Currents MCP Server
currents-dev/currents-mcp erreicht einen Gesundheitsindex von 71 von 100 und liegt damit im Bereich Gut. Am stärksten schneidet es bei Vitality (93/100) ab, am schwächsten bei AI Readiness (40/100). Zuletzt vor 4 Tagen aktualisiert. 4 Mitwirkende tragen den Großteil der jüngsten Arbeit.
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | @currents/mcp | 2.3.3 | 78.006 | 35 | vor 35 Tagen | currentsmcp-serverplaywrightdashboardreporting |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 4 Tagen |
| 24.9/36 | Commit-Rhythmus — 36/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 208 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 208 |
| human_commit_share | — |
| days_since_last_push | 4 |
| active_weeks_last_year | 36 |
| 27/27 | Liefert Releases aus — 7 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 62 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 40,6 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
| releases_count | 7 |
| latest_release_tag | v2.3.1 |
| releases_from_tags | nein |
| days_since_latest_release | 62 |
| mean_days_between_releases | 40,6 |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 19.5/60 | Stars — 17 Stars |
| 9.3/25 | Forks — 14 Forks |
| 0/15 | Watcher — 2 Watcher |
| forks | 14 |
| stars | 17 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (Apache-2.0) |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
| has_readme | ja |
| has_license | ja |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | nein |
| 65.2/80 | Downloads pro Monat — 78.006 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
| packages | @currents/mcp |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 78.006 |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 43.2/54 | Bus-Faktor — 4 Beitragende decken die Hälfte aller Commits ab |
| 17.9/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 20 % der Commits |
| 13.5/13.5 | Breite der Beitragenden — 15 Beitragende |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 4 |
| contributors_sampled | 15 |
| top_contributor_share | 0,205 |
| 0/46.8 | Issue-Lösungsquote — keine Issues oder keine Daten |
| 27.2/38.3 | PR-Annahme — 106/149 entschiedene PRs gemergt |
| 6/15 | OpenSSF Scorecard: Code-Review — Found 4/9 approved changesets -- score normalized to 4 |
| merged_prs | 106 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 43 |
| 30/30 | Organisatorische Trägerschaft — im Besitz einer Organisation |
| 0/20 | Verifizierte Domain |
| 12.7/25 | Reichweite des Inhabers — 58 Follower von currents-dev |
| 23.5/25 | Kontohistorie — 57 öffentliche Repos, Kontoalter ca. 5 Jahre |
| followers | 58 |
| owner_type | Organization |
| is_verified | — |
| owner_login | currents-dev |
| public_repos | 57 |
| account_age_days | 1.948 |
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 35 Tagen |
| 20/20 | Versionshistorie — 35 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | @currents/mcp |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 35 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 24/24 | CI-Workflows — 9 Workflow(s) |
| 24/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 17 out of 17 merged PRs checked by a CI test -- score normalized to 10 |
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | nein |
| has_precommit_config | nein |
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://currents.dev |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 4 Topics |
| 10/10 | Wiki |
| topics | ai, currents, mcp, playwright |
| has_wiki | ja |
| homepage | https://currents.dev |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — keine Daten |
| 2.5/2.5 | CI-Tests — 17 out of 17 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 3/7.5 | Code-Review — Found 4/9 approved changesets -- score normalized to 4 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 0/10 | Dangerous-Workflow — dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 1/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
| 35/35 | Direkte Abhängigkeiten ohne bekannte Advisories — keine direkte Abhängigkeit trägt ein bekanntes Advisory |
| 25/25 | Indirekte Abhängigkeiten ohne bekannte Advisories — keine indirekte Abhängigkeit trägt ein bekanntes Advisory |
| 0/40 | Keine offenen Advisories — kein Advisory trägt ein Veröffentlichungsdatum |
| source | osv |
| advisories | 0 |
| affected_packages | 0 |
| assessed_packages | 122 |
| unassessed_packages | 0 |
| affected_by_severity | none |
| direct_affected_packages | 0 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
| has_llms_txt | nein |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 11/11 | Statische Typprüfung — mcp-server/tsconfig.json |
| 10/10 | Reproduzierbare Umgebung — Dockerfile, lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 0/8 | Automatisierte Wartung — keine Daten |
| 2/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
| has_nix | nein |
| has_tests | ja |
| lockfiles | package-lock.json |
| has_dockerfile | ja |
| typed_language | ja |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | mcp-server/tsconfig.json |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 45/45 | Typprüfbarer Code — TypeScript (statisch typisiert) |
| 55/55 | Handhabbare Dateigrößen — 0/70 Quelldateien über 60 KB |
| primary_language | TypeScript |
| largest_source_bytes | 18.905 |
| source_files_sampled | 70 |
| oversized_source_files | 0 |
| 0/40 | API-Schema (OpenAPI/GraphQL/proto) |
| 20/20 | MCP-Server |
| 0/40 | Lauffähige Beispiele |
| example_dirs | — |
| has_mcp_signal | ja |
| api_schema_files | — |
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| k. A. | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 10 | CI-Tests | 17 out of 17 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 4 | Code-Review | Found 4/9 approved changesets -- score normalized to 4 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 0 | Dangerous-Workflow | dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 2 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 2 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| npm | @modelcontextprotocol/sdk | ^1.28.0 | mcp-server/package.json |
| npm | commander | ^12.1.0 | mcp-server/package.json |
| npm | pino | ^9.9.5 | mcp-server/package.json |
| npm | pino-pretty | ^13.1.1 | mcp-server/package.json |
| npm | zod | ^4.3.5 | mcp-server/package.json |
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 5 direkte und 418 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| npm | @modelcontextprotocol/sdk | 1.28.0 | direkt |
| npm | commander | 12.1.0 | direkt |
| npm | pino | 9.13.1 | direkt |
| npm | pino-pretty | 13.1.1 | direkt |
| npm | zod | 4.3.5 | direkt |
| npm | @babel/generator | 8.0.0-rc.3 | indirekt |
| npm | @babel/helper-string-parser | 8.0.0-rc.5 | indirekt |
| npm | @babel/helper-validator-identifier | 8.0.0-rc.3 | indirekt |
| npm | @babel/parser | 8.0.0-rc.3 | indirekt |
| npm | @babel/types | 8.0.0-rc.3 | indirekt |
| npm | @conventional-changelog/git-client | 2.7.0 | indirekt |
| npm | @emnapi/core | 1.10.0 | indirekt |
| npm | @emnapi/runtime | 1.10.0 | indirekt |
| npm | @emnapi/wasi-threads | 1.2.1 | indirekt |
| npm | @hono/node-server | 1.19.13 | indirekt |
| npm | @inquirer/ansi | 2.0.5 | indirekt |
| npm | @inquirer/checkbox | 5.1.5 | indirekt |
| npm | @inquirer/confirm | 6.0.13 | indirekt |
| npm | @inquirer/core | 11.1.10 | indirekt |
| npm | @inquirer/editor | 5.1.2 | indirekt |
| npm | @inquirer/expand | 5.0.14 | indirekt |
| npm | @inquirer/external-editor | 3.0.0 | indirekt |
| npm | @inquirer/figures | 2.0.5 | indirekt |
| npm | @inquirer/input | 5.0.13 | indirekt |
| npm | @inquirer/number | 4.0.13 | indirekt |
| npm | @inquirer/password | 5.0.13 | indirekt |
| npm | @inquirer/prompts | 8.4.2 | indirekt |
| npm | @inquirer/rawlist | 5.2.9 | indirekt |
| npm | @inquirer/search | 4.1.9 | indirekt |
| npm | @inquirer/select | 5.1.5 | indirekt |
| npm | @inquirer/type | 4.0.5 | indirekt |
| npm | @jridgewell/gen-mapping | 0.3.13 | indirekt |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirekt |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirekt |
| npm | @jridgewell/trace-mapping | 0.3.31 | indirekt |
| npm | @napi-rs/wasm-runtime | 1.1.4 | indirekt |
| npm | @octokit/auth-token | 6.0.0 | indirekt |
| npm | @octokit/core | 7.0.6 | indirekt |
| npm | @octokit/endpoint | 11.0.2 | indirekt |
| npm | @octokit/graphql | 9.0.3 | indirekt |
| npm | @octokit/openapi-types | 27.0.0 | indirekt |
| npm | @octokit/plugin-paginate-rest | 14.0.0 | indirekt |
| npm | @octokit/plugin-request-log | 6.0.0 | indirekt |
| npm | @octokit/plugin-rest-endpoint-methods | 17.0.0 | indirekt |
| npm | @octokit/request | 10.0.7 | indirekt |
| npm | @octokit/request-error | 7.1.0 | indirekt |
| npm | @octokit/rest | 22.0.1 | indirekt |
| npm | @octokit/types | 16.0.0 | indirekt |
| npm | @oxc-project/types | 0.127.0 | indirekt |
| npm | @oxc-project/types | 0.133.0 | indirekt |
| npm | @phun-ky/typeof | 2.0.3 | indirekt |
| npm | @quansync/fs | 1.0.0 | indirekt |
| npm | @release-it/conventional-changelog | 11.0.0 | indirekt |
| npm | @rolldown/binding-android-arm64 | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-android-arm64 | 1.0.3 | indirekt |
| npm | @rolldown/binding-darwin-arm64 | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-darwin-arm64 | 1.0.3 | indirekt |
| npm | @rolldown/binding-darwin-x64 | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-darwin-x64 | 1.0.3 | indirekt |
| npm | @rolldown/binding-freebsd-x64 | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-freebsd-x64 | 1.0.3 | indirekt |
| npm | @rolldown/binding-linux-arm-gnueabihf | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-linux-arm-gnueabihf | 1.0.3 | indirekt |
| npm | @rolldown/binding-linux-arm64-gnu | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-linux-arm64-gnu | 1.0.3 | indirekt |
| npm | @rolldown/binding-linux-arm64-musl | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-linux-arm64-musl | 1.0.3 | indirekt |
| npm | @rolldown/binding-linux-ppc64-gnu | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-linux-ppc64-gnu | 1.0.3 | indirekt |
| npm | @rolldown/binding-linux-s390x-gnu | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-linux-s390x-gnu | 1.0.3 | indirekt |
| npm | @rolldown/binding-linux-x64-gnu | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-linux-x64-gnu | 1.0.3 | indirekt |
| npm | @rolldown/binding-linux-x64-musl | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-linux-x64-musl | 1.0.3 | indirekt |
| npm | @rolldown/binding-openharmony-arm64 | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-openharmony-arm64 | 1.0.3 | indirekt |
| npm | @rolldown/binding-wasm32-wasi | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-wasm32-wasi | 1.0.3 | indirekt |
| npm | @rolldown/binding-win32-arm64-msvc | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-win32-arm64-msvc | 1.0.3 | indirekt |
| npm | @rolldown/binding-win32-x64-msvc | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/binding-win32-x64-msvc | 1.0.3 | indirekt |
| npm | @rolldown/pluginutils | 1.0.0-rc.17 | indirekt |
| npm | @rolldown/pluginutils | 1.0.1 | indirekt |
| npm | @simple-libs/child-process-utils | 1.0.1 | indirekt |
| npm | @simple-libs/hosted-git-info | 1.0.2 | indirekt |
| npm | @simple-libs/stream-utils | 1.2.0 | indirekt |
| npm | @standard-schema/spec | 1.1.0 | indirekt |
| npm | @tybys/wasm-util | 0.10.2 | indirekt |
| npm | @types/chai | 5.2.3 | indirekt |
| npm | @types/deep-eql | 4.0.2 | indirekt |
| npm | @types/estree | 1.0.8 | indirekt |
| npm | @types/jsesc | 2.5.1 | indirekt |
| npm | @types/node | 20.19.37 | indirekt |
| npm | @types/node | 22.19.15 | indirekt |
| npm | @types/normalize-package-data | 2.4.4 | indirekt |
| npm | @types/parse-path | 7.0.3 | indirekt |
| npm | @vitest/expect | 4.1.0 | indirekt |
| npm | @vitest/mocker | 4.1.0 | indirekt |
| npm | @vitest/pretty-format | 4.1.0 | indirekt |
| npm | @vitest/runner | 4.1.0 | indirekt |
| npm | @vitest/snapshot | 4.1.0 | indirekt |
| npm | @vitest/spy | 4.1.0 | indirekt |
| npm | @vitest/utils | 4.1.0 | indirekt |
| npm | accepts | 2.0.0 | indirekt |
| npm | agent-base | 8.0.0 | indirekt |
| npm | ajv | 8.18.0 | indirekt |
| npm | ajv-formats | 3.0.1 | indirekt |
| npm | ansi-regex | 6.2.2 | indirekt |
| npm | ansis | 4.3.0 | indirekt |
| npm | array-ify | 1.0.0 | indirekt |
| npm | assertion-error | 2.0.1 | indirekt |
| npm | ast-kit | 3.0.0-beta.1 | indirekt |
| npm | ast-types | 0.13.4 | indirekt |
| npm | async-retry | 1.3.3 | indirekt |
| npm | atomic-sleep | 1.0.0 | indirekt |
| npm | basic-ftp | 5.3.1 | indirekt |
| npm | before-after-hook | 4.0.0 | indirekt |
| npm | birpc | 4.0.0 | indirekt |
| npm | body-parser | 2.2.2 | indirekt |
| npm | buffer-from | 1.1.2 | indirekt |
| npm | bundle-name | 4.1.0 | indirekt |
| npm | bytes | 3.1.2 | indirekt |
| npm | c12 | 3.3.3 | indirekt |
| npm | cac | 7.0.0 | indirekt |
| npm | call-bind-apply-helpers | 1.0.2 | indirekt |
| npm | call-bound | 1.0.4 | indirekt |
| npm | chai | 6.2.2 | indirekt |
| npm | chalk | 5.6.2 | indirekt |
| npm | chardet | 2.1.1 | indirekt |
| npm | chokidar | 5.0.0 | indirekt |
| npm | ci-info | 4.4.0 | indirekt |
| npm | citty | 0.1.6 | indirekt |
| npm | citty | 0.2.0 | indirekt |
| npm | cli-cursor | 5.0.0 | indirekt |
| npm | cli-spinners | 3.4.0 | indirekt |
| npm | cli-width | 4.1.0 | indirekt |
| npm | colorette | 2.0.20 | indirekt |
| npm | compare-func | 2.0.0 | indirekt |
| npm | concat-stream | 2.0.0 | indirekt |
| npm | confbox | 0.2.2 | indirekt |
| npm | consola | 3.4.2 | indirekt |
| npm | content-disposition | 1.0.1 | indirekt |
| npm | content-type | 1.0.5 | indirekt |
| npm | conventional-changelog | 7.2.0 | indirekt |
| npm | conventional-changelog-angular | 8.3.1 | indirekt |
| npm | conventional-changelog-conventionalcommits | 9.3.1 | indirekt |
| npm | conventional-changelog-preset-loader | 5.0.0 | indirekt |
| npm | conventional-changelog-writer | 8.4.0 | indirekt |
| npm | conventional-commits-filter | 5.0.0 | indirekt |
| npm | conventional-commits-parser | 6.4.0 | indirekt |
| npm | conventional-recommended-bump | 11.2.0 | indirekt |
| npm | convert-source-map | 2.0.0 | indirekt |
| npm | cookie | 0.7.2 | indirekt |
| npm | cookie-signature | 1.2.2 | indirekt |
| npm | cors | 2.8.5 | indirekt |
| npm | cross-spawn | 7.0.6 | indirekt |
| npm | data-uri-to-buffer | 7.0.0 | indirekt |
| npm | dateformat | 4.6.3 | indirekt |
| npm | debug | 4.4.3 | indirekt |
| npm | default-browser | 5.5.0 | indirekt |
| npm | default-browser-id | 5.0.1 | indirekt |
| npm | define-lazy-prop | 3.0.0 | indirekt |
| npm | defu | 6.1.7 | indirekt |
| npm | degenerator | 6.0.0 | indirekt |
| npm | depd | 2.0.0 | indirekt |
| npm | destr | 2.0.5 | indirekt |
| npm | detect-libc | 2.1.2 | indirekt |
| npm | dot-prop | 5.3.0 | indirekt |
| npm | dotenv | 17.2.3 | indirekt |
| npm | dts-resolver | 2.1.3 | indirekt |
| npm | dunder-proto | 1.0.1 | indirekt |
| npm | ee-first | 1.1.1 | indirekt |
| npm | empathic | 2.0.1 | indirekt |
| npm | encodeurl | 2.0.0 | indirekt |
| npm | end-of-stream | 1.4.5 | indirekt |
| npm | es-define-property | 1.0.1 | indirekt |
| npm | es-errors | 1.3.0 | indirekt |
| npm | es-module-lexer | 2.1.0 | indirekt |
| npm | es-object-atoms | 1.1.1 | indirekt |
| npm | escape-html | 1.0.3 | indirekt |
| npm | escodegen | 2.1.0 | indirekt |
| npm | esprima | 4.0.1 | indirekt |
| npm | estraverse | 5.3.0 | indirekt |
| npm | estree-walker | 3.0.3 | indirekt |
| npm | esutils | 2.0.3 | indirekt |
| npm | eta | 4.5.1 | indirekt |
| npm | etag | 1.8.1 | indirekt |
| npm | eventsource | 3.0.6 | indirekt |
| npm | eventsource-parser | 3.0.1 | indirekt |
| npm | expect-type | 1.3.0 | indirekt |
| npm | express | 5.2.1 | indirekt |
| npm | express-rate-limit | 8.5.1 | indirekt |
| npm | exsolve | 1.0.8 | indirekt |
| npm | fast-content-type-parse | 3.0.0 | indirekt |
| npm | fast-copy | 3.0.2 | indirekt |
| npm | fast-deep-equal | 3.1.3 | indirekt |
| npm | fast-safe-stringify | 2.1.1 | indirekt |
| npm | fast-string-truncated-width | 3.0.3 | indirekt |
| npm | fast-string-width | 3.0.2 | indirekt |
| npm | fast-uri | 3.1.2 | indirekt |
| npm | fast-wrap-ansi | 0.2.0 | indirekt |
| npm | fd-package-json | 2.0.0 | indirekt |
| npm | fdir | 6.5.0 | indirekt |
| npm | finalhandler | 2.1.1 | indirekt |
| npm | forwarded | 0.2.0 | indirekt |
| npm | fresh | 2.0.0 | indirekt |
| npm | fsevents | 2.3.3 | indirekt |
| npm | function-bind | 1.1.2 | indirekt |
| npm | get-east-asian-width | 1.6.0 | indirekt |
| npm | get-intrinsic | 1.3.0 | indirekt |
| npm | get-proto | 1.0.1 | indirekt |
| npm | get-tsconfig | 4.14.0 | indirekt |
| npm | get-uri | 7.0.0 | indirekt |
| npm | giget | 2.0.0 | indirekt |
| npm | git-up | 8.1.1 | indirekt |
| npm | git-url-parse | 16.1.0 | indirekt |
| npm | gopd | 1.2.0 | indirekt |
| npm | handlebars | 4.7.9 | indirekt |
| npm | has-symbols | 1.1.0 | indirekt |
| npm | hasown | 2.0.2 | indirekt |
| npm | help-me | 5.0.0 | indirekt |
| npm | hono | 4.12.26 | indirekt |
| npm | hookable | 6.1.1 | indirekt |
| npm | hosted-git-info | 8.1.0 | indirekt |
| npm | http-errors | 2.0.1 | indirekt |
| npm | http-proxy-agent | 8.0.0 | indirekt |
| npm | https-proxy-agent | 8.0.0 | indirekt |
| npm | iconv-lite | 0.7.2 | indirekt |
| npm | import-without-cache | 0.3.3 | indirekt |
| npm | inherits | 2.0.4 | indirekt |
| npm | ip-address | 10.2.0 | indirekt |
| npm | ipaddr.js | 1.9.1 | indirekt |
| npm | is-docker | 3.0.0 | indirekt |
| npm | is-in-ssh | 1.0.0 | indirekt |
| npm | is-inside-container | 1.0.0 | indirekt |
| npm | is-interactive | 2.0.0 | indirekt |
| npm | is-obj | 2.0.0 | indirekt |
| npm | is-promise | 4.0.0 | indirekt |
| npm | is-ssh | 1.4.1 | indirekt |
| npm | is-unicode-supported | 2.1.0 | indirekt |
| npm | is-wsl | 3.1.1 | indirekt |
| npm | isexe | 2.0.0 | indirekt |
| npm | issue-parser | 7.0.1 | indirekt |
| npm | jiti | 2.6.1 | indirekt |
| npm | jose | 6.1.3 | indirekt |
| npm | joycon | 3.1.1 | indirekt |
| npm | jsesc | 3.1.0 | indirekt |
| npm | json-schema-traverse | 1.0.0 | indirekt |
| npm | json-schema-typed | 8.0.2 | indirekt |
| npm | lightningcss | 1.32.0 | indirekt |
| npm | lightningcss-android-arm64 | 1.32.0 | indirekt |
| npm | lightningcss-darwin-arm64 | 1.32.0 | indirekt |
| npm | lightningcss-darwin-x64 | 1.32.0 | indirekt |
| npm | lightningcss-freebsd-x64 | 1.32.0 | indirekt |
| npm | lightningcss-linux-arm-gnueabihf | 1.32.0 | indirekt |
| npm | lightningcss-linux-arm64-gnu | 1.32.0 | indirekt |
| npm | lightningcss-linux-arm64-musl | 1.32.0 | indirekt |
| npm | lightningcss-linux-x64-gnu | 1.32.0 | indirekt |
| npm | lightningcss-linux-x64-musl | 1.32.0 | indirekt |
| npm | lightningcss-win32-arm64-msvc | 1.32.0 | indirekt |
| npm | lightningcss-win32-x64-msvc | 1.32.0 | indirekt |
| npm | lodash.capitalize | 4.2.1 | indirekt |
| npm | lodash.escaperegexp | 4.1.2 | indirekt |
| npm | lodash.isplainobject | 4.0.6 | indirekt |
| npm | lodash.isstring | 4.0.1 | indirekt |
| npm | lodash.merge | 4.6.2 | indirekt |
| npm | lodash.uniqby | 4.7.0 | indirekt |
| npm | log-symbols | 7.0.1 | indirekt |
| npm | lru-cache | 10.4.3 | indirekt |
| npm | lru-cache | 7.18.3 | indirekt |
| npm | macos-release | 3.4.0 | indirekt |
| npm | magic-string | 0.30.21 | indirekt |
| npm | math-intrinsics | 1.1.0 | indirekt |
| npm | media-typer | 1.1.0 | indirekt |
| npm | meow | 13.2.0 | indirekt |
| npm | merge-descriptors | 2.0.0 | indirekt |
| npm | mime-db | 1.54.0 | indirekt |
| npm | mime-types | 3.0.2 | indirekt |
| npm | mimic-function | 5.0.1 | indirekt |
| npm | minimist | 1.2.8 | indirekt |
| npm | ms | 2.1.3 | indirekt |
| npm | mute-stream | 3.0.0 | indirekt |
| npm | nanoid | 3.3.12 | indirekt |
| npm | negotiator | 1.0.0 | indirekt |
| npm | neo-async | 2.6.2 | indirekt |
| npm | netmask | 2.1.1 | indirekt |
| npm | new-github-release-url | 2.0.0 | indirekt |
| npm | node-fetch-native | 1.6.7 | indirekt |
| npm | normalize-package-data | 7.0.1 | indirekt |
| npm | nypm | 0.6.4 | indirekt |
| npm | object-assign | 4.1.1 | indirekt |
| npm | object-inspect | 1.13.4 | indirekt |
| npm | obug | 2.1.1 | indirekt |
| npm | ohash | 2.0.11 | indirekt |
| npm | on-exit-leak-free | 2.1.2 | indirekt |
| npm | on-finished | 2.4.1 | indirekt |
| npm | once | 1.4.0 | indirekt |
| npm | onetime | 7.0.0 | indirekt |
| npm | open | 11.0.0 | indirekt |
| npm | ora | 9.3.0 | indirekt |
| npm | os-name | 7.0.0 | indirekt |
| npm | pac-proxy-agent | 8.0.0 | indirekt |
| npm | pac-resolver | 8.0.0 | indirekt |
| npm | parse-path | 7.1.0 | indirekt |
| npm | parse-url | 9.2.0 | indirekt |
| npm | parseurl | 1.3.3 | indirekt |
| npm | path-key | 3.1.1 | indirekt |
| npm | path-to-regexp | 8.4.0 | indirekt |
| npm | pathe | 2.0.3 | indirekt |
| npm | perfect-debounce | 2.1.0 | indirekt |
| npm | picocolors | 1.1.1 | indirekt |
| npm | picomatch | 4.0.4 | indirekt |
| npm | pino-abstract-transport | 2.0.0 | indirekt |
| npm | pino-std-serializers | 7.0.0 | indirekt |
| npm | pkce-challenge | 5.0.0 | indirekt |
| npm | pkg-types | 2.3.0 | indirekt |
| npm | postcss | 8.5.15 | indirekt |
| npm | powershell-utils | 0.1.0 | indirekt |
| npm | powershell-utils | 0.2.0 | indirekt |
| npm | process-warning | 5.0.0 | indirekt |
| npm | protocols | 2.0.2 | indirekt |
| npm | proxy-addr | 2.0.7 | indirekt |
| npm | proxy-agent | 7.0.0 | indirekt |
| npm | proxy-from-env | 1.1.0 | indirekt |
| npm | pump | 3.0.3 | indirekt |
| npm | qs | 6.15.2 | indirekt |
| npm | quansync | 1.0.0 | indirekt |
| npm | quick-format-unescaped | 4.0.4 | indirekt |
| npm | quickjs-wasi | 0.0.1 | indirekt |
| npm | range-parser | 1.2.1 | indirekt |
| npm | raw-body | 3.0.2 | indirekt |
| npm | rc9 | 2.1.2 | indirekt |
| npm | readable-stream | 3.6.2 | indirekt |
| npm | readdirp | 5.0.0 | indirekt |
| npm | real-require | 0.2.0 | indirekt |
| npm | release-it | 20.2.1 | indirekt |
| npm | require-from-string | 2.0.2 | indirekt |
| npm | resolve-pkg-maps | 1.0.0 | indirekt |
| npm | restore-cursor | 5.1.0 | indirekt |
| npm | retry | 0.13.1 | indirekt |
| npm | rolldown | 1.0.0-rc.17 | indirekt |
| npm | rolldown | 1.0.3 | indirekt |
| npm | rolldown-plugin-dts | 0.23.2 | indirekt |
| npm | router | 2.2.0 | indirekt |
| npm | run-applescript | 7.1.0 | indirekt |
| npm | safe-buffer | 5.2.1 | indirekt |
| npm | safe-stable-stringify | 2.5.0 | indirekt |
| npm | safer-buffer | 2.1.2 | indirekt |
| npm | secure-json-parse | 4.0.0 | indirekt |
| npm | semver | 7.7.4 | indirekt |
| npm | semver | 7.8.0 | indirekt |
| npm | send | 1.2.1 | indirekt |
| npm | serve-static | 2.2.1 | indirekt |
| npm | setprototypeof | 1.2.0 | indirekt |
| npm | shebang-command | 2.0.0 | indirekt |
| npm | shebang-regex | 3.0.0 | indirekt |
| npm | side-channel | 1.1.0 | indirekt |
| npm | side-channel-list | 1.0.0 | indirekt |
| npm | side-channel-map | 1.0.1 | indirekt |
| npm | side-channel-weakmap | 1.0.2 | indirekt |
| npm | siginfo | 2.0.0 | indirekt |
| npm | signal-exit | 4.1.0 | indirekt |
| npm | slow-redact | 0.3.2 | indirekt |
| npm | smart-buffer | 4.2.0 | indirekt |
| npm | socks | 2.8.9 | indirekt |
| npm | socks-proxy-agent | 9.0.0 | indirekt |
| npm | sonic-boom | 4.2.0 | indirekt |
| npm | source-map | 0.6.1 | indirekt |
| npm | source-map-js | 1.2.1 | indirekt |
| npm | spdx-correct | 3.2.0 | indirekt |
| npm | spdx-exceptions | 2.5.0 | indirekt |
| npm | spdx-expression-parse | 3.0.1 | indirekt |
| npm | spdx-license-ids | 3.0.23 | indirekt |
| npm | split2 | 4.2.0 | indirekt |
| npm | stackback | 0.0.2 | indirekt |
| npm | statuses | 2.0.2 | indirekt |
| npm | std-env | 4.1.0 | indirekt |
| npm | stdin-discarder | 0.3.2 | indirekt |
| npm | string-width | 8.2.1 | indirekt |
| npm | string_decoder | 1.3.0 | indirekt |
| npm | strip-ansi | 7.2.0 | indirekt |
| npm | strip-json-comments | 5.0.3 | indirekt |
| npm | thread-stream | 3.1.0 | indirekt |
| npm | tinybench | 2.9.0 | indirekt |
| npm | tinyexec | 1.1.2 | indirekt |
| npm | tinyglobby | 0.2.15 | indirekt |
| npm | tinyglobby | 0.2.16 | indirekt |
| npm | tinyglobby | 0.2.17 | indirekt |
| npm | tinyrainbow | 3.1.0 | indirekt |
| npm | toidentifier | 1.0.1 | indirekt |
| npm | tree-kill | 1.2.2 | indirekt |
| npm | tsdown | 0.21.10 | indirekt |
| npm | tslib | 2.8.1 | indirekt |
| npm | type-fest | 2.19.0 | indirekt |
| npm | type-is | 2.0.1 | indirekt |
| npm | typedarray | 0.0.6 | indirekt |
| npm | typescript | 5.9.3 | indirekt |
| npm | uglify-js | 3.19.3 | indirekt |
| npm | unconfig-core | 7.5.0 | indirekt |
| npm | undici | 7.28.0 | indirekt |
| npm | undici-types | 6.21.0 | indirekt |
| npm | universal-user-agent | 7.0.3 | indirekt |
| npm | unpipe | 1.0.0 | indirekt |
| npm | unrun | 0.2.39 | indirekt |
| npm | url-join | 5.0.0 | indirekt |
| npm | util-deprecate | 1.0.2 | indirekt |
| npm | validate-npm-package-license | 3.0.4 | indirekt |
| npm | vary | 1.1.2 | indirekt |
| npm | vite | 8.0.16 | indirekt |
| npm | vitest | 4.1.0 | indirekt |
| npm | walk-up-path | 4.0.0 | indirekt |
| npm | which | 2.0.2 | indirekt |
| npm | why-is-node-running | 2.3.0 | indirekt |
| npm | wildcard-match | 5.1.4 | indirekt |
| npm | windows-release | 7.1.1 | indirekt |
| npm | wordwrap | 1.0.0 | indirekt |
| npm | wrappy | 1.0.2 | indirekt |
| npm | wsl-utils | 0.3.1 | indirekt |
| npm | yargs-parser | 22.0.0 | indirekt |
| npm | yoctocolors | 2.1.2 | indirekt |
| npm | zod-to-json-schema | 3.25.1 | indirekt |
Die Installation von npm:@currents/mcp@2.3.3 zieht 122 Pakete nach sich, direkt und transitiv: 0 tragen bekannte Advisories, davon 0 direkte Abhängigkeiten.
Keine bekannten Advisories betreffen die bewerteten Abhängigkeiten.
Ein Advisory bedeutet, dass die im Abhängigkeitsgraphen erfasste Version in den betroffenen Bereich eines Advisories fällt. Erreichbarkeit wird nicht analysiert, und der Graph enthält Entwicklungs- und Test-Pins — ein Fund kann das Werkzeug betreffen und nicht die ausgelieferte Software.
{
"data": {
"repo": {
"topics": [
"ai",
"currents",
"mcp",
"playwright"
],
"is_fork": false,
"size_kb": 1482,
"has_wiki": true,
"homepage": "https://currents.dev",
"languages": {
"Shell": 220,
"Dockerfile": 1403,
"JavaScript": 10626,
"TypeScript": 157323
},
"pushed_at": "2026-07-16T14:30:48Z",
"created_at": "2025-04-02T18:56:01Z",
"owner_type": "Organization",
"updated_at": "2026-07-14T06:16:11Z",
"description": "Currents MCP Server",
"is_archived": false,
"is_disabled": false,
"license_spdx": "Apache-2.0",
"default_branch": "main",
"license_spdx_raw": "Apache-2.0",
"primary_language": "TypeScript",
"significant_languages": [
"TypeScript"
]
},
"owner": {
"blog": "https://currents.dev",
"name": "Currents.dev",
"type": "Organization",
"login": "currents-dev",
"company": null,
"location": "Canada",
"followers": 58,
"avatar_url": "https://avatars.githubusercontent.com/u/81007196?v=4",
"created_at": "2021-03-20T07:12:37Z",
"is_verified": null,
"public_repos": 57,
"account_age_days": 1948
},
"license": {
"state": "standard",
"spdx_id": "Apache-2.0",
"raw_spdx": "Apache-2.0",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 7,
"commits_last_year": 208,
"latest_release_at": "2026-05-19T01:39:01Z",
"latest_release_tag": "v2.3.1",
"releases_from_tags": false,
"days_since_last_push": 4,
"active_weeks_last_year": 36,
"days_since_latest_release": 62,
"mean_days_between_releases": 40.6
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 37,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "@currents/mcp",
"exists": true,
"license": "Apache-2.0",
"keywords": [
"currents",
"mcp-server",
"playwright",
"dashboard",
"reporting"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/@currents/mcp",
"is_deprecated": false,
"latest_version": "2.3.3",
"repository_url": "https://github.com/currents-dev/currents-mcp",
"versions_count": 35,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 3,
"monthly_downloads": 78006,
"first_published_at": "2025-04-03T22:41:14.323000Z",
"latest_published_at": "2026-06-15T11:52:35.970000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 35
}
]
},
"popularity": {
"forks": 14,
"stars": 17,
"watchers": 2,
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": true,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"mcp-server/tsconfig.json"
],
"largest_source_bytes": 18905,
"source_files_sampled": 70,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"mcp-server/package.json"
],
"advisories": {
"error": null,
"scope": "published_package",
"source": "osv",
"findings": [],
"collected": true,
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 122,
"assessed_package": "npm:@currents/mcp@2.3.3",
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm"
],
"dependencies": [
{
"name": "@modelcontextprotocol/sdk",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^1.28.0"
},
{
"name": "commander",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^12.1.0"
},
{
"name": "pino",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^9.9.5"
},
{
"name": "pino-pretty",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^13.1.1"
},
{
"name": "zod",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^4.3.5"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "@modelcontextprotocol/sdk",
"direct": true,
"version": "1.28.0",
"ecosystem": "npm"
},
{
"name": "commander",
"direct": true,
"version": "12.1.0",
"ecosystem": "npm"
},
{
"name": "pino",
"direct": true,
"version": "9.13.1",
"ecosystem": "npm"
},
{
"name": "pino-pretty",
"direct": true,
"version": "13.1.1",
"ecosystem": "npm"
},
{
"name": "zod",
"direct": true,
"version": "4.3.5",
"ecosystem": "npm"
},
{
"name": "@babel/generator",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@babel/helper-string-parser",
"direct": false,
"version": "8.0.0-rc.5",
"ecosystem": "npm"
},
{
"name": "@babel/helper-validator-identifier",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@babel/parser",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@babel/types",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@conventional-changelog/git-client",
"direct": false,
"version": "2.7.0",
"ecosystem": "npm"
},
{
"name": "@emnapi/core",
"direct": false,
"version": "1.10.0",
"ecosystem": "npm"
},
{
"name": "@emnapi/runtime",
"direct": false,
"version": "1.10.0",
"ecosystem": "npm"
},
{
"name": "@emnapi/wasi-threads",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "@hono/node-server",
"direct": false,
"version": "1.19.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/ansi",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/checkbox",
"direct": false,
"version": "5.1.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/confirm",
"direct": false,
"version": "6.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/core",
"direct": false,
"version": "11.1.10",
"ecosystem": "npm"
},
{
"name": "@inquirer/editor",
"direct": false,
"version": "5.1.2",
"ecosystem": "npm"
},
{
"name": "@inquirer/expand",
"direct": false,
"version": "5.0.14",
"ecosystem": "npm"
},
{
"name": "@inquirer/external-editor",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "@inquirer/figures",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/input",
"direct": false,
"version": "5.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/number",
"direct": false,
"version": "4.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/password",
"direct": false,
"version": "5.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/prompts",
"direct": false,
"version": "8.4.2",
"ecosystem": "npm"
},
{
"name": "@inquirer/rawlist",
"direct": false,
"version": "5.2.9",
"ecosystem": "npm"
},
{
"name": "@inquirer/search",
"direct": false,
"version": "4.1.9",
"ecosystem": "npm"
},
{
"name": "@inquirer/select",
"direct": false,
"version": "5.1.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/type",
"direct": false,
"version": "4.0.5",
"ecosystem": "npm"
},
{
"name": "@jridgewell/gen-mapping",
"direct": false,
"version": "0.3.13",
"ecosystem": "npm"
},
{
"name": "@jridgewell/resolve-uri",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "@jridgewell/sourcemap-codec",
"direct": false,
"version": "1.5.5",
"ecosystem": "npm"
},
{
"name": "@jridgewell/trace-mapping",
"direct": false,
"version": "0.3.31",
"ecosystem": "npm"
},
{
"name": "@napi-rs/wasm-runtime",
"direct": false,
"version": "1.1.4",
"ecosystem": "npm"
},
{
"name": "@octokit/auth-token",
"direct": false,
"version": "6.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/core",
"direct": false,
"version": "7.0.6",
"ecosystem": "npm"
},
{
"name": "@octokit/endpoint",
"direct": false,
"version": "11.0.2",
"ecosystem": "npm"
},
{
"name": "@octokit/graphql",
"direct": false,
"version": "9.0.3",
"ecosystem": "npm"
},
{
"name": "@octokit/openapi-types",
"direct": false,
"version": "27.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/plugin-paginate-rest",
"direct": false,
"version": "14.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/plugin-request-log",
"direct": false,
"version": "6.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/plugin-rest-endpoint-methods",
"direct": false,
"version": "17.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/request",
"direct": false,
"version": "10.0.7",
"ecosystem": "npm"
},
{
"name": "@octokit/request-error",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "@octokit/rest",
"direct": false,
"version": "22.0.1",
"ecosystem": "npm"
},
{
"name": "@octokit/types",
"direct": false,
"version": "16.0.0",
"ecosystem": "npm"
},
{
"name": "@oxc-project/types",
"direct": false,
"version": "0.127.0",
"ecosystem": "npm"
},
{
"name": "@oxc-project/types",
"direct": false,
"version": "0.133.0",
"ecosystem": "npm"
},
{
"name": "@phun-ky/typeof",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "@quansync/fs",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "@release-it/conventional-changelog",
"direct": false,
"version": "11.0.0",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-android-arm64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-android-arm64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-arm64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-arm64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-x64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-x64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-freebsd-x64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-freebsd-x64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm-gnueabihf",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm-gnueabihf",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-musl",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-musl",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-ppc64-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-ppc64-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-s390x-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-s390x-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-musl",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-musl",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-openharmony-arm64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-openharmony-arm64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-wasm32-wasi",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-wasm32-wasi",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-arm64-msvc",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-arm64-msvc",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-x64-msvc",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-x64-msvc",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/pluginutils",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/pluginutils",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "@simple-libs/child-process-utils",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "@simple-libs/hosted-git-info",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "@simple-libs/stream-utils",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "@standard-schema/spec",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "@tybys/wasm-util",
"direct": false,
"version": "0.10.2",
"ecosystem": "npm"
},
{
"name": "@types/chai",
"direct": false,
"version": "5.2.3",
"ecosystem": "npm"
},
{
"name": "@types/deep-eql",
"direct": false,
"version": "4.0.2",
"ecosystem": "npm"
},
{
"name": "@types/estree",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "@types/jsesc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@types/node",
"direct": false,
"version": "20.19.37",
"ecosystem": "npm"
},
{
"name": "@types/node",
"direct": false,
"version": "22.19.15",
"ecosystem": "npm"
},
{
"name": "@types/normalize-package-data",
"direct": false,
"version": "2.4.4",
"ecosystem": "npm"
},
{
"name": "@types/parse-path",
"direct": false,
"version": "7.0.3",
"ecosystem": "npm"
},
{
"name": "@vitest/expect",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/mocker",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/pretty-format",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/runner",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/snapshot",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/spy",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/utils",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "accepts",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "agent-base",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "ajv",
"direct": false,
"version": "8.18.0",
"ecosystem": "npm"
},
{
"name": "ajv-formats",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "ansi-regex",
"direct": false,
"version": "6.2.2",
"ecosystem": "npm"
},
{
"name": "ansis",
"direct": false,
"version": "4.3.0",
"ecosystem": "npm"
},
{
"name": "array-ify",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "assertion-error",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "ast-kit",
"direct": false,
"version": "3.0.0-beta.1",
"ecosystem": "npm"
},
{
"name": "ast-types",
"direct": false,
"version": "0.13.4",
"ecosystem": "npm"
},
{
"name": "async-retry",
"direct": false,
"version": "1.3.3",
"ecosystem": "npm"
},
{
"name": "atomic-sleep",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "basic-ftp",
"direct": false,
"version": "5.3.1",
"ecosystem": "npm"
},
{
"name": "before-after-hook",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "birpc",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "body-parser",
"direct": false,
"version": "2.2.2",
"ecosystem": "npm"
},
{
"name": "buffer-from",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "bundle-name",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "bytes",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "c12",
"direct": false,
"version": "3.3.3",
"ecosystem": "npm"
},
{
"name": "cac",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "call-bind-apply-helpers",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "call-bound",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "chai",
"direct": false,
"version": "6.2.2",
"ecosystem": "npm"
},
{
"name": "chalk",
"direct": false,
"version": "5.6.2",
"ecosystem": "npm"
},
{
"name": "chardet",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "chokidar",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "ci-info",
"direct": false,
"version": "4.4.0",
"ecosystem": "npm"
},
{
"name": "citty",
"direct": false,
"version": "0.1.6",
"ecosystem": "npm"
},
{
"name": "citty",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "cli-cursor",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "cli-spinners",
"direct": false,
"version": "3.4.0",
"ecosystem": "npm"
},
{
"name": "cli-width",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "colorette",
"direct": false,
"version": "2.0.20",
"ecosystem": "npm"
},
{
"name": "compare-func",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "concat-stream",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "confbox",
"direct": false,
"version": "0.2.2",
"ecosystem": "npm"
},
{
"name": "consola",
"direct": false,
"version": "3.4.2",
"ecosystem": "npm"
},
{
"name": "content-disposition",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "content-type",
"direct": false,
"version": "1.0.5",
"ecosystem": "npm"
},
{
"name": "conventional-changelog",
"direct": false,
"version": "7.2.0",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-angular",
"direct": false,
"version": "8.3.1",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-conventionalcommits",
"direct": false,
"version": "9.3.1",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-preset-loader",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-writer",
"direct": false,
"version": "8.4.0",
"ecosystem": "npm"
},
{
"name": "conventional-commits-filter",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "conventional-commits-parser",
"direct": false,
"version": "6.4.0",
"ecosystem": "npm"
},
{
"name": "conventional-recommended-bump",
"direct": false,
"version": "11.2.0",
"ecosystem": "npm"
},
{
"name": "convert-source-map",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "cookie",
"direct": false,
"version": "0.7.2",
"ecosystem": "npm"
},
{
"name": "cookie-signature",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "cors",
"direct": false,
"version": "2.8.5",
"ecosystem": "npm"
},
{
"name": "cross-spawn",
"direct": false,
"version": "7.0.6",
"ecosystem": "npm"
},
{
"name": "data-uri-to-buffer",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "dateformat",
"direct": false,
"version": "4.6.3",
"ecosystem": "npm"
},
{
"name": "debug",
"direct": false,
"version": "4.4.3",
"ecosystem": "npm"
},
{
"name": "default-browser",
"direct": false,
"version": "5.5.0",
"ecosystem": "npm"
},
{
"name": "default-browser-id",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "define-lazy-prop",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "defu",
"direct": false,
"version": "6.1.7",
"ecosystem": "npm"
},
{
"name": "degenerator",
"direct": false,
"version": "6.0.0",
"ecosystem": "npm"
},
{
"name": "depd",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "destr",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "detect-libc",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "dot-prop",
"direct": false,
"version": "5.3.0",
"ecosystem": "npm"
},
{
"name": "dotenv",
"direct": false,
"version": "17.2.3",
"ecosystem": "npm"
},
{
"name": "dts-resolver",
"direct": false,
"version": "2.1.3",
"ecosystem": "npm"
},
{
"name": "dunder-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "ee-first",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "empathic",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "encodeurl",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "end-of-stream",
"direct": false,
"version": "1.4.5",
"ecosystem": "npm"
},
{
"name": "es-define-property",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "es-errors",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "es-module-lexer",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "es-object-atoms",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "escape-html",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "escodegen",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "esprima",
"direct": false,
"version": "4.0.1",
"ecosystem": "npm"
},
{
"name": "estraverse",
"direct": false,
"version": "5.3.0",
"ecosystem": "npm"
},
{
"name": "estree-walker",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "esutils",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "eta",
"direct": false,
"version": "4.5.1",
"ecosystem": "npm"
},
{
"name": "etag",
"direct": false,
"version": "1.8.1",
"ecosystem": "npm"
},
{
"name": "eventsource",
"direct": false,
"version": "3.0.6",
"ecosystem": "npm"
},
{
"name": "eventsource-parser",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "expect-type",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "express",
"direct": false,
"version": "5.2.1",
"ecosystem": "npm"
},
{
"name": "express-rate-limit",
"direct": false,
"version": "8.5.1",
"ecosystem": "npm"
},
{
"name": "exsolve",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "fast-content-type-parse",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "fast-copy",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "fast-deep-equal",
"direct": false,
"version": "3.1.3",
"ecosystem": "npm"
},
{
"name": "fast-safe-stringify",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "fast-string-truncated-width",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "fast-string-width",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "fast-uri",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "fast-wrap-ansi",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "fd-package-json",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "fdir",
"direct": false,
"version": "6.5.0",
"ecosystem": "npm"
},
{
"name": "finalhandler",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "forwarded",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "fresh",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "fsevents",
"direct": false,
"version": "2.3.3",
"ecosystem": "npm"
},
{
"name": "function-bind",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "get-east-asian-width",
"direct": false,
"version": "1.6.0",
"ecosystem": "npm"
},
{
"name": "get-intrinsic",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "get-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "get-tsconfig",
"direct": false,
"version": "4.14.0",
"ecosystem": "npm"
},
{
"name": "get-uri",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "giget",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "git-up",
"direct": false,
"version": "8.1.1",
"ecosystem": "npm"
},
{
"name": "git-url-parse",
"direct": false,
"version": "16.1.0",
"ecosystem": "npm"
},
{
"name": "gopd",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "handlebars",
"direct": false,
"version": "4.7.9",
"ecosystem": "npm"
},
{
"name": "has-symbols",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "hasown",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "help-me",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "hono",
"direct": false,
"version": "4.12.26",
"ecosystem": "npm"
},
{
"name": "hookable",
"direct": false,
"version": "6.1.1",
"ecosystem": "npm"
},
{
"name": "hosted-git-info",
"direct": false,
"version": "8.1.0",
"ecosystem": "npm"
},
{
"name": "http-errors",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "http-proxy-agent",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "https-proxy-agent",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "iconv-lite",
"direct": false,
"version": "0.7.2",
"ecosystem": "npm"
},
{
"name": "import-without-cache",
"direct": false,
"version": "0.3.3",
"ecosystem": "npm"
},
{
"name": "inherits",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "ip-address",
"direct": false,
"version": "10.2.0",
"ecosystem": "npm"
},
{
"name": "ipaddr.js",
"direct": false,
"version": "1.9.1",
"ecosystem": "npm"
},
{
"name": "is-docker",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "is-in-ssh",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "is-inside-container",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "is-interactive",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "is-obj",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "is-promise",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "is-ssh",
"direct": false,
"version": "1.4.1",
"ecosystem": "npm"
},
{
"name": "is-unicode-supported",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "is-wsl",
"direct": false,
"version": "3.1.1",
"ecosystem": "npm"
},
{
"name": "isexe",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "issue-parser",
"direct": false,
"version": "7.0.1",
"ecosystem": "npm"
},
{
"name": "jiti",
"direct": false,
"version": "2.6.1",
"ecosystem": "npm"
},
{
"name": "jose",
"direct": false,
"version": "6.1.3",
"ecosystem": "npm"
},
{
"name": "joycon",
"direct": false,
"version": "3.1.1",
"ecosystem": "npm"
},
{
"name": "jsesc",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "json-schema-traverse",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "json-schema-typed",
"direct": false,
"version": "8.0.2",
"ecosystem": "npm"
},
{
"name": "lightningcss",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-android-arm64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-arm64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-x64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-freebsd-x64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm-gnueabihf",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-gnu",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-musl",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-gnu",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-musl",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-arm64-msvc",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-x64-msvc",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lodash.capitalize",
"direct": false,
"version": "4.2.1",
"ecosystem": "npm"
},
{
"name": "lodash.escaperegexp",
"direct": false,
"version": "4.1.2",
"ecosystem": "npm"
},
{
"name": "lodash.isplainobject",
"direct": false,
"version": "4.0.6",
"ecosystem": "npm"
},
{
"name": "lodash.isstring",
"direct": false,
"version": "4.0.1",
"ecosystem": "npm"
},
{
"name": "lodash.merge",
"direct": false,
"version": "4.6.2",
"ecosystem": "npm"
},
{
"name": "lodash.uniqby",
"direct": false,
"version": "4.7.0",
"ecosystem": "npm"
},
{
"name": "log-symbols",
"direct": false,
"version": "7.0.1",
"ecosystem": "npm"
},
{
"name": "lru-cache",
"direct": false,
"version": "10.4.3",
"ecosystem": "npm"
},
{
"name": "lru-cache",
"direct": false,
"version": "7.18.3",
"ecosystem": "npm"
},
{
"name": "macos-release",
"direct": false,
"version": "3.4.0",
"ecosystem": "npm"
},
{
"name": "magic-string",
"direct": false,
"version": "0.30.21",
"ecosystem": "npm"
},
{
"name": "math-intrinsics",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "media-typer",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "meow",
"direct": false,
"version": "13.2.0",
"ecosystem": "npm"
},
{
"name": "merge-descriptors",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "mime-db",
"direct": false,
"version": "1.54.0",
"ecosystem": "npm"
},
{
"name": "mime-types",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "mimic-function",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "minimist",
"direct": false,
"version": "1.2.8",
"ecosystem": "npm"
},
{
"name": "ms",
"direct": false,
"version": "2.1.3",
"ecosystem": "npm"
},
{
"name": "mute-stream",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "nanoid",
"direct": false,
"version": "3.3.12",
"ecosystem": "npm"
},
{
"name": "negotiator",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "neo-async",
"direct": false,
"version": "2.6.2",
"ecosystem": "npm"
},
{
"name": "netmask",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "new-github-release-url",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "node-fetch-native",
"direct": false,
"version": "1.6.7",
"ecosystem": "npm"
},
{
"name": "normalize-package-data",
"direct": false,
"version": "7.0.1",
"ecosystem": "npm"
},
{
"name": "nypm",
"direct": false,
"version": "0.6.4",
"ecosystem": "npm"
},
{
"name": "object-assign",
"direct": false,
"version": "4.1.1",
"ecosystem": "npm"
},
{
"name": "object-inspect",
"direct": false,
"version": "1.13.4",
"ecosystem": "npm"
},
{
"name": "obug",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "ohash",
"direct": false,
"version": "2.0.11",
"ecosystem": "npm"
},
{
"name": "on-exit-leak-free",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "on-finished",
"direct": false,
"version": "2.4.1",
"ecosystem": "npm"
},
{
"name": "once",
"direct": false,
"version": "1.4.0",
"ecosystem": "npm"
},
{
"name": "onetime",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "open",
"direct": false,
"version": "11.0.0",
"ecosystem": "npm"
},
{
"name": "ora",
"direct": false,
"version": "9.3.0",
"ecosystem": "npm"
},
{
"name": "os-name",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "pac-proxy-agent",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "pac-resolver",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "parse-path",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "parse-url",
"direct": false,
"version": "9.2.0",
"ecosystem": "npm"
},
{
"name": "parseurl",
"direct": false,
"version": "1.3.3",
"ecosystem": "npm"
},
{
"name": "path-key",
"direct": false,
"version": "3.1.1",
"ecosystem": "npm"
},
{
"name": "path-to-regexp",
"direct": false,
"version": "8.4.0",
"ecosystem": "npm"
},
{
"name": "pathe",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "perfect-debounce",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "picocolors",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "picomatch",
"direct": false,
"version": "4.0.4",
"ecosystem": "npm"
},
{
"name": "pino-abstract-transport",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "pino-std-serializers",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "pkce-challenge",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "pkg-types",
"direct": false,
"version": "2.3.0",
"ecosystem": "npm"
},
{
"name": "postcss",
"direct": false,
"version": "8.5.15",
"ecosystem": "npm"
},
{
"name": "powershell-utils",
"direct": false,
"version": "0.1.0",
"ecosystem": "npm"
},
{
"name": "powershell-utils",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "process-warning",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "protocols",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "proxy-addr",
"direct": false,
"version": "2.0.7",
"ecosystem": "npm"
},
{
"name": "proxy-agent",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "proxy-from-env",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "pump",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "qs",
"direct": false,
"version": "6.15.2",
"ecosystem": "npm"
},
{
"name": "quansync",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "quick-format-unescaped",
"direct": false,
"version": "4.0.4",
"ecosystem": "npm"
},
{
"name": "quickjs-wasi",
"direct": false,
"version": "0.0.1",
"ecosystem": "npm"
},
{
"name": "range-parser",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "raw-body",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "rc9",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "readable-stream",
"direct": false,
"version": "3.6.2",
"ecosystem": "npm"
},
{
"name": "readdirp",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "real-require",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "release-it",
"direct": false,
"version": "20.2.1",
"ecosystem": "npm"
},
{
"name": "require-from-string",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "resolve-pkg-maps",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "restore-cursor",
"direct": false,
"version": "5.1.0",
"ecosystem": "npm"
},
{
"name": "retry",
"direct": false,
"version": "0.13.1",
"ecosystem": "npm"
},
{
"name": "rolldown",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "rolldown",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "rolldown-plugin-dts",
"direct": false,
"version": "0.23.2",
"ecosystem": "npm"
},
{
"name": "router",
"direct": false,
"version": "2.2.0",
"ecosystem": "npm"
},
{
"name": "run-applescript",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "safe-buffer",
"direct": false,
"version": "5.2.1",
"ecosystem": "npm"
},
{
"name": "safe-stable-stringify",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "safer-buffer",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "secure-json-parse",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "semver",
"direct": false,
"version": "7.7.4",
"ecosystem": "npm"
},
{
"name": "semver",
"direct": false,
"version": "7.8.0",
"ecosystem": "npm"
},
{
"name": "send",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "serve-static",
"direct": false,
"version": "2.2.1",
"ecosystem": "npm"
},
{
"name": "setprototypeof",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "shebang-command",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "shebang-regex",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "side-channel",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "side-channel-list",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "side-channel-map",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "side-channel-weakmap",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "siginfo",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "signal-exit",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "slow-redact",
"direct": false,
"version": "0.3.2",
"ecosystem": "npm"
},
{
"name": "smart-buffer",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "socks",
"direct": false,
"version": "2.8.9",
"ecosystem": "npm"
},
{
"name": "socks-proxy-agent",
"direct": false,
"version": "9.0.0",
"ecosystem": "npm"
},
{
"name": "sonic-boom",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "source-map",
"direct": false,
"version": "0.6.1",
"ecosystem": "npm"
},
{
"name": "source-map-js",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "spdx-correct",
"direct": false,
"version": "3.2.0",
"ecosystem": "npm"
},
{
"name": "spdx-exceptions",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "spdx-expression-parse",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "spdx-license-ids",
"direct": false,
"version": "3.0.23",
"ecosystem": "npm"
},
{
"name": "split2",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "stackback",
"direct": false,
"version": "0.0.2",
"ecosystem": "npm"
},
{
"name": "statuses",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "std-env",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "stdin-discarder",
"direct": false,
"version": "0.3.2",
"ecosystem": "npm"
},
{
"name": "string-width",
"direct": false,
"version": "8.2.1",
"ecosystem": "npm"
},
{
"name": "string_decoder",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "strip-ansi",
"direct": false,
"version": "7.2.0",
"ecosystem": "npm"
},
{
"name": "strip-json-comments",
"direct": false,
"version": "5.0.3",
"ecosystem": "npm"
},
{
"name": "thread-stream",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "tinybench",
"direct": false,
"version": "2.9.0",
"ecosystem": "npm"
},
{
"name": "tinyexec",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "tinyglobby",
"direct": false,
"version": "0.2.15",
"ecosystem": "npm"
},
{
"name": "tinyglobby",
"direct": false,
"version": "0.2.16",
"ecosystem": "npm"
},
{
"name": "tinyglobby",
"direct": false,
"version": "0.2.17",
"ecosystem": "npm"
},
{
"name": "tinyrainbow",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "toidentifier",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "tree-kill",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "tsdown",
"direct": false,
"version": "0.21.10",
"ecosystem": "npm"
},
{
"name": "tslib",
"direct": false,
"version": "2.8.1",
"ecosystem": "npm"
},
{
"name": "type-fest",
"direct": false,
"version": "2.19.0",
"ecosystem": "npm"
},
{
"name": "type-is",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "typedarray",
"direct": false,
"version": "0.0.6",
"ecosystem": "npm"
},
{
"name": "typescript",
"direct": false,
"version": "5.9.3",
"ecosystem": "npm"
},
{
"name": "uglify-js",
"direct": false,
"version": "3.19.3",
"ecosystem": "npm"
},
{
"name": "unconfig-core",
"direct": false,
"version": "7.5.0",
"ecosystem": "npm"
},
{
"name": "undici",
"direct": false,
"version": "7.28.0",
"ecosystem": "npm"
},
{
"name": "undici-types",
"direct": false,
"version": "6.21.0",
"ecosystem": "npm"
},
{
"name": "universal-user-agent",
"direct": false,
"version": "7.0.3",
"ecosystem": "npm"
},
{
"name": "unpipe",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "unrun",
"direct": false,
"version": "0.2.39",
"ecosystem": "npm"
},
{
"name": "url-join",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "util-deprecate",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "validate-npm-package-license",
"direct": false,
"version": "3.0.4",
"ecosystem": "npm"
},
{
"name": "vary",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "vite",
"direct": false,
"version": "8.0.16",
"ecosystem": "npm"
},
{
"name": "vitest",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "walk-up-path",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "which",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "why-is-node-running",
"direct": false,
"version": "2.3.0",
"ecosystem": "npm"
},
{
"name": "wildcard-match",
"direct": false,
"version": "5.1.4",
"ecosystem": "npm"
},
{
"name": "windows-release",
"direct": false,
"version": "7.1.1",
"ecosystem": "npm"
},
{
"name": "wordwrap",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "wrappy",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "wsl-utils",
"direct": false,
"version": "0.3.1",
"ecosystem": "npm"
},
{
"name": "yargs-parser",
"direct": false,
"version": "22.0.0",
"ecosystem": "npm"
},
{
"name": "yoctocolors",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "zod-to-json-schema",
"direct": false,
"version": "3.25.1",
"ecosystem": "npm"
}
],
"collected": true,
"truncated": false,
"total_count": 423,
"direct_count": 5,
"indirect_count": 418
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 106,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 43
},
"bus_factor": 4,
"top_contributors": [
{
"type": "User",
"login": "agoldis",
"commits": 47,
"avatar_url": "https://avatars.githubusercontent.com/u/1637928?v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 38,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "User",
"login": "miguelangaranocurrents",
"commits": 29,
"avatar_url": "https://avatars.githubusercontent.com/u/140348970?v=4"
},
{
"type": "User",
"login": "ynahmany",
"commits": 26,
"avatar_url": "https://avatars.githubusercontent.com/u/7278548?v=4"
},
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 24,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
},
{
"type": "User",
"login": "miguelangarano",
"commits": 23,
"avatar_url": "https://avatars.githubusercontent.com/u/26367577?v=4"
},
{
"type": "User",
"login": "waltergalvao",
"commits": 20,
"avatar_url": "https://avatars.githubusercontent.com/u/1367578?v=4"
},
{
"type": "User",
"login": "cursoragent",
"commits": 6,
"avatar_url": "https://avatars.githubusercontent.com/u/199161495?v=4"
},
{
"type": "User",
"login": "maxigimenez",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/1178139?v=4"
},
{
"type": "User",
"login": "calclavia",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/1828968?v=4"
}
],
"contributors_sampled": 15,
"top_contributor_share": 0.205
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"auto-pr-parity-branch.yaml",
"dependabot-review.yml",
"linear-release.yaml",
"parity-pr-merged.yaml",
"post-release.yaml",
"promote.yaml",
"publish.yaml",
"release.yaml",
"test.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 10,
"reason": "17 out of 17 merged PRs checked by a CI test -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 4,
"reason": "Found 4/9 approved changesets -- score normalized to 4",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 3,
"reason": "project has 1 contributing companies or organizations -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 0,
"reason": "dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 2,
"reason": "dependency not pinned by hash detected -- score normalized to 2",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "3e76b01b7b5b14140c9845db65206de4a307153d",
"ran_at": "2026-07-20T22:03:48Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/currents-dev/currents-mcp",
"host": "github.com",
"name": "currents-mcp",
"owner": "currents-dev"
},
"metrics": {
"overall": {
"key": "overall",
"band": "good",
"name": "Overall health",
"note": null,
"notes": [],
"value": 71,
"inputs": {
"security": 60,
"vitality": 93,
"community": 50,
"governance": 75,
"engineering": 71
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 93,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 89,
"inputs": {
"commits_last_year": 208,
"human_commit_share": null,
"days_since_last_push": 4,
"active_weeks_last_year": 36
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "36/52 weeks with commits",
"points": 24.9,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 36
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "208 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 208
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 100,
"inputs": {
"releases_count": 7,
"latest_release_tag": "v2.3.1",
"releases_from_tags": false,
"days_since_latest_release": 62,
"mean_days_between_releases": 40.6
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "7 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 7
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 62 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 62
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~40.6 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 40.6
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 50,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 29,
"inputs": {
"forks": 14,
"stars": 17,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "17 stars",
"points": 19.5,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 17
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "14 forks",
"points": 9.3,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 14
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (Apache-2.0)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "Apache-2.0"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "good",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 82,
"inputs": {
"packages": [
"@currents/mcp"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 78006
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "78,006 downloads/month across npm",
"points": 65.2,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 78006,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "good",
"name": "Sustainability & Governance",
"value": 75,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "good",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 78,
"inputs": {
"bus_factor": 4,
"contributors_sampled": 15,
"top_contributor_share": 0.205
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "4 contributor(s) cover half of all commits",
"points": 43.2,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 4
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 20% of commits",
"points": 17.9,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 20
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "15 contributors",
"points": 13.5,
"status": "met",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 15
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 62,
"inputs": {
"merged_prs": 106,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 43
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "106/149 decided PRs merged",
"points": 27.2,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 106,
"decided": 149
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 4/9 approved changesets -- score normalized to 4",
"points": 6,
"status": "partial",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 66,
"inputs": {
"followers": 58,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "currents-dev",
"public_repos": 57,
"account_age_days": 1948
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "58 followers of currents-dev",
"points": 12.7,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 58,
"login": "currents-dev"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "57 public repos, account ~5 yr old",
"points": 23.5,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 57
}
},
{
"code": "account_age_years",
"params": {
"years": 5
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"@currents/mcp"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 35
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 35 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 35
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "35 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 35
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "good",
"name": "Engineering Quality",
"value": 71,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 68,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "9 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 9
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "17 out of 17 merged PRs checked by a CI test -- score normalized to 10",
"points": 20,
"status": "met",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [
"ai",
"currents",
"mcp",
"playwright"
],
"has_wiki": true,
"homepage": "https://currents.dev",
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://currents.dev",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "4 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 4
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 60,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "17 out of 17 merged PRs checked by a CI test -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 4/9 approved changesets -- score normalized to 4",
"points": 3,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "dangerous workflow patterns detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 2",
"points": 1,
"status": "partial",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "dependency_advisories",
"band": "excellent",
"name": "Dependency advisories",
"note": "Excluded from scoring (no data or not applicable): No advisories left outstanding. Remaining weights renormalized. Matched the npm:@currents/mcp@2.3.3 runtime dependency closure — what installing the published package pulls in — 122 packages. Reachability is not analyzed.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"no_advisories_left_outstanding"
]
}
},
{
"code": "weights_renormalized",
"params": {}
},
{
"code": "advisories_scope_published",
"params": {
"package": "npm:@currents/mcp@2.3.3",
"assessed": 122
}
},
{
"code": "advisories_reachability",
"params": {}
}
],
"value": 100,
"inputs": {
"source": "osv",
"advisories": 0,
"affected_packages": 0,
"assessed_packages": 122,
"unassessed_packages": 0,
"affected_by_severity": "none",
"direct_affected_packages": 0
},
"components": [
{
"key": "direct_dependencies_free_of_known_advisories",
"name": "Direct dependencies free of known advisories",
"detail": "no direct dependency carries a known advisory",
"points": 35,
"status": "met",
"details": [
{
"code": "no_direct_advisories",
"params": {}
}
],
"max_points": 35
},
{
"key": "indirect_dependencies_free_of_known_advisories",
"name": "Indirect dependencies free of known advisories",
"detail": "no indirect dependency carries a known advisory",
"points": 25,
"status": "met",
"details": [
{
"code": "no_indirect_advisories",
"params": {}
}
],
"max_points": 25
},
{
"key": "no_advisories_left_outstanding",
"name": "No advisories left outstanding",
"detail": "no advisory carries a publication date",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_no_publication_date",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "malicious_dependencies",
"band": "excellent",
"name": "Malicious dependencies",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"source": "osv",
"meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
"packages": [],
"red_flag": false,
"assessed_packages": 122,
"malicious_packages": 0,
"direct_malicious_packages": 0,
"withdrawn_malicious_packages": 0,
"installable_malicious_packages": 0
},
"components": [
{
"key": "no_dependency_reported_as_a_malicious_package",
"name": "No dependency reported as a malicious package",
"detail": "no dependency is reported as a malicious package",
"points": 100,
"status": "met",
"details": [
{
"code": "no_malicious_dependencies",
"params": {}
}
],
"max_points": 100
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 5
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 40,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "moderate",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice",
"automated_maintenance"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 55,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": true,
"typed_language": true,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"mcp-server/tsconfig.json"
],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": null
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "mcp-server/tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "mcp-server/tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 2",
"points": 2,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "excellent",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"primary_language": "TypeScript",
"largest_source_bytes": 18905,
"source_files_sampled": 70,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "TypeScript (statically typed)",
"points": 45,
"status": "met",
"details": [
{
"code": "statically_typed_language",
"params": {
"language": "TypeScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/70 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 70,
"oversized": 0
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "critical",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 20,
"inputs": {
"example_dirs": [],
"has_mcp_signal": true,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 20,
"status": "met",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-20T22:04:11.454457Z",
"schema_version": "0.16.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/c/currents-dev/currents-mcp.svg",
"full_name": "currents-dev/currents-mcp",
"license_state": "standard",
"license_spdx": "Apache-2.0"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.16.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm.