachstum steht direkt über den täglichen Zugängen, aus denen es besteht, sodass beide gegeneinander lesbar sind: stetiger organischer Zuwachs sieht ganz anders aus als ein abrupter, kurzlebiger Ausschlag. Wo dieser Unterschied messbar ist, wird er als Wachstumsauthentizität ausgewiesen.
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| k. A. | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 0 | License | license file not detected |
| 0 | Maintained | project was created within the last 90 days. Please review its contents carefully |
| 10 | Packaging | packaging workflow detected |
| 10 | Pinned-Dependencies | all dependencies are pinned |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 4 | Vulnerabilities | 6 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| npm | @bacnh85/pi-config-panel | ^0.1.0 | pi-a2a/package.json |
| npm | @bacnh85/pi-config-panel | ^0.1.0 | pi-commandcode/package.json |
| npm | @kalera/munin-sdk | ^1.5.0 | pi-evolve/package.json |
| npm | @ff-labs/fff-node | ^0.9.6 | pi-fff/package.json |
| npm | @kalera/munin-sdk | ^1.5.0 | pi-munin/package.json |
| npm | dotenv | ^16.4.7 | pi-munin/package.json |
| npm | @bacnh85/pi-config-panel | ^0.1.0 | pi-router/package.json |
| npm | @bacnh85/pi-config-panel | ^0.1.0 | pi-subagent/package.json |
| npm | @mozilla/readability | ^0.6.0 | pi-web/package.json |
| npm | jsdom | ^27.0.1 | pi-web/package.json |
| npm | turndown | ^7.2.2 | pi-web/package.json |
| npm | turndown-plugin-gfm | ^1.0.2 | pi-web/package.json |
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 9 direkte und 422 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| npm | @bacnh85/pi-config-panel | 0.1.0 | direkt |
| npm | @bacnh85/pi-config-panel | 0.1.4 | direkt |
| npm | @ff-labs/fff-node | 0.9.6 | direkt |
| npm | @kalera/munin-sdk | 1.5.0 | direkt |
| npm | @mozilla/readability | 0.6.0 | direkt |
| npm | dotenv | 16.6.1 | direkt |
| npm | jsdom | 27.4.0 | direkt |
| npm | turndown | 7.2.4 | direkt |
| npm | turndown-plugin-gfm | 1.0.2 | direkt |
| npm | @acemir/cssom | 0.9.31 | indirekt |
| npm | @anthropic-ai/sdk | 0.91.1 | indirekt |
| npm | @asamuzakjp/css-color | 4.1.2 | indirekt |
| npm | @asamuzakjp/dom-selector | 6.8.1 | indirekt |
| npm | @asamuzakjp/nwsapi | 2.3.9 | indirekt |
| npm | @aws-crypto/crc32 | 5.2.0 | indirekt |
| npm | @aws-crypto/sha256-browser | 5.2.0 | indirekt |
| npm | @aws-crypto/sha256-js | 5.2.0 | indirekt |
| npm | @aws-crypto/supports-web-crypto | 5.2.0 | indirekt |
| npm | @aws-crypto/util | 5.2.0 | indirekt |
| npm | @aws-sdk/client-bedrock-runtime | 3.1048.0 | indirekt |
| npm | @aws-sdk/core | 3.974.11 | indirekt |
| npm | @aws-sdk/core | 3.977.9 | indirekt |
| npm | @aws-sdk/credential-provider-env | 3.972.37 | indirekt |
| npm | @aws-sdk/credential-provider-env | 3.972.70 | indirekt |
| npm | @aws-sdk/credential-provider-http | 3.972.39 | indirekt |
| npm | @aws-sdk/credential-provider-http | 3.972.72 | indirekt |
| npm | @aws-sdk/credential-provider-ini | 3.972.41 | indirekt |
| npm | @aws-sdk/credential-provider-ini | 3.973.15 | indirekt |
| npm | @aws-sdk/credential-provider-login | 3.972.41 | indirekt |
| npm | @aws-sdk/credential-provider-login | 3.972.77 | indirekt |
| npm | @aws-sdk/credential-provider-node | 3.972.42 | indirekt |
| npm | @aws-sdk/credential-provider-node | 3.972.81 | indirekt |
| npm | @aws-sdk/credential-provider-process | 3.972.37 | indirekt |
| npm | @aws-sdk/credential-provider-process | 3.972.70 | indirekt |
| npm | @aws-sdk/credential-provider-sso | 3.972.41 | indirekt |
| npm | @aws-sdk/credential-provider-sso | 3.973.14 | indirekt |
| npm | @aws-sdk/credential-provider-web-identity | 3.972.41 | indirekt |
| npm | @aws-sdk/credential-provider-web-identity | 3.972.76 | indirekt |
| npm | @aws-sdk/eventstream-handler-node | 3.972.16 | indirekt |
| npm | @aws-sdk/eventstream-handler-node | 3.972.34 | indirekt |
| npm | @aws-sdk/middleware-eventstream | 3.972.12 | indirekt |
| npm | @aws-sdk/middleware-eventstream | 3.972.29 | indirekt |
| npm | @aws-sdk/middleware-websocket | 3.972.19 | indirekt |
| npm | @aws-sdk/middleware-websocket | 3.972.52 | indirekt |
| npm | @aws-sdk/nested-clients | 3.997.44 | indirekt |
| npm | @aws-sdk/nested-clients | 3.997.9 | indirekt |
| npm | @aws-sdk/signature-v4-multi-region | 3.996.27 | indirekt |
| npm | @aws-sdk/signature-v4-multi-region | 3.996.46 | indirekt |
| npm | @aws-sdk/token-providers | 3.1048.0 | indirekt |
| npm | @aws-sdk/token-providers | 3.1116.0 | indirekt |
| npm | @aws-sdk/types | 3.973.8 | indirekt |
| npm | @aws-sdk/types | 3.974.5 | indirekt |
| npm | @aws-sdk/util-locate-window | 3.965.10 | indirekt |
| npm | @aws-sdk/util-locate-window | 3.965.5 | indirekt |
| npm | @aws-sdk/xml-builder | 3.972.24 | indirekt |
| npm | @aws-sdk/xml-builder | 3.972.40 | indirekt |
| npm | @aws/lambda-invoke-store | 0.2.4 | indirekt |
| npm | @aws/lambda-invoke-store | 0.3.0 | indirekt |
| npm | @babel/runtime | 7.29.2 | indirekt |
| npm | @babel/runtime | 7.29.7 | indirekt |
| npm | @csstools/color-helpers | 6.1.1 | indirekt |
| npm | @csstools/css-calc | 3.3.0 | indirekt |
| npm | @csstools/css-color-parser | 4.2.0 | indirekt |
| npm | @csstools/css-parser-algorithms | 4.0.0 | indirekt |
| npm | @csstools/css-syntax-patches-for-csstree | 1.1.8 | indirekt |
| npm | @csstools/css-tokenizer | 4.0.0 | indirekt |
| npm | @earendil-works/pi-agent-core | 0.84.3 | indirekt |
| npm | @earendil-works/pi-ai | 0.84.3 | indirekt |
| npm | @earendil-works/pi-client | 0.84.3 | indirekt |
| npm | @earendil-works/pi-coding-agent | 0.84.3 | indirekt |
| npm | @earendil-works/pi-protocol | 0.84.3 | indirekt |
| npm | @earendil-works/pi-telemetry | 0.84.3 | indirekt |
| npm | @earendil-works/pi-tui | 0.84.2 | indirekt |
| npm | @earendil-works/pi-tui | 0.84.3 | indirekt |
| npm | @esbuild/aix-ppc64 | 0.28.1 | indirekt |
| npm | @esbuild/aix-ppc64 | 0.28.2 | indirekt |
| npm | @esbuild/android-arm | 0.28.1 | indirekt |
| npm | @esbuild/android-arm | 0.28.2 | indirekt |
| npm | @esbuild/android-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/android-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/android-x64 | 0.28.1 | indirekt |
| npm | @esbuild/android-x64 | 0.28.2 | indirekt |
| npm | @esbuild/darwin-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/darwin-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/darwin-x64 | 0.28.1 | indirekt |
| npm | @esbuild/darwin-x64 | 0.28.2 | indirekt |
| npm | @esbuild/freebsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/freebsd-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/freebsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/freebsd-x64 | 0.28.2 | indirekt |
| npm | @esbuild/linux-arm | 0.28.1 | indirekt |
| npm | @esbuild/linux-arm | 0.28.2 | indirekt |
| npm | @esbuild/linux-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/linux-ia32 | 0.28.1 | indirekt |
| npm | @esbuild/linux-ia32 | 0.28.2 | indirekt |
| npm | @esbuild/linux-loong64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-loong64 | 0.28.2 | indirekt |
| npm | @esbuild/linux-mips64el | 0.28.1 | indirekt |
| npm | @esbuild/linux-mips64el | 0.28.2 | indirekt |
| npm | @esbuild/linux-ppc64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-ppc64 | 0.28.2 | indirekt |
| npm | @esbuild/linux-riscv64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-riscv64 | 0.28.2 | indirekt |
| npm | @esbuild/linux-s390x | 0.28.1 | indirekt |
| npm | @esbuild/linux-s390x | 0.28.2 | indirekt |
| npm | @esbuild/linux-x64 | 0.28.1 | indirekt |
| npm | @esbuild/linux-x64 | 0.28.2 | indirekt |
| npm | @esbuild/netbsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/netbsd-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/netbsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/netbsd-x64 | 0.28.2 | indirekt |
| npm | @esbuild/openbsd-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/openbsd-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/openbsd-x64 | 0.28.1 | indirekt |
| npm | @esbuild/openbsd-x64 | 0.28.2 | indirekt |
| npm | @esbuild/openharmony-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/openharmony-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/sunos-x64 | 0.28.1 | indirekt |
| npm | @esbuild/sunos-x64 | 0.28.2 | indirekt |
| npm | @esbuild/win32-arm64 | 0.28.1 | indirekt |
| npm | @esbuild/win32-arm64 | 0.28.2 | indirekt |
| npm | @esbuild/win32-ia32 | 0.28.1 | indirekt |
| npm | @esbuild/win32-ia32 | 0.28.2 | indirekt |
| npm | @esbuild/win32-x64 | 0.28.1 | indirekt |
| npm | @esbuild/win32-x64 | 0.28.2 | indirekt |
| npm | @exodus/bytes | 1.15.1 | indirekt |
| npm | @ff-labs/fff-bin-darwin-arm64 | 0.9.6 | indirekt |
| npm | @ff-labs/fff-bin-darwin-x64 | 0.9.6 | indirekt |
| npm | @ff-labs/fff-bin-linux-arm64-gnu | 0.9.6 | indirekt |
| npm | @ff-labs/fff-bin-linux-arm64-musl | 0.9.6 | indirekt |
| npm | @ff-labs/fff-bin-linux-x64-gnu | 0.9.6 | indirekt |
| npm | @ff-labs/fff-bin-linux-x64-musl | 0.9.6 | indirekt |
| npm | @ff-labs/fff-bin-win32-arm64 | 0.9.6 | indirekt |
| npm | @ff-labs/fff-bin-win32-x64 | 0.9.6 | indirekt |
| npm | @google/genai | 1.52.0 | indirekt |
| npm | @isaacs/cliui | 8.0.2 | indirekt |
| npm | @leichtgewicht/ip-codec | 2.0.5 | indirekt |
| npm | @mariozechner/clipboard | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-darwin-arm64 | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-darwin-universal | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-darwin-x64 | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-linux-arm64-gnu | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-linux-arm64-musl | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-linux-riscv64-gnu | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-linux-x64-gnu | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-linux-x64-musl | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-win32-arm64-msvc | 0.3.9 | indirekt |
| npm | @mariozechner/clipboard-win32-x64-msvc | 0.3.9 | indirekt |
| npm | @mixmark-io/domino | 2.2.0 | indirekt |
| npm | @nodable/entities | 2.1.0 | indirekt |
| npm | @pkgjs/parseargs | 0.11.0 | indirekt |
| npm | @protobufjs/aspromise | 1.1.2 | indirekt |
| npm | @protobufjs/base64 | 1.1.2 | indirekt |
| npm | @protobufjs/codegen | 2.0.5 | indirekt |
| npm | @protobufjs/eventemitter | 1.1.1 | indirekt |
| npm | @protobufjs/fetch | 1.1.1 | indirekt |
| npm | @protobufjs/float | 1.0.2 | indirekt |
| npm | @protobufjs/path | 1.1.2 | indirekt |
| npm | @protobufjs/pool | 1.1.0 | indirekt |
| npm | @protobufjs/utf8 | 1.1.1 | indirekt |
| npm | @protobufjs/utf8 | 1.1.2 | indirekt |
| npm | @silvia-odwyer/photon-node | 0.3.4 | indirekt |
| npm | @sinclair/typebox | 0.34.50 | indirekt |
| npm | @sinclair/typebox | 0.34.52 | indirekt |
| npm | @smithy/core | 3.24.3 | indirekt |
| npm | @smithy/core | 3.33.3 | indirekt |
| npm | @smithy/credential-provider-imds | 4.3.3 | indirekt |
| npm | @smithy/credential-provider-imds | 4.5.2 | indirekt |
| npm | @smithy/fetch-http-handler | 5.4.3 | indirekt |
| npm | @smithy/fetch-http-handler | 5.7.2 | indirekt |
| npm | @smithy/is-array-buffer | 2.2.0 | indirekt |
| npm | @smithy/node-http-handler | 4.11.3 | indirekt |
| npm | @smithy/node-http-handler | 4.7.3 | indirekt |
| npm | @smithy/signature-v4 | 5.4.3 | indirekt |
| npm | @smithy/signature-v4 | 5.7.3 | indirekt |
| npm | @smithy/types | 4.14.2 | indirekt |
| npm | @smithy/types | 4.17.2 | indirekt |
| npm | @smithy/util-buffer-from | 2.2.0 | indirekt |
| npm | @smithy/util-utf8 | 2.3.0 | indirekt |
| npm | @types/chai | 4.3.20 | indirekt |
| npm | @types/chai | 5.2.3 | indirekt |
| npm | @types/deep-eql | 4.0.2 | indirekt |
| npm | @types/jsdom | 28.0.3 | indirekt |
| npm | @types/mocha | 10.0.10 | indirekt |
| npm | @types/node | 20.19.43 | indirekt |
| npm | @types/node | 22.19.19 | indirekt |
| npm | @types/node | 22.20.1 | indirekt |
| npm | @types/node | 26.2.0 | indirekt |
| npm | @types/retry | 0.12.0 | indirekt |
| npm | @types/tough-cookie | 4.0.5 | indirekt |
| npm | @types/turndown | 5.0.6 | indirekt |
| npm | @yuuang/ffi-rs-android-arm64 | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-darwin-arm64 | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-darwin-x64 | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-linux-arm-gnueabihf | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-linux-arm64-gnu | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-linux-arm64-musl | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-linux-x64-gnu | 1.3.2 | indirekt |
| npm | @yuuang/ffi-rs-linux-x64-gnu | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-linux-x64-musl | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-win32-arm64-msvc | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-win32-ia32-msvc | 1.3.7 | indirekt |
| npm | @yuuang/ffi-rs-win32-x64-msvc | 1.3.7 | indirekt |
| npm | agent-base | 7.1.4 | indirekt |
| npm | ansi-colors | 4.1.3 | indirekt |
| npm | ansi-regex | 5.0.1 | indirekt |
| npm | ansi-regex | 6.3.0 | indirekt |
| npm | ansi-styles | 4.3.0 | indirekt |
| npm | ansi-styles | 6.2.3 | indirekt |
| npm | anymatch | 3.1.3 | indirekt |
| npm | argparse | 2.0.1 | indirekt |
| npm | assertion-error | 1.1.0 | indirekt |
| npm | assertion-error | 2.0.1 | indirekt |
| npm | balanced-match | 1.0.2 | indirekt |
| npm | balanced-match | 4.0.4 | indirekt |
| npm | base64-js | 1.5.1 | indirekt |
| npm | bidi-js | 1.0.3 | indirekt |
| npm | bignumber.js | 9.3.1 | indirekt |
| npm | binary-extensions | 2.3.0 | indirekt |
| npm | bonjour-service | 1.4.4 | indirekt |
| npm | bowser | 2.14.1 | indirekt |
| npm | brace-expansion | 2.1.2 | indirekt |
| npm | brace-expansion | 2.1.4 | indirekt |
| npm | brace-expansion | 5.0.9 | indirekt |
| npm | braces | 3.0.3 | indirekt |
| npm | browser-stdout | 1.3.1 | indirekt |
| npm | buffer-equal-constant-time | 1.0.1 | indirekt |
| npm | camelcase | 6.3.0 | indirekt |
| npm | chai | 4.5.0 | indirekt |
| npm | chai | 6.2.2 | indirekt |
| npm | chalk | 4.1.2 | indirekt |
| npm | chalk | 5.6.2 | indirekt |
| npm | check-error | 1.0.3 | indirekt |
| npm | chokidar | 3.6.0 | indirekt |
| npm | chokidar | 4.0.3 | indirekt |
| npm | cliui | 7.0.4 | indirekt |
| npm | cliui | 8.0.1 | indirekt |
| npm | color-convert | 2.0.1 | indirekt |
| npm | color-name | 1.1.4 | indirekt |
| npm | cross-spawn | 7.0.6 | indirekt |
| npm | css-tree | 3.2.1 | indirekt |
| npm | cssstyle | 5.3.7 | indirekt |
| npm | data-uri-to-buffer | 4.0.1 | indirekt |
| npm | data-urls | 6.0.1 | indirekt |
| npm | debug | 4.4.3 | indirekt |
| npm | decamelize | 4.0.0 | indirekt |
| npm | decimal.js | 10.6.0 | indirekt |
| npm | deep-eql | 4.1.4 | indirekt |
| npm | diff | 5.2.2 | indirekt |
| npm | diff | 7.0.0 | indirekt |
| npm | diff | 8.0.4 | indirekt |
| npm | dns-packet | 5.6.1 | indirekt |
| npm | eastasianwidth | 0.2.0 | indirekt |
| npm | ecdsa-sig-formatter | 1.0.11 | indirekt |
| npm | emoji-regex | 8.0.0 | indirekt |
| npm | emoji-regex | 9.2.2 | indirekt |
| npm | entities | 8.0.0 | indirekt |
| npm | esbuild | 0.28.1 | indirekt |
| npm | esbuild | 0.28.2 | indirekt |
| npm | escalade | 3.2.0 | indirekt |
| npm | escape-string-regexp | 4.0.0 | indirekt |
| npm | extend | 3.0.2 | indirekt |
| npm | fast-deep-equal | 3.1.3 | indirekt |
| npm | fast-xml-builder | 1.2.0 | indirekt |
| npm | fast-xml-parser | 5.7.3 | indirekt |
| npm | fetch-blob | 3.2.0 | indirekt |
| npm | ffi-rs | 1.3.7 | indirekt |
| npm | fill-range | 7.1.1 | indirekt |
| npm | find-up | 5.0.0 | indirekt |
| npm | flat | 5.0.2 | indirekt |
| npm | foreground-child | 3.3.1 | indirekt |
| npm | formdata-polyfill | 4.0.10 | indirekt |
| npm | fs.realpath | 1.0.0 | indirekt |
| npm | fsevents | 2.3.3 | indirekt |
| npm | gaxios | 7.1.4 | indirekt |
| npm | gaxios | 7.3.1 | indirekt |
| npm | gcp-metadata | 8.1.2 | indirekt |
| npm | get-caller-file | 2.0.5 | indirekt |
| npm | get-east-asian-width | 1.6.0 | indirekt |
| npm | get-func-name | 2.0.2 | indirekt |
| npm | glob | 10.5.0 | indirekt |
| npm | glob | 8.1.0 | indirekt |
| npm | glob-parent | 5.1.2 | indirekt |
| npm | google-auth-library | 10.6.2 | indirekt |
| npm | google-auth-library | 10.9.1 | indirekt |
| npm | google-logging-utils | 1.1.3 | indirekt |
| npm | graceful-fs | 4.2.11 | indirekt |
| npm | grok-mermaid | 0.2.2 | indirekt |
| npm | has-flag | 4.0.0 | indirekt |
| npm | he | 1.2.0 | indirekt |
| npm | highlight.js | 10.7.3 | indirekt |
| npm | hosted-git-info | 9.0.3 | indirekt |
| npm | html-encoding-sniffer | 6.0.0 | indirekt |
| npm | http-proxy-agent | 7.0.2 | indirekt |
| npm | https-proxy-agent | 7.0.6 | indirekt |
| npm | ignore | 7.0.5 | indirekt |
| npm | inflight | 1.0.6 | indirekt |
| npm | inherits | 2.0.4 | indirekt |
| npm | is-binary-path | 2.1.0 | indirekt |
| npm | is-extglob | 2.1.1 | indirekt |
| npm | is-fullwidth-code-point | 3.0.0 | indirekt |
| npm | is-glob | 4.0.3 | indirekt |
| npm | is-number | 7.0.0 | indirekt |
| npm | is-path-inside | 3.0.3 | indirekt |
| npm | is-plain-obj | 2.1.0 | indirekt |
| npm | is-potential-custom-element-name | 1.0.1 | indirekt |
| npm | is-unicode-supported | 0.1.0 | indirekt |
| npm | isexe | 2.0.0 | indirekt |
| npm | jackspeak | 3.4.3 | indirekt |
| npm | jiti | 2.7.0 | indirekt |
| npm | js-yaml | 4.3.0 | indirekt |
| npm | js-yaml | 4.3.1 | indirekt |
| npm | json-bigint | 1.0.0 | indirekt |
| npm | json-schema-to-ts | 3.1.1 | indirekt |
| npm | jwa | 2.0.1 | indirekt |
| npm | jws | 4.0.1 | indirekt |
| npm | locate-path | 6.0.0 | indirekt |
| npm | log-symbols | 4.1.0 | indirekt |
| npm | long | 5.3.2 | indirekt |
| npm | loupe | 2.3.7 | indirekt |
| npm | lru-cache | 10.4.3 | indirekt |
| npm | lru-cache | 11.4.0 | indirekt |
| npm | lru-cache | 11.5.2 | indirekt |
| npm | marked | 18.0.5 | indirekt |
| npm | mdn-data | 2.27.1 | indirekt |
| npm | minimatch | 10.2.5 | indirekt |
| npm | minimatch | 5.1.9 | indirekt |
| npm | minimatch | 9.0.9 | indirekt |
| npm | minipass | 7.1.3 | indirekt |
| npm | mocha | 10.8.2 | indirekt |
| npm | mocha | 11.8.0 | indirekt |
| npm | ms | 2.1.3 | indirekt |
| npm | multicast-dns | 7.2.5 | indirekt |
| npm | node-domexception | 1.0.0 | indirekt |
| npm | node-fetch | 3.3.2 | indirekt |
| npm | normalize-path | 3.0.0 | indirekt |
| npm | once | 1.4.0 | indirekt |
| npm | openai | 6.40.0 | indirekt |
| npm | p-limit | 3.1.0 | indirekt |
| npm | p-locate | 5.0.0 | indirekt |
| npm | p-retry | 4.6.2 | indirekt |
| npm | package-json-from-dist | 1.0.1 | indirekt |
| npm | parse5 | 8.0.1 | indirekt |
| npm | partial-json | 0.1.7 | indirekt |
| npm | path-exists | 4.0.0 | indirekt |
| npm | path-expression-matcher | 1.5.0 | indirekt |
| npm | path-key | 3.1.1 | indirekt |
| npm | path-scurry | 1.11.1 | indirekt |
| npm | pathval | 1.1.1 | indirekt |
| npm | picocolors | 1.1.1 | indirekt |
| npm | picomatch | 2.3.2 | indirekt |
| npm | proper-lockfile | 4.1.2 | indirekt |
| npm | protobufjs | 7.6.5 | indirekt |
| npm | punycode | 2.3.1 | indirekt |
| npm | randombytes | 2.1.0 | indirekt |
| npm | readdirp | 3.6.0 | indirekt |
| npm | readdirp | 4.1.2 | indirekt |
| npm | require-directory | 2.1.1 | indirekt |
| npm | require-from-string | 2.0.2 | indirekt |
| npm | retry | 0.12.0 | indirekt |
| npm | retry | 0.13.1 | indirekt |
| npm | safe-buffer | 5.2.1 | indirekt |
| npm | saxes | 6.0.0 | indirekt |
| npm | semver | 7.8.0 | indirekt |
| npm | serialize-javascript | 6.0.2 | indirekt |
| npm | serialize-javascript | 7.0.7 | indirekt |
| npm | serialize-javascript | 7.1.0 | indirekt |
| npm | shebang-command | 2.0.0 | indirekt |
| npm | shebang-regex | 3.0.0 | indirekt |
| npm | signal-exit | 3.0.7 | indirekt |
| npm | signal-exit | 4.1.0 | indirekt |
| npm | source-map-js | 1.2.1 | indirekt |
| npm | string-width | 4.2.3 | indirekt |
| npm | string-width | 5.1.2 | indirekt |
| npm | strip-ansi | 6.0.1 | indirekt |
| npm | strip-ansi | 7.2.0 | indirekt |
| npm | strip-json-comments | 3.1.1 | indirekt |
| npm | strnum | 2.3.0 | indirekt |
| npm | supports-color | 7.2.0 | indirekt |
| npm | supports-color | 8.1.1 | indirekt |
| npm | symbol-tree | 3.2.4 | indirekt |
| npm | thunky | 1.1.0 | indirekt |
| npm | tldts | 7.4.10 | indirekt |
| npm | tldts-core | 7.4.10 | indirekt |
| npm | to-regex-range | 5.0.1 | indirekt |
| npm | tough-cookie | 6.0.2 | indirekt |
| npm | tr46 | 6.0.0 | indirekt |
| npm | ts-algebra | 2.0.0 | indirekt |
| npm | tslib | 2.8.1 | indirekt |
| npm | tsx | 4.23.0 | indirekt |
| npm | tsx | 4.23.1 | indirekt |
| npm | tsx | 4.23.12 | indirekt |
| npm | type-detect | 4.1.0 | indirekt |
| npm | typebox | 1.3.12 | indirekt |
| npm | typebox | 1.3.15 | indirekt |
| npm | typebox | 1.3.16 | indirekt |
| npm | typebox | 1.3.19 | indirekt |
| npm | typebox | 1.3.3 | indirekt |
| npm | typebox | 1.3.7 | indirekt |
| npm | typebox | 1.3.8 | indirekt |
| npm | typescript | 5.9.3 | indirekt |
| npm | undici | 8.9.0 | indirekt |
| npm | undici-types | 6.21.0 | indirekt |
| npm | undici-types | 7.29.0 | indirekt |
| npm | undici-types | 8.3.0 | indirekt |
| npm | w3c-xmlserializer | 5.0.0 | indirekt |
| npm | web-streams-polyfill | 3.3.3 | indirekt |
| npm | webidl-conversions | 8.0.1 | indirekt |
| npm | whatwg-mimetype | 4.0.0 | indirekt |
| npm | whatwg-mimetype | 5.0.0 | indirekt |
| npm | whatwg-url | 15.1.0 | indirekt |
| npm | which | 2.0.2 | indirekt |
| npm | workerpool | 6.5.1 | indirekt |
| npm | workerpool | 9.3.4 | indirekt |
| npm | wrap-ansi | 7.0.0 | indirekt |
| npm | wrap-ansi | 8.1.0 | indirekt |
| npm | wrappy | 1.0.2 | indirekt |
| npm | ws | 8.21.0 | indirekt |
| npm | ws | 8.21.3 | indirekt |
| npm | xml-name-validator | 5.0.0 | indirekt |
| npm | xml-naming | 0.1.0 | indirekt |
| npm | xmlchars | 2.2.0 | indirekt |
| npm | y18n | 5.0.8 | indirekt |
| npm | yaml | 2.9.0 | indirekt |
| npm | yargs | 16.2.2 | indirekt |
| npm | yargs | 17.7.3 | indirekt |
| npm | yargs-parser | 20.2.9 | indirekt |
| npm | yargs-parser | 21.1.1 | indirekt |
| npm | yargs-unparser | 2.0.0 | indirekt |
| npm | yocto-queue | 0.1.0 | indirekt |
Dieses Repository veröffentlicht kein vom Index auflösbares Paket, daher wurde sein eigener Abhängigkeitsgraph bewertet – 431 Pakete, darunter auch Entwicklungs- und Test-Pins, die nie ausgeliefert werden: 4 tragen bekannte Advisories, davon 0 direkte.
| Paket | Version | Beziehung | Schweregrad | Advisories | Behoben in |
|---|---|---|---|---|---|
| brace-expansion | 2.1.2 | indirekt | hoch | 2 | 5.0.9 |
| js-yaml | 4.3.0 | indirekt | hoch | 1 | 4.3.1 |
| serialize-javascript | 6.0.2 | indirekt | hoch | 2 | 7.0.5 |
| diff | 7.0.0 | indirekt | mittel | 1 | 8.0.3 |
Ein Advisory bedeutet, dass die im Abhängigkeitsgraphen erfasste Version in den betroffenen Bereich eines Advisories fällt. Erreichbarkeit wird nicht analysiert, und der Graph enthält Entwicklungs- und Test-Pins — ein Fund kann das Werkzeug betreffen und nicht die ausgelieferte Software.
Stimmt etwas in diesem Bericht nicht, oder gibt es Gedanken dazu? Falsche Messungen, übersehene Tools, Ideen, Fragen — alles ist willkommen. Jede Nachricht wird gelesen und beantwortet.
Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v2.10.0, Schema v0.34.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm.