Currents MCP Server
currents-dev/currents-mcp holds a health index of 71 out of 100, placing it in the Good band. It scores highest on Vitality (93/100) and lowest on AI Readiness (40/100). It was last updated 4 days ago. 4 contributors account for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | @currents/mcp | 2.3.3 | 78,006 | 35 | 35 days ago | currentsmcp-serverplaywrightdashboardreporting |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 4 days ago |
| 24.9/36 | Commit cadence — 36/52 weeks with commits |
| 18/18 | Commit volume — 208 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 208 |
| human_commit_share | — |
| days_since_last_push | 4 |
| active_weeks_last_year | 36 |
| 27/27 | Ships releases — 7 releases published |
| 36/36 | Release recency — latest release 62 days ago |
| 27/27 | Release cadence — a release every ~40.6 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 7 |
| latest_release_tag | v2.3.1 |
| releases_from_tags | no |
| days_since_latest_release | 62 |
| mean_days_between_releases | 40.6 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 19.5/60 | Stars — 17 stars |
| 9.3/25 | Forks — 14 forks |
| 0/15 | Watchers — 2 watchers |
| forks | 14 |
| stars | 17 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (Apache-2.0) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
| 65.2/80 | Monthly downloads — 78,006 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | @currents/mcp |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 78,006 |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 43.2/54 | Bus factor — 4 contributor(s) cover half of all commits |
| 17.9/22.5 | Commit distribution — top contributor authored 20% of commits |
| 13.5/13.5 | Contributor breadth — 15 contributors |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 4 |
| contributors_sampled | 15 |
| top_contributor_share | 0.205 |
| 0/46.8 | Issue resolution — no issues or no data |
| 27.2/38.3 | PR acceptance — 106/149 decided PRs merged |
| 6/15 | OpenSSF Scorecard: Code-Review — Found 4/9 approved changesets -- score normalized to 4 |
| merged_prs | 106 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 43 |
| 30/30 | Ownership backing — organization-owned |
| 0/20 | Verified domain |
| 12.7/25 | Owner reach — 58 followers of currents-dev |
| 23.5/25 | Track record — 57 public repos, account ~5 yr old |
| followers | 58 |
| owner_type | Organization |
| is_verified | — |
| owner_login | currents-dev |
| public_repos | 57 |
| account_age_days | 1,948 |
| 25/25 | Published & resolvable — 1 package(s) on npm |
| 35/35 | Publish recency — latest publish 35 days ago |
| 20/20 | Version history — 35 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | @currents/mcp |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 35 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 9 workflow(s) |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 17 out of 17 merged PRs checked by a CI test -- score normalized to 10 |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://currents.dev |
| 10/10 | Repository description |
| 10/10 | Topics — 4 topics |
| 10/10 | Wiki |
| topics | ai, currents, mcp, playwright |
| has_wiki | yes |
| homepage | https://currents.dev |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — no data |
| 2.5/2.5 | CI-Tests — 17 out of 17 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 3/7.5 | Code-Review — Found 4/9 approved changesets -- score normalized to 4 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 0/10 | Dangerous-Workflow — dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 1/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 25/25 | Indirect dependencies free of known advisories — no indirect dependency carries a known advisory |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
| source | osv |
| advisories | 0 |
| affected_packages | 0 |
| assessed_packages | 122 |
| unassessed_packages | 0 |
| affected_by_severity | none |
| direct_affected_packages | 0 |
How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 0/40 | Legible commit history — no data |
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — mcp-server/tsconfig.json |
| 10/10 | Reproducible environment — Dockerfile, lockfile |
| 0/10 | Demonstrated agent practice — no data |
| 0/8 | Automated maintenance — no data |
| 2/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
| has_nix | no |
| has_tests | yes |
| lockfiles | package-lock.json |
| has_dockerfile | yes |
| typed_language | yes |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | mcp-server/tsconfig.json |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 45/45 | Type-checkable code — TypeScript (statically typed) |
| 55/55 | Manageable file sizes — 0/70 source files over 60KB |
| primary_language | TypeScript |
| largest_source_bytes | 18,905 |
| source_files_sampled | 70 |
| oversized_source_files | 0 |
| 0/40 | API schema (OpenAPI/GraphQL/proto) |
| 20/20 | MCP server |
| 0/40 | Runnable examples |
| example_dirs | — |
| has_mcp_signal | yes |
| api_schema_files | — |
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/a | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 10 | CI-Tests | 17 out of 17 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 4 | Code-Review | Found 4/9 approved changesets -- score normalized to 4 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 0 | Dangerous-Workflow | dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 2 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 2 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| npm | @modelcontextprotocol/sdk | ^1.28.0 | mcp-server/package.json |
| npm | commander | ^12.1.0 | mcp-server/package.json |
| npm | pino | ^9.9.5 | mcp-server/package.json |
| npm | pino-pretty | ^13.1.1 | mcp-server/package.json |
| npm | zod | ^4.3.5 | mcp-server/package.json |
Full resolved dependency set from the GitHub dependency graph: 5 direct and 418 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | @modelcontextprotocol/sdk | 1.28.0 | direct |
| npm | commander | 12.1.0 | direct |
| npm | pino | 9.13.1 | direct |
| npm | pino-pretty | 13.1.1 | direct |
| npm | zod | 4.3.5 | direct |
| npm | @babel/generator | 8.0.0-rc.3 | indirect |
| npm | @babel/helper-string-parser | 8.0.0-rc.5 | indirect |
| npm | @babel/helper-validator-identifier | 8.0.0-rc.3 | indirect |
| npm | @babel/parser | 8.0.0-rc.3 | indirect |
| npm | @babel/types | 8.0.0-rc.3 | indirect |
| npm | @conventional-changelog/git-client | 2.7.0 | indirect |
| npm | @emnapi/core | 1.10.0 | indirect |
| npm | @emnapi/runtime | 1.10.0 | indirect |
| npm | @emnapi/wasi-threads | 1.2.1 | indirect |
| npm | @hono/node-server | 1.19.13 | indirect |
| npm | @inquirer/ansi | 2.0.5 | indirect |
| npm | @inquirer/checkbox | 5.1.5 | indirect |
| npm | @inquirer/confirm | 6.0.13 | indirect |
| npm | @inquirer/core | 11.1.10 | indirect |
| npm | @inquirer/editor | 5.1.2 | indirect |
| npm | @inquirer/expand | 5.0.14 | indirect |
| npm | @inquirer/external-editor | 3.0.0 | indirect |
| npm | @inquirer/figures | 2.0.5 | indirect |
| npm | @inquirer/input | 5.0.13 | indirect |
| npm | @inquirer/number | 4.0.13 | indirect |
| npm | @inquirer/password | 5.0.13 | indirect |
| npm | @inquirer/prompts | 8.4.2 | indirect |
| npm | @inquirer/rawlist | 5.2.9 | indirect |
| npm | @inquirer/search | 4.1.9 | indirect |
| npm | @inquirer/select | 5.1.5 | indirect |
| npm | @inquirer/type | 4.0.5 | indirect |
| npm | @jridgewell/gen-mapping | 0.3.13 | indirect |
| npm | @jridgewell/resolve-uri | 3.1.2 | indirect |
| npm | @jridgewell/sourcemap-codec | 1.5.5 | indirect |
| npm | @jridgewell/trace-mapping | 0.3.31 | indirect |
| npm | @napi-rs/wasm-runtime | 1.1.4 | indirect |
| npm | @octokit/auth-token | 6.0.0 | indirect |
| npm | @octokit/core | 7.0.6 | indirect |
| npm | @octokit/endpoint | 11.0.2 | indirect |
| npm | @octokit/graphql | 9.0.3 | indirect |
| npm | @octokit/openapi-types | 27.0.0 | indirect |
| npm | @octokit/plugin-paginate-rest | 14.0.0 | indirect |
| npm | @octokit/plugin-request-log | 6.0.0 | indirect |
| npm | @octokit/plugin-rest-endpoint-methods | 17.0.0 | indirect |
| npm | @octokit/request | 10.0.7 | indirect |
| npm | @octokit/request-error | 7.1.0 | indirect |
| npm | @octokit/rest | 22.0.1 | indirect |
| npm | @octokit/types | 16.0.0 | indirect |
| npm | @oxc-project/types | 0.127.0 | indirect |
| npm | @oxc-project/types | 0.133.0 | indirect |
| npm | @phun-ky/typeof | 2.0.3 | indirect |
| npm | @quansync/fs | 1.0.0 | indirect |
| npm | @release-it/conventional-changelog | 11.0.0 | indirect |
| npm | @rolldown/binding-android-arm64 | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-android-arm64 | 1.0.3 | indirect |
| npm | @rolldown/binding-darwin-arm64 | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-darwin-arm64 | 1.0.3 | indirect |
| npm | @rolldown/binding-darwin-x64 | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-darwin-x64 | 1.0.3 | indirect |
| npm | @rolldown/binding-freebsd-x64 | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-freebsd-x64 | 1.0.3 | indirect |
| npm | @rolldown/binding-linux-arm-gnueabihf | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-linux-arm-gnueabihf | 1.0.3 | indirect |
| npm | @rolldown/binding-linux-arm64-gnu | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-linux-arm64-gnu | 1.0.3 | indirect |
| npm | @rolldown/binding-linux-arm64-musl | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-linux-arm64-musl | 1.0.3 | indirect |
| npm | @rolldown/binding-linux-ppc64-gnu | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-linux-ppc64-gnu | 1.0.3 | indirect |
| npm | @rolldown/binding-linux-s390x-gnu | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-linux-s390x-gnu | 1.0.3 | indirect |
| npm | @rolldown/binding-linux-x64-gnu | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-linux-x64-gnu | 1.0.3 | indirect |
| npm | @rolldown/binding-linux-x64-musl | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-linux-x64-musl | 1.0.3 | indirect |
| npm | @rolldown/binding-openharmony-arm64 | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-openharmony-arm64 | 1.0.3 | indirect |
| npm | @rolldown/binding-wasm32-wasi | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-wasm32-wasi | 1.0.3 | indirect |
| npm | @rolldown/binding-win32-arm64-msvc | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-win32-arm64-msvc | 1.0.3 | indirect |
| npm | @rolldown/binding-win32-x64-msvc | 1.0.0-rc.17 | indirect |
| npm | @rolldown/binding-win32-x64-msvc | 1.0.3 | indirect |
| npm | @rolldown/pluginutils | 1.0.0-rc.17 | indirect |
| npm | @rolldown/pluginutils | 1.0.1 | indirect |
| npm | @simple-libs/child-process-utils | 1.0.1 | indirect |
| npm | @simple-libs/hosted-git-info | 1.0.2 | indirect |
| npm | @simple-libs/stream-utils | 1.2.0 | indirect |
| npm | @standard-schema/spec | 1.1.0 | indirect |
| npm | @tybys/wasm-util | 0.10.2 | indirect |
| npm | @types/chai | 5.2.3 | indirect |
| npm | @types/deep-eql | 4.0.2 | indirect |
| npm | @types/estree | 1.0.8 | indirect |
| npm | @types/jsesc | 2.5.1 | indirect |
| npm | @types/node | 20.19.37 | indirect |
| npm | @types/node | 22.19.15 | indirect |
| npm | @types/normalize-package-data | 2.4.4 | indirect |
| npm | @types/parse-path | 7.0.3 | indirect |
| npm | @vitest/expect | 4.1.0 | indirect |
| npm | @vitest/mocker | 4.1.0 | indirect |
| npm | @vitest/pretty-format | 4.1.0 | indirect |
| npm | @vitest/runner | 4.1.0 | indirect |
| npm | @vitest/snapshot | 4.1.0 | indirect |
| npm | @vitest/spy | 4.1.0 | indirect |
| npm | @vitest/utils | 4.1.0 | indirect |
| npm | accepts | 2.0.0 | indirect |
| npm | agent-base | 8.0.0 | indirect |
| npm | ajv | 8.18.0 | indirect |
| npm | ajv-formats | 3.0.1 | indirect |
| npm | ansi-regex | 6.2.2 | indirect |
| npm | ansis | 4.3.0 | indirect |
| npm | array-ify | 1.0.0 | indirect |
| npm | assertion-error | 2.0.1 | indirect |
| npm | ast-kit | 3.0.0-beta.1 | indirect |
| npm | ast-types | 0.13.4 | indirect |
| npm | async-retry | 1.3.3 | indirect |
| npm | atomic-sleep | 1.0.0 | indirect |
| npm | basic-ftp | 5.3.1 | indirect |
| npm | before-after-hook | 4.0.0 | indirect |
| npm | birpc | 4.0.0 | indirect |
| npm | body-parser | 2.2.2 | indirect |
| npm | buffer-from | 1.1.2 | indirect |
| npm | bundle-name | 4.1.0 | indirect |
| npm | bytes | 3.1.2 | indirect |
| npm | c12 | 3.3.3 | indirect |
| npm | cac | 7.0.0 | indirect |
| npm | call-bind-apply-helpers | 1.0.2 | indirect |
| npm | call-bound | 1.0.4 | indirect |
| npm | chai | 6.2.2 | indirect |
| npm | chalk | 5.6.2 | indirect |
| npm | chardet | 2.1.1 | indirect |
| npm | chokidar | 5.0.0 | indirect |
| npm | ci-info | 4.4.0 | indirect |
| npm | citty | 0.1.6 | indirect |
| npm | citty | 0.2.0 | indirect |
| npm | cli-cursor | 5.0.0 | indirect |
| npm | cli-spinners | 3.4.0 | indirect |
| npm | cli-width | 4.1.0 | indirect |
| npm | colorette | 2.0.20 | indirect |
| npm | compare-func | 2.0.0 | indirect |
| npm | concat-stream | 2.0.0 | indirect |
| npm | confbox | 0.2.2 | indirect |
| npm | consola | 3.4.2 | indirect |
| npm | content-disposition | 1.0.1 | indirect |
| npm | content-type | 1.0.5 | indirect |
| npm | conventional-changelog | 7.2.0 | indirect |
| npm | conventional-changelog-angular | 8.3.1 | indirect |
| npm | conventional-changelog-conventionalcommits | 9.3.1 | indirect |
| npm | conventional-changelog-preset-loader | 5.0.0 | indirect |
| npm | conventional-changelog-writer | 8.4.0 | indirect |
| npm | conventional-commits-filter | 5.0.0 | indirect |
| npm | conventional-commits-parser | 6.4.0 | indirect |
| npm | conventional-recommended-bump | 11.2.0 | indirect |
| npm | convert-source-map | 2.0.0 | indirect |
| npm | cookie | 0.7.2 | indirect |
| npm | cookie-signature | 1.2.2 | indirect |
| npm | cors | 2.8.5 | indirect |
| npm | cross-spawn | 7.0.6 | indirect |
| npm | data-uri-to-buffer | 7.0.0 | indirect |
| npm | dateformat | 4.6.3 | indirect |
| npm | debug | 4.4.3 | indirect |
| npm | default-browser | 5.5.0 | indirect |
| npm | default-browser-id | 5.0.1 | indirect |
| npm | define-lazy-prop | 3.0.0 | indirect |
| npm | defu | 6.1.7 | indirect |
| npm | degenerator | 6.0.0 | indirect |
| npm | depd | 2.0.0 | indirect |
| npm | destr | 2.0.5 | indirect |
| npm | detect-libc | 2.1.2 | indirect |
| npm | dot-prop | 5.3.0 | indirect |
| npm | dotenv | 17.2.3 | indirect |
| npm | dts-resolver | 2.1.3 | indirect |
| npm | dunder-proto | 1.0.1 | indirect |
| npm | ee-first | 1.1.1 | indirect |
| npm | empathic | 2.0.1 | indirect |
| npm | encodeurl | 2.0.0 | indirect |
| npm | end-of-stream | 1.4.5 | indirect |
| npm | es-define-property | 1.0.1 | indirect |
| npm | es-errors | 1.3.0 | indirect |
| npm | es-module-lexer | 2.1.0 | indirect |
| npm | es-object-atoms | 1.1.1 | indirect |
| npm | escape-html | 1.0.3 | indirect |
| npm | escodegen | 2.1.0 | indirect |
| npm | esprima | 4.0.1 | indirect |
| npm | estraverse | 5.3.0 | indirect |
| npm | estree-walker | 3.0.3 | indirect |
| npm | esutils | 2.0.3 | indirect |
| npm | eta | 4.5.1 | indirect |
| npm | etag | 1.8.1 | indirect |
| npm | eventsource | 3.0.6 | indirect |
| npm | eventsource-parser | 3.0.1 | indirect |
| npm | expect-type | 1.3.0 | indirect |
| npm | express | 5.2.1 | indirect |
| npm | express-rate-limit | 8.5.1 | indirect |
| npm | exsolve | 1.0.8 | indirect |
| npm | fast-content-type-parse | 3.0.0 | indirect |
| npm | fast-copy | 3.0.2 | indirect |
| npm | fast-deep-equal | 3.1.3 | indirect |
| npm | fast-safe-stringify | 2.1.1 | indirect |
| npm | fast-string-truncated-width | 3.0.3 | indirect |
| npm | fast-string-width | 3.0.2 | indirect |
| npm | fast-uri | 3.1.2 | indirect |
| npm | fast-wrap-ansi | 0.2.0 | indirect |
| npm | fd-package-json | 2.0.0 | indirect |
| npm | fdir | 6.5.0 | indirect |
| npm | finalhandler | 2.1.1 | indirect |
| npm | forwarded | 0.2.0 | indirect |
| npm | fresh | 2.0.0 | indirect |
| npm | fsevents | 2.3.3 | indirect |
| npm | function-bind | 1.1.2 | indirect |
| npm | get-east-asian-width | 1.6.0 | indirect |
| npm | get-intrinsic | 1.3.0 | indirect |
| npm | get-proto | 1.0.1 | indirect |
| npm | get-tsconfig | 4.14.0 | indirect |
| npm | get-uri | 7.0.0 | indirect |
| npm | giget | 2.0.0 | indirect |
| npm | git-up | 8.1.1 | indirect |
| npm | git-url-parse | 16.1.0 | indirect |
| npm | gopd | 1.2.0 | indirect |
| npm | handlebars | 4.7.9 | indirect |
| npm | has-symbols | 1.1.0 | indirect |
| npm | hasown | 2.0.2 | indirect |
| npm | help-me | 5.0.0 | indirect |
| npm | hono | 4.12.26 | indirect |
| npm | hookable | 6.1.1 | indirect |
| npm | hosted-git-info | 8.1.0 | indirect |
| npm | http-errors | 2.0.1 | indirect |
| npm | http-proxy-agent | 8.0.0 | indirect |
| npm | https-proxy-agent | 8.0.0 | indirect |
| npm | iconv-lite | 0.7.2 | indirect |
| npm | import-without-cache | 0.3.3 | indirect |
| npm | inherits | 2.0.4 | indirect |
| npm | ip-address | 10.2.0 | indirect |
| npm | ipaddr.js | 1.9.1 | indirect |
| npm | is-docker | 3.0.0 | indirect |
| npm | is-in-ssh | 1.0.0 | indirect |
| npm | is-inside-container | 1.0.0 | indirect |
| npm | is-interactive | 2.0.0 | indirect |
| npm | is-obj | 2.0.0 | indirect |
| npm | is-promise | 4.0.0 | indirect |
| npm | is-ssh | 1.4.1 | indirect |
| npm | is-unicode-supported | 2.1.0 | indirect |
| npm | is-wsl | 3.1.1 | indirect |
| npm | isexe | 2.0.0 | indirect |
| npm | issue-parser | 7.0.1 | indirect |
| npm | jiti | 2.6.1 | indirect |
| npm | jose | 6.1.3 | indirect |
| npm | joycon | 3.1.1 | indirect |
| npm | jsesc | 3.1.0 | indirect |
| npm | json-schema-traverse | 1.0.0 | indirect |
| npm | json-schema-typed | 8.0.2 | indirect |
| npm | lightningcss | 1.32.0 | indirect |
| npm | lightningcss-android-arm64 | 1.32.0 | indirect |
| npm | lightningcss-darwin-arm64 | 1.32.0 | indirect |
| npm | lightningcss-darwin-x64 | 1.32.0 | indirect |
| npm | lightningcss-freebsd-x64 | 1.32.0 | indirect |
| npm | lightningcss-linux-arm-gnueabihf | 1.32.0 | indirect |
| npm | lightningcss-linux-arm64-gnu | 1.32.0 | indirect |
| npm | lightningcss-linux-arm64-musl | 1.32.0 | indirect |
| npm | lightningcss-linux-x64-gnu | 1.32.0 | indirect |
| npm | lightningcss-linux-x64-musl | 1.32.0 | indirect |
| npm | lightningcss-win32-arm64-msvc | 1.32.0 | indirect |
| npm | lightningcss-win32-x64-msvc | 1.32.0 | indirect |
| npm | lodash.capitalize | 4.2.1 | indirect |
| npm | lodash.escaperegexp | 4.1.2 | indirect |
| npm | lodash.isplainobject | 4.0.6 | indirect |
| npm | lodash.isstring | 4.0.1 | indirect |
| npm | lodash.merge | 4.6.2 | indirect |
| npm | lodash.uniqby | 4.7.0 | indirect |
| npm | log-symbols | 7.0.1 | indirect |
| npm | lru-cache | 10.4.3 | indirect |
| npm | lru-cache | 7.18.3 | indirect |
| npm | macos-release | 3.4.0 | indirect |
| npm | magic-string | 0.30.21 | indirect |
| npm | math-intrinsics | 1.1.0 | indirect |
| npm | media-typer | 1.1.0 | indirect |
| npm | meow | 13.2.0 | indirect |
| npm | merge-descriptors | 2.0.0 | indirect |
| npm | mime-db | 1.54.0 | indirect |
| npm | mime-types | 3.0.2 | indirect |
| npm | mimic-function | 5.0.1 | indirect |
| npm | minimist | 1.2.8 | indirect |
| npm | ms | 2.1.3 | indirect |
| npm | mute-stream | 3.0.0 | indirect |
| npm | nanoid | 3.3.12 | indirect |
| npm | negotiator | 1.0.0 | indirect |
| npm | neo-async | 2.6.2 | indirect |
| npm | netmask | 2.1.1 | indirect |
| npm | new-github-release-url | 2.0.0 | indirect |
| npm | node-fetch-native | 1.6.7 | indirect |
| npm | normalize-package-data | 7.0.1 | indirect |
| npm | nypm | 0.6.4 | indirect |
| npm | object-assign | 4.1.1 | indirect |
| npm | object-inspect | 1.13.4 | indirect |
| npm | obug | 2.1.1 | indirect |
| npm | ohash | 2.0.11 | indirect |
| npm | on-exit-leak-free | 2.1.2 | indirect |
| npm | on-finished | 2.4.1 | indirect |
| npm | once | 1.4.0 | indirect |
| npm | onetime | 7.0.0 | indirect |
| npm | open | 11.0.0 | indirect |
| npm | ora | 9.3.0 | indirect |
| npm | os-name | 7.0.0 | indirect |
| npm | pac-proxy-agent | 8.0.0 | indirect |
| npm | pac-resolver | 8.0.0 | indirect |
| npm | parse-path | 7.1.0 | indirect |
| npm | parse-url | 9.2.0 | indirect |
| npm | parseurl | 1.3.3 | indirect |
| npm | path-key | 3.1.1 | indirect |
| npm | path-to-regexp | 8.4.0 | indirect |
| npm | pathe | 2.0.3 | indirect |
| npm | perfect-debounce | 2.1.0 | indirect |
| npm | picocolors | 1.1.1 | indirect |
| npm | picomatch | 4.0.4 | indirect |
| npm | pino-abstract-transport | 2.0.0 | indirect |
| npm | pino-std-serializers | 7.0.0 | indirect |
| npm | pkce-challenge | 5.0.0 | indirect |
| npm | pkg-types | 2.3.0 | indirect |
| npm | postcss | 8.5.15 | indirect |
| npm | powershell-utils | 0.1.0 | indirect |
| npm | powershell-utils | 0.2.0 | indirect |
| npm | process-warning | 5.0.0 | indirect |
| npm | protocols | 2.0.2 | indirect |
| npm | proxy-addr | 2.0.7 | indirect |
| npm | proxy-agent | 7.0.0 | indirect |
| npm | proxy-from-env | 1.1.0 | indirect |
| npm | pump | 3.0.3 | indirect |
| npm | qs | 6.15.2 | indirect |
| npm | quansync | 1.0.0 | indirect |
| npm | quick-format-unescaped | 4.0.4 | indirect |
| npm | quickjs-wasi | 0.0.1 | indirect |
| npm | range-parser | 1.2.1 | indirect |
| npm | raw-body | 3.0.2 | indirect |
| npm | rc9 | 2.1.2 | indirect |
| npm | readable-stream | 3.6.2 | indirect |
| npm | readdirp | 5.0.0 | indirect |
| npm | real-require | 0.2.0 | indirect |
| npm | release-it | 20.2.1 | indirect |
| npm | require-from-string | 2.0.2 | indirect |
| npm | resolve-pkg-maps | 1.0.0 | indirect |
| npm | restore-cursor | 5.1.0 | indirect |
| npm | retry | 0.13.1 | indirect |
| npm | rolldown | 1.0.0-rc.17 | indirect |
| npm | rolldown | 1.0.3 | indirect |
| npm | rolldown-plugin-dts | 0.23.2 | indirect |
| npm | router | 2.2.0 | indirect |
| npm | run-applescript | 7.1.0 | indirect |
| npm | safe-buffer | 5.2.1 | indirect |
| npm | safe-stable-stringify | 2.5.0 | indirect |
| npm | safer-buffer | 2.1.2 | indirect |
| npm | secure-json-parse | 4.0.0 | indirect |
| npm | semver | 7.7.4 | indirect |
| npm | semver | 7.8.0 | indirect |
| npm | send | 1.2.1 | indirect |
| npm | serve-static | 2.2.1 | indirect |
| npm | setprototypeof | 1.2.0 | indirect |
| npm | shebang-command | 2.0.0 | indirect |
| npm | shebang-regex | 3.0.0 | indirect |
| npm | side-channel | 1.1.0 | indirect |
| npm | side-channel-list | 1.0.0 | indirect |
| npm | side-channel-map | 1.0.1 | indirect |
| npm | side-channel-weakmap | 1.0.2 | indirect |
| npm | siginfo | 2.0.0 | indirect |
| npm | signal-exit | 4.1.0 | indirect |
| npm | slow-redact | 0.3.2 | indirect |
| npm | smart-buffer | 4.2.0 | indirect |
| npm | socks | 2.8.9 | indirect |
| npm | socks-proxy-agent | 9.0.0 | indirect |
| npm | sonic-boom | 4.2.0 | indirect |
| npm | source-map | 0.6.1 | indirect |
| npm | source-map-js | 1.2.1 | indirect |
| npm | spdx-correct | 3.2.0 | indirect |
| npm | spdx-exceptions | 2.5.0 | indirect |
| npm | spdx-expression-parse | 3.0.1 | indirect |
| npm | spdx-license-ids | 3.0.23 | indirect |
| npm | split2 | 4.2.0 | indirect |
| npm | stackback | 0.0.2 | indirect |
| npm | statuses | 2.0.2 | indirect |
| npm | std-env | 4.1.0 | indirect |
| npm | stdin-discarder | 0.3.2 | indirect |
| npm | string-width | 8.2.1 | indirect |
| npm | string_decoder | 1.3.0 | indirect |
| npm | strip-ansi | 7.2.0 | indirect |
| npm | strip-json-comments | 5.0.3 | indirect |
| npm | thread-stream | 3.1.0 | indirect |
| npm | tinybench | 2.9.0 | indirect |
| npm | tinyexec | 1.1.2 | indirect |
| npm | tinyglobby | 0.2.15 | indirect |
| npm | tinyglobby | 0.2.16 | indirect |
| npm | tinyglobby | 0.2.17 | indirect |
| npm | tinyrainbow | 3.1.0 | indirect |
| npm | toidentifier | 1.0.1 | indirect |
| npm | tree-kill | 1.2.2 | indirect |
| npm | tsdown | 0.21.10 | indirect |
| npm | tslib | 2.8.1 | indirect |
| npm | type-fest | 2.19.0 | indirect |
| npm | type-is | 2.0.1 | indirect |
| npm | typedarray | 0.0.6 | indirect |
| npm | typescript | 5.9.3 | indirect |
| npm | uglify-js | 3.19.3 | indirect |
| npm | unconfig-core | 7.5.0 | indirect |
| npm | undici | 7.28.0 | indirect |
| npm | undici-types | 6.21.0 | indirect |
| npm | universal-user-agent | 7.0.3 | indirect |
| npm | unpipe | 1.0.0 | indirect |
| npm | unrun | 0.2.39 | indirect |
| npm | url-join | 5.0.0 | indirect |
| npm | util-deprecate | 1.0.2 | indirect |
| npm | validate-npm-package-license | 3.0.4 | indirect |
| npm | vary | 1.1.2 | indirect |
| npm | vite | 8.0.16 | indirect |
| npm | vitest | 4.1.0 | indirect |
| npm | walk-up-path | 4.0.0 | indirect |
| npm | which | 2.0.2 | indirect |
| npm | why-is-node-running | 2.3.0 | indirect |
| npm | wildcard-match | 5.1.4 | indirect |
| npm | windows-release | 7.1.1 | indirect |
| npm | wordwrap | 1.0.0 | indirect |
| npm | wrappy | 1.0.2 | indirect |
| npm | wsl-utils | 0.3.1 | indirect |
| npm | yargs-parser | 22.0.0 | indirect |
| npm | yoctocolors | 2.1.2 | indirect |
| npm | zod-to-json-schema | 3.25.1 | indirect |
Installing npm:@currents/mcp@2.3.3 pulls in 122 packages, direct and transitive: 0 carry known advisories, of which 0 are direct dependencies.
No known advisories affect the assessed dependencies.
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
{
"data": {
"repo": {
"topics": [
"ai",
"currents",
"mcp",
"playwright"
],
"is_fork": false,
"size_kb": 1482,
"has_wiki": true,
"homepage": "https://currents.dev",
"languages": {
"Shell": 220,
"Dockerfile": 1403,
"JavaScript": 10626,
"TypeScript": 157323
},
"pushed_at": "2026-07-16T14:30:48Z",
"created_at": "2025-04-02T18:56:01Z",
"owner_type": "Organization",
"updated_at": "2026-07-14T06:16:11Z",
"description": "Currents MCP Server",
"is_archived": false,
"is_disabled": false,
"license_spdx": "Apache-2.0",
"default_branch": "main",
"license_spdx_raw": "Apache-2.0",
"primary_language": "TypeScript",
"significant_languages": [
"TypeScript"
]
},
"owner": {
"blog": "https://currents.dev",
"name": "Currents.dev",
"type": "Organization",
"login": "currents-dev",
"company": null,
"location": "Canada",
"followers": 58,
"avatar_url": "https://avatars.githubusercontent.com/u/81007196?v=4",
"created_at": "2021-03-20T07:12:37Z",
"is_verified": null,
"public_repos": 57,
"account_age_days": 1948
},
"license": {
"state": "standard",
"spdx_id": "Apache-2.0",
"raw_spdx": "Apache-2.0",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 7,
"commits_last_year": 208,
"latest_release_at": "2026-05-19T01:39:01Z",
"latest_release_tag": "v2.3.1",
"releases_from_tags": false,
"days_since_last_push": 4,
"active_weeks_last_year": 36,
"days_since_latest_release": 62,
"mean_days_between_releases": 40.6
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 37,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "@currents/mcp",
"exists": true,
"license": "Apache-2.0",
"keywords": [
"currents",
"mcp-server",
"playwright",
"dashboard",
"reporting"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/@currents/mcp",
"is_deprecated": false,
"latest_version": "2.3.3",
"repository_url": "https://github.com/currents-dev/currents-mcp",
"versions_count": 35,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 3,
"monthly_downloads": 78006,
"first_published_at": "2025-04-03T22:41:14.323000Z",
"latest_published_at": "2026-06-15T11:52:35.970000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 35
}
]
},
"popularity": {
"forks": 14,
"stars": 17,
"watchers": 2,
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": true,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"mcp-server/tsconfig.json"
],
"largest_source_bytes": 18905,
"source_files_sampled": 70,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"mcp-server/package.json"
],
"advisories": {
"error": null,
"scope": "published_package",
"source": "osv",
"findings": [],
"collected": true,
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 122,
"assessed_package": "npm:@currents/mcp@2.3.3",
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm"
],
"dependencies": [
{
"name": "@modelcontextprotocol/sdk",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^1.28.0"
},
{
"name": "commander",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^12.1.0"
},
{
"name": "pino",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^9.9.5"
},
{
"name": "pino-pretty",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^13.1.1"
},
{
"name": "zod",
"manifest": "mcp-server/package.json",
"ecosystem": "npm",
"version_constraint": "^4.3.5"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "@modelcontextprotocol/sdk",
"direct": true,
"version": "1.28.0",
"ecosystem": "npm"
},
{
"name": "commander",
"direct": true,
"version": "12.1.0",
"ecosystem": "npm"
},
{
"name": "pino",
"direct": true,
"version": "9.13.1",
"ecosystem": "npm"
},
{
"name": "pino-pretty",
"direct": true,
"version": "13.1.1",
"ecosystem": "npm"
},
{
"name": "zod",
"direct": true,
"version": "4.3.5",
"ecosystem": "npm"
},
{
"name": "@babel/generator",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@babel/helper-string-parser",
"direct": false,
"version": "8.0.0-rc.5",
"ecosystem": "npm"
},
{
"name": "@babel/helper-validator-identifier",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@babel/parser",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@babel/types",
"direct": false,
"version": "8.0.0-rc.3",
"ecosystem": "npm"
},
{
"name": "@conventional-changelog/git-client",
"direct": false,
"version": "2.7.0",
"ecosystem": "npm"
},
{
"name": "@emnapi/core",
"direct": false,
"version": "1.10.0",
"ecosystem": "npm"
},
{
"name": "@emnapi/runtime",
"direct": false,
"version": "1.10.0",
"ecosystem": "npm"
},
{
"name": "@emnapi/wasi-threads",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "@hono/node-server",
"direct": false,
"version": "1.19.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/ansi",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/checkbox",
"direct": false,
"version": "5.1.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/confirm",
"direct": false,
"version": "6.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/core",
"direct": false,
"version": "11.1.10",
"ecosystem": "npm"
},
{
"name": "@inquirer/editor",
"direct": false,
"version": "5.1.2",
"ecosystem": "npm"
},
{
"name": "@inquirer/expand",
"direct": false,
"version": "5.0.14",
"ecosystem": "npm"
},
{
"name": "@inquirer/external-editor",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "@inquirer/figures",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/input",
"direct": false,
"version": "5.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/number",
"direct": false,
"version": "4.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/password",
"direct": false,
"version": "5.0.13",
"ecosystem": "npm"
},
{
"name": "@inquirer/prompts",
"direct": false,
"version": "8.4.2",
"ecosystem": "npm"
},
{
"name": "@inquirer/rawlist",
"direct": false,
"version": "5.2.9",
"ecosystem": "npm"
},
{
"name": "@inquirer/search",
"direct": false,
"version": "4.1.9",
"ecosystem": "npm"
},
{
"name": "@inquirer/select",
"direct": false,
"version": "5.1.5",
"ecosystem": "npm"
},
{
"name": "@inquirer/type",
"direct": false,
"version": "4.0.5",
"ecosystem": "npm"
},
{
"name": "@jridgewell/gen-mapping",
"direct": false,
"version": "0.3.13",
"ecosystem": "npm"
},
{
"name": "@jridgewell/resolve-uri",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "@jridgewell/sourcemap-codec",
"direct": false,
"version": "1.5.5",
"ecosystem": "npm"
},
{
"name": "@jridgewell/trace-mapping",
"direct": false,
"version": "0.3.31",
"ecosystem": "npm"
},
{
"name": "@napi-rs/wasm-runtime",
"direct": false,
"version": "1.1.4",
"ecosystem": "npm"
},
{
"name": "@octokit/auth-token",
"direct": false,
"version": "6.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/core",
"direct": false,
"version": "7.0.6",
"ecosystem": "npm"
},
{
"name": "@octokit/endpoint",
"direct": false,
"version": "11.0.2",
"ecosystem": "npm"
},
{
"name": "@octokit/graphql",
"direct": false,
"version": "9.0.3",
"ecosystem": "npm"
},
{
"name": "@octokit/openapi-types",
"direct": false,
"version": "27.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/plugin-paginate-rest",
"direct": false,
"version": "14.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/plugin-request-log",
"direct": false,
"version": "6.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/plugin-rest-endpoint-methods",
"direct": false,
"version": "17.0.0",
"ecosystem": "npm"
},
{
"name": "@octokit/request",
"direct": false,
"version": "10.0.7",
"ecosystem": "npm"
},
{
"name": "@octokit/request-error",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "@octokit/rest",
"direct": false,
"version": "22.0.1",
"ecosystem": "npm"
},
{
"name": "@octokit/types",
"direct": false,
"version": "16.0.0",
"ecosystem": "npm"
},
{
"name": "@oxc-project/types",
"direct": false,
"version": "0.127.0",
"ecosystem": "npm"
},
{
"name": "@oxc-project/types",
"direct": false,
"version": "0.133.0",
"ecosystem": "npm"
},
{
"name": "@phun-ky/typeof",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "@quansync/fs",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "@release-it/conventional-changelog",
"direct": false,
"version": "11.0.0",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-android-arm64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-android-arm64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-arm64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-arm64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-x64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-darwin-x64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-freebsd-x64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-freebsd-x64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm-gnueabihf",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm-gnueabihf",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-musl",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-arm64-musl",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-ppc64-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-ppc64-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-s390x-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-s390x-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-gnu",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-gnu",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-musl",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-linux-x64-musl",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-openharmony-arm64",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-openharmony-arm64",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-wasm32-wasi",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-wasm32-wasi",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-arm64-msvc",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-arm64-msvc",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-x64-msvc",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/binding-win32-x64-msvc",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "@rolldown/pluginutils",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "@rolldown/pluginutils",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "@simple-libs/child-process-utils",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "@simple-libs/hosted-git-info",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "@simple-libs/stream-utils",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "@standard-schema/spec",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "@tybys/wasm-util",
"direct": false,
"version": "0.10.2",
"ecosystem": "npm"
},
{
"name": "@types/chai",
"direct": false,
"version": "5.2.3",
"ecosystem": "npm"
},
{
"name": "@types/deep-eql",
"direct": false,
"version": "4.0.2",
"ecosystem": "npm"
},
{
"name": "@types/estree",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "@types/jsesc",
"direct": false,
"version": "2.5.1",
"ecosystem": "npm"
},
{
"name": "@types/node",
"direct": false,
"version": "20.19.37",
"ecosystem": "npm"
},
{
"name": "@types/node",
"direct": false,
"version": "22.19.15",
"ecosystem": "npm"
},
{
"name": "@types/normalize-package-data",
"direct": false,
"version": "2.4.4",
"ecosystem": "npm"
},
{
"name": "@types/parse-path",
"direct": false,
"version": "7.0.3",
"ecosystem": "npm"
},
{
"name": "@vitest/expect",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/mocker",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/pretty-format",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/runner",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/snapshot",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/spy",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "@vitest/utils",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "accepts",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "agent-base",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "ajv",
"direct": false,
"version": "8.18.0",
"ecosystem": "npm"
},
{
"name": "ajv-formats",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "ansi-regex",
"direct": false,
"version": "6.2.2",
"ecosystem": "npm"
},
{
"name": "ansis",
"direct": false,
"version": "4.3.0",
"ecosystem": "npm"
},
{
"name": "array-ify",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "assertion-error",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "ast-kit",
"direct": false,
"version": "3.0.0-beta.1",
"ecosystem": "npm"
},
{
"name": "ast-types",
"direct": false,
"version": "0.13.4",
"ecosystem": "npm"
},
{
"name": "async-retry",
"direct": false,
"version": "1.3.3",
"ecosystem": "npm"
},
{
"name": "atomic-sleep",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "basic-ftp",
"direct": false,
"version": "5.3.1",
"ecosystem": "npm"
},
{
"name": "before-after-hook",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "birpc",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "body-parser",
"direct": false,
"version": "2.2.2",
"ecosystem": "npm"
},
{
"name": "buffer-from",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "bundle-name",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "bytes",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "c12",
"direct": false,
"version": "3.3.3",
"ecosystem": "npm"
},
{
"name": "cac",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "call-bind-apply-helpers",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "call-bound",
"direct": false,
"version": "1.0.4",
"ecosystem": "npm"
},
{
"name": "chai",
"direct": false,
"version": "6.2.2",
"ecosystem": "npm"
},
{
"name": "chalk",
"direct": false,
"version": "5.6.2",
"ecosystem": "npm"
},
{
"name": "chardet",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "chokidar",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "ci-info",
"direct": false,
"version": "4.4.0",
"ecosystem": "npm"
},
{
"name": "citty",
"direct": false,
"version": "0.1.6",
"ecosystem": "npm"
},
{
"name": "citty",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "cli-cursor",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "cli-spinners",
"direct": false,
"version": "3.4.0",
"ecosystem": "npm"
},
{
"name": "cli-width",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "colorette",
"direct": false,
"version": "2.0.20",
"ecosystem": "npm"
},
{
"name": "compare-func",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "concat-stream",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "confbox",
"direct": false,
"version": "0.2.2",
"ecosystem": "npm"
},
{
"name": "consola",
"direct": false,
"version": "3.4.2",
"ecosystem": "npm"
},
{
"name": "content-disposition",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "content-type",
"direct": false,
"version": "1.0.5",
"ecosystem": "npm"
},
{
"name": "conventional-changelog",
"direct": false,
"version": "7.2.0",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-angular",
"direct": false,
"version": "8.3.1",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-conventionalcommits",
"direct": false,
"version": "9.3.1",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-preset-loader",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "conventional-changelog-writer",
"direct": false,
"version": "8.4.0",
"ecosystem": "npm"
},
{
"name": "conventional-commits-filter",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "conventional-commits-parser",
"direct": false,
"version": "6.4.0",
"ecosystem": "npm"
},
{
"name": "conventional-recommended-bump",
"direct": false,
"version": "11.2.0",
"ecosystem": "npm"
},
{
"name": "convert-source-map",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "cookie",
"direct": false,
"version": "0.7.2",
"ecosystem": "npm"
},
{
"name": "cookie-signature",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "cors",
"direct": false,
"version": "2.8.5",
"ecosystem": "npm"
},
{
"name": "cross-spawn",
"direct": false,
"version": "7.0.6",
"ecosystem": "npm"
},
{
"name": "data-uri-to-buffer",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "dateformat",
"direct": false,
"version": "4.6.3",
"ecosystem": "npm"
},
{
"name": "debug",
"direct": false,
"version": "4.4.3",
"ecosystem": "npm"
},
{
"name": "default-browser",
"direct": false,
"version": "5.5.0",
"ecosystem": "npm"
},
{
"name": "default-browser-id",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "define-lazy-prop",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "defu",
"direct": false,
"version": "6.1.7",
"ecosystem": "npm"
},
{
"name": "degenerator",
"direct": false,
"version": "6.0.0",
"ecosystem": "npm"
},
{
"name": "depd",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "destr",
"direct": false,
"version": "2.0.5",
"ecosystem": "npm"
},
{
"name": "detect-libc",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "dot-prop",
"direct": false,
"version": "5.3.0",
"ecosystem": "npm"
},
{
"name": "dotenv",
"direct": false,
"version": "17.2.3",
"ecosystem": "npm"
},
{
"name": "dts-resolver",
"direct": false,
"version": "2.1.3",
"ecosystem": "npm"
},
{
"name": "dunder-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "ee-first",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "empathic",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "encodeurl",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "end-of-stream",
"direct": false,
"version": "1.4.5",
"ecosystem": "npm"
},
{
"name": "es-define-property",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "es-errors",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "es-module-lexer",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "es-object-atoms",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "escape-html",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "escodegen",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "esprima",
"direct": false,
"version": "4.0.1",
"ecosystem": "npm"
},
{
"name": "estraverse",
"direct": false,
"version": "5.3.0",
"ecosystem": "npm"
},
{
"name": "estree-walker",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "esutils",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "eta",
"direct": false,
"version": "4.5.1",
"ecosystem": "npm"
},
{
"name": "etag",
"direct": false,
"version": "1.8.1",
"ecosystem": "npm"
},
{
"name": "eventsource",
"direct": false,
"version": "3.0.6",
"ecosystem": "npm"
},
{
"name": "eventsource-parser",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "expect-type",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "express",
"direct": false,
"version": "5.2.1",
"ecosystem": "npm"
},
{
"name": "express-rate-limit",
"direct": false,
"version": "8.5.1",
"ecosystem": "npm"
},
{
"name": "exsolve",
"direct": false,
"version": "1.0.8",
"ecosystem": "npm"
},
{
"name": "fast-content-type-parse",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "fast-copy",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "fast-deep-equal",
"direct": false,
"version": "3.1.3",
"ecosystem": "npm"
},
{
"name": "fast-safe-stringify",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "fast-string-truncated-width",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "fast-string-width",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "fast-uri",
"direct": false,
"version": "3.1.2",
"ecosystem": "npm"
},
{
"name": "fast-wrap-ansi",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "fd-package-json",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "fdir",
"direct": false,
"version": "6.5.0",
"ecosystem": "npm"
},
{
"name": "finalhandler",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "forwarded",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "fresh",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "fsevents",
"direct": false,
"version": "2.3.3",
"ecosystem": "npm"
},
{
"name": "function-bind",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "get-east-asian-width",
"direct": false,
"version": "1.6.0",
"ecosystem": "npm"
},
{
"name": "get-intrinsic",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "get-proto",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "get-tsconfig",
"direct": false,
"version": "4.14.0",
"ecosystem": "npm"
},
{
"name": "get-uri",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "giget",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "git-up",
"direct": false,
"version": "8.1.1",
"ecosystem": "npm"
},
{
"name": "git-url-parse",
"direct": false,
"version": "16.1.0",
"ecosystem": "npm"
},
{
"name": "gopd",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "handlebars",
"direct": false,
"version": "4.7.9",
"ecosystem": "npm"
},
{
"name": "has-symbols",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "hasown",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "help-me",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "hono",
"direct": false,
"version": "4.12.26",
"ecosystem": "npm"
},
{
"name": "hookable",
"direct": false,
"version": "6.1.1",
"ecosystem": "npm"
},
{
"name": "hosted-git-info",
"direct": false,
"version": "8.1.0",
"ecosystem": "npm"
},
{
"name": "http-errors",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "http-proxy-agent",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "https-proxy-agent",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "iconv-lite",
"direct": false,
"version": "0.7.2",
"ecosystem": "npm"
},
{
"name": "import-without-cache",
"direct": false,
"version": "0.3.3",
"ecosystem": "npm"
},
{
"name": "inherits",
"direct": false,
"version": "2.0.4",
"ecosystem": "npm"
},
{
"name": "ip-address",
"direct": false,
"version": "10.2.0",
"ecosystem": "npm"
},
{
"name": "ipaddr.js",
"direct": false,
"version": "1.9.1",
"ecosystem": "npm"
},
{
"name": "is-docker",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "is-in-ssh",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "is-inside-container",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "is-interactive",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "is-obj",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "is-promise",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "is-ssh",
"direct": false,
"version": "1.4.1",
"ecosystem": "npm"
},
{
"name": "is-unicode-supported",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "is-wsl",
"direct": false,
"version": "3.1.1",
"ecosystem": "npm"
},
{
"name": "isexe",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "issue-parser",
"direct": false,
"version": "7.0.1",
"ecosystem": "npm"
},
{
"name": "jiti",
"direct": false,
"version": "2.6.1",
"ecosystem": "npm"
},
{
"name": "jose",
"direct": false,
"version": "6.1.3",
"ecosystem": "npm"
},
{
"name": "joycon",
"direct": false,
"version": "3.1.1",
"ecosystem": "npm"
},
{
"name": "jsesc",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "json-schema-traverse",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "json-schema-typed",
"direct": false,
"version": "8.0.2",
"ecosystem": "npm"
},
{
"name": "lightningcss",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-android-arm64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-arm64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-darwin-x64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-freebsd-x64",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm-gnueabihf",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-gnu",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-arm64-musl",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-gnu",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-linux-x64-musl",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-arm64-msvc",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lightningcss-win32-x64-msvc",
"direct": false,
"version": "1.32.0",
"ecosystem": "npm"
},
{
"name": "lodash.capitalize",
"direct": false,
"version": "4.2.1",
"ecosystem": "npm"
},
{
"name": "lodash.escaperegexp",
"direct": false,
"version": "4.1.2",
"ecosystem": "npm"
},
{
"name": "lodash.isplainobject",
"direct": false,
"version": "4.0.6",
"ecosystem": "npm"
},
{
"name": "lodash.isstring",
"direct": false,
"version": "4.0.1",
"ecosystem": "npm"
},
{
"name": "lodash.merge",
"direct": false,
"version": "4.6.2",
"ecosystem": "npm"
},
{
"name": "lodash.uniqby",
"direct": false,
"version": "4.7.0",
"ecosystem": "npm"
},
{
"name": "log-symbols",
"direct": false,
"version": "7.0.1",
"ecosystem": "npm"
},
{
"name": "lru-cache",
"direct": false,
"version": "10.4.3",
"ecosystem": "npm"
},
{
"name": "lru-cache",
"direct": false,
"version": "7.18.3",
"ecosystem": "npm"
},
{
"name": "macos-release",
"direct": false,
"version": "3.4.0",
"ecosystem": "npm"
},
{
"name": "magic-string",
"direct": false,
"version": "0.30.21",
"ecosystem": "npm"
},
{
"name": "math-intrinsics",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "media-typer",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "meow",
"direct": false,
"version": "13.2.0",
"ecosystem": "npm"
},
{
"name": "merge-descriptors",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "mime-db",
"direct": false,
"version": "1.54.0",
"ecosystem": "npm"
},
{
"name": "mime-types",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "mimic-function",
"direct": false,
"version": "5.0.1",
"ecosystem": "npm"
},
{
"name": "minimist",
"direct": false,
"version": "1.2.8",
"ecosystem": "npm"
},
{
"name": "ms",
"direct": false,
"version": "2.1.3",
"ecosystem": "npm"
},
{
"name": "mute-stream",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "nanoid",
"direct": false,
"version": "3.3.12",
"ecosystem": "npm"
},
{
"name": "negotiator",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "neo-async",
"direct": false,
"version": "2.6.2",
"ecosystem": "npm"
},
{
"name": "netmask",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "new-github-release-url",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "node-fetch-native",
"direct": false,
"version": "1.6.7",
"ecosystem": "npm"
},
{
"name": "normalize-package-data",
"direct": false,
"version": "7.0.1",
"ecosystem": "npm"
},
{
"name": "nypm",
"direct": false,
"version": "0.6.4",
"ecosystem": "npm"
},
{
"name": "object-assign",
"direct": false,
"version": "4.1.1",
"ecosystem": "npm"
},
{
"name": "object-inspect",
"direct": false,
"version": "1.13.4",
"ecosystem": "npm"
},
{
"name": "obug",
"direct": false,
"version": "2.1.1",
"ecosystem": "npm"
},
{
"name": "ohash",
"direct": false,
"version": "2.0.11",
"ecosystem": "npm"
},
{
"name": "on-exit-leak-free",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "on-finished",
"direct": false,
"version": "2.4.1",
"ecosystem": "npm"
},
{
"name": "once",
"direct": false,
"version": "1.4.0",
"ecosystem": "npm"
},
{
"name": "onetime",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "open",
"direct": false,
"version": "11.0.0",
"ecosystem": "npm"
},
{
"name": "ora",
"direct": false,
"version": "9.3.0",
"ecosystem": "npm"
},
{
"name": "os-name",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "pac-proxy-agent",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "pac-resolver",
"direct": false,
"version": "8.0.0",
"ecosystem": "npm"
},
{
"name": "parse-path",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "parse-url",
"direct": false,
"version": "9.2.0",
"ecosystem": "npm"
},
{
"name": "parseurl",
"direct": false,
"version": "1.3.3",
"ecosystem": "npm"
},
{
"name": "path-key",
"direct": false,
"version": "3.1.1",
"ecosystem": "npm"
},
{
"name": "path-to-regexp",
"direct": false,
"version": "8.4.0",
"ecosystem": "npm"
},
{
"name": "pathe",
"direct": false,
"version": "2.0.3",
"ecosystem": "npm"
},
{
"name": "perfect-debounce",
"direct": false,
"version": "2.1.0",
"ecosystem": "npm"
},
{
"name": "picocolors",
"direct": false,
"version": "1.1.1",
"ecosystem": "npm"
},
{
"name": "picomatch",
"direct": false,
"version": "4.0.4",
"ecosystem": "npm"
},
{
"name": "pino-abstract-transport",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "pino-std-serializers",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "pkce-challenge",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "pkg-types",
"direct": false,
"version": "2.3.0",
"ecosystem": "npm"
},
{
"name": "postcss",
"direct": false,
"version": "8.5.15",
"ecosystem": "npm"
},
{
"name": "powershell-utils",
"direct": false,
"version": "0.1.0",
"ecosystem": "npm"
},
{
"name": "powershell-utils",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "process-warning",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "protocols",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "proxy-addr",
"direct": false,
"version": "2.0.7",
"ecosystem": "npm"
},
{
"name": "proxy-agent",
"direct": false,
"version": "7.0.0",
"ecosystem": "npm"
},
{
"name": "proxy-from-env",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "pump",
"direct": false,
"version": "3.0.3",
"ecosystem": "npm"
},
{
"name": "qs",
"direct": false,
"version": "6.15.2",
"ecosystem": "npm"
},
{
"name": "quansync",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "quick-format-unescaped",
"direct": false,
"version": "4.0.4",
"ecosystem": "npm"
},
{
"name": "quickjs-wasi",
"direct": false,
"version": "0.0.1",
"ecosystem": "npm"
},
{
"name": "range-parser",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "raw-body",
"direct": false,
"version": "3.0.2",
"ecosystem": "npm"
},
{
"name": "rc9",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "readable-stream",
"direct": false,
"version": "3.6.2",
"ecosystem": "npm"
},
{
"name": "readdirp",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "real-require",
"direct": false,
"version": "0.2.0",
"ecosystem": "npm"
},
{
"name": "release-it",
"direct": false,
"version": "20.2.1",
"ecosystem": "npm"
},
{
"name": "require-from-string",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "resolve-pkg-maps",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "restore-cursor",
"direct": false,
"version": "5.1.0",
"ecosystem": "npm"
},
{
"name": "retry",
"direct": false,
"version": "0.13.1",
"ecosystem": "npm"
},
{
"name": "rolldown",
"direct": false,
"version": "1.0.0-rc.17",
"ecosystem": "npm"
},
{
"name": "rolldown",
"direct": false,
"version": "1.0.3",
"ecosystem": "npm"
},
{
"name": "rolldown-plugin-dts",
"direct": false,
"version": "0.23.2",
"ecosystem": "npm"
},
{
"name": "router",
"direct": false,
"version": "2.2.0",
"ecosystem": "npm"
},
{
"name": "run-applescript",
"direct": false,
"version": "7.1.0",
"ecosystem": "npm"
},
{
"name": "safe-buffer",
"direct": false,
"version": "5.2.1",
"ecosystem": "npm"
},
{
"name": "safe-stable-stringify",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "safer-buffer",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "secure-json-parse",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "semver",
"direct": false,
"version": "7.7.4",
"ecosystem": "npm"
},
{
"name": "semver",
"direct": false,
"version": "7.8.0",
"ecosystem": "npm"
},
{
"name": "send",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "serve-static",
"direct": false,
"version": "2.2.1",
"ecosystem": "npm"
},
{
"name": "setprototypeof",
"direct": false,
"version": "1.2.0",
"ecosystem": "npm"
},
{
"name": "shebang-command",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "shebang-regex",
"direct": false,
"version": "3.0.0",
"ecosystem": "npm"
},
{
"name": "side-channel",
"direct": false,
"version": "1.1.0",
"ecosystem": "npm"
},
{
"name": "side-channel-list",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "side-channel-map",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "side-channel-weakmap",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "siginfo",
"direct": false,
"version": "2.0.0",
"ecosystem": "npm"
},
{
"name": "signal-exit",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "slow-redact",
"direct": false,
"version": "0.3.2",
"ecosystem": "npm"
},
{
"name": "smart-buffer",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "socks",
"direct": false,
"version": "2.8.9",
"ecosystem": "npm"
},
{
"name": "socks-proxy-agent",
"direct": false,
"version": "9.0.0",
"ecosystem": "npm"
},
{
"name": "sonic-boom",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "source-map",
"direct": false,
"version": "0.6.1",
"ecosystem": "npm"
},
{
"name": "source-map-js",
"direct": false,
"version": "1.2.1",
"ecosystem": "npm"
},
{
"name": "spdx-correct",
"direct": false,
"version": "3.2.0",
"ecosystem": "npm"
},
{
"name": "spdx-exceptions",
"direct": false,
"version": "2.5.0",
"ecosystem": "npm"
},
{
"name": "spdx-expression-parse",
"direct": false,
"version": "3.0.1",
"ecosystem": "npm"
},
{
"name": "spdx-license-ids",
"direct": false,
"version": "3.0.23",
"ecosystem": "npm"
},
{
"name": "split2",
"direct": false,
"version": "4.2.0",
"ecosystem": "npm"
},
{
"name": "stackback",
"direct": false,
"version": "0.0.2",
"ecosystem": "npm"
},
{
"name": "statuses",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "std-env",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "stdin-discarder",
"direct": false,
"version": "0.3.2",
"ecosystem": "npm"
},
{
"name": "string-width",
"direct": false,
"version": "8.2.1",
"ecosystem": "npm"
},
{
"name": "string_decoder",
"direct": false,
"version": "1.3.0",
"ecosystem": "npm"
},
{
"name": "strip-ansi",
"direct": false,
"version": "7.2.0",
"ecosystem": "npm"
},
{
"name": "strip-json-comments",
"direct": false,
"version": "5.0.3",
"ecosystem": "npm"
},
{
"name": "thread-stream",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "tinybench",
"direct": false,
"version": "2.9.0",
"ecosystem": "npm"
},
{
"name": "tinyexec",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "tinyglobby",
"direct": false,
"version": "0.2.15",
"ecosystem": "npm"
},
{
"name": "tinyglobby",
"direct": false,
"version": "0.2.16",
"ecosystem": "npm"
},
{
"name": "tinyglobby",
"direct": false,
"version": "0.2.17",
"ecosystem": "npm"
},
{
"name": "tinyrainbow",
"direct": false,
"version": "3.1.0",
"ecosystem": "npm"
},
{
"name": "toidentifier",
"direct": false,
"version": "1.0.1",
"ecosystem": "npm"
},
{
"name": "tree-kill",
"direct": false,
"version": "1.2.2",
"ecosystem": "npm"
},
{
"name": "tsdown",
"direct": false,
"version": "0.21.10",
"ecosystem": "npm"
},
{
"name": "tslib",
"direct": false,
"version": "2.8.1",
"ecosystem": "npm"
},
{
"name": "type-fest",
"direct": false,
"version": "2.19.0",
"ecosystem": "npm"
},
{
"name": "type-is",
"direct": false,
"version": "2.0.1",
"ecosystem": "npm"
},
{
"name": "typedarray",
"direct": false,
"version": "0.0.6",
"ecosystem": "npm"
},
{
"name": "typescript",
"direct": false,
"version": "5.9.3",
"ecosystem": "npm"
},
{
"name": "uglify-js",
"direct": false,
"version": "3.19.3",
"ecosystem": "npm"
},
{
"name": "unconfig-core",
"direct": false,
"version": "7.5.0",
"ecosystem": "npm"
},
{
"name": "undici",
"direct": false,
"version": "7.28.0",
"ecosystem": "npm"
},
{
"name": "undici-types",
"direct": false,
"version": "6.21.0",
"ecosystem": "npm"
},
{
"name": "universal-user-agent",
"direct": false,
"version": "7.0.3",
"ecosystem": "npm"
},
{
"name": "unpipe",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "unrun",
"direct": false,
"version": "0.2.39",
"ecosystem": "npm"
},
{
"name": "url-join",
"direct": false,
"version": "5.0.0",
"ecosystem": "npm"
},
{
"name": "util-deprecate",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "validate-npm-package-license",
"direct": false,
"version": "3.0.4",
"ecosystem": "npm"
},
{
"name": "vary",
"direct": false,
"version": "1.1.2",
"ecosystem": "npm"
},
{
"name": "vite",
"direct": false,
"version": "8.0.16",
"ecosystem": "npm"
},
{
"name": "vitest",
"direct": false,
"version": "4.1.0",
"ecosystem": "npm"
},
{
"name": "walk-up-path",
"direct": false,
"version": "4.0.0",
"ecosystem": "npm"
},
{
"name": "which",
"direct": false,
"version": "2.0.2",
"ecosystem": "npm"
},
{
"name": "why-is-node-running",
"direct": false,
"version": "2.3.0",
"ecosystem": "npm"
},
{
"name": "wildcard-match",
"direct": false,
"version": "5.1.4",
"ecosystem": "npm"
},
{
"name": "windows-release",
"direct": false,
"version": "7.1.1",
"ecosystem": "npm"
},
{
"name": "wordwrap",
"direct": false,
"version": "1.0.0",
"ecosystem": "npm"
},
{
"name": "wrappy",
"direct": false,
"version": "1.0.2",
"ecosystem": "npm"
},
{
"name": "wsl-utils",
"direct": false,
"version": "0.3.1",
"ecosystem": "npm"
},
{
"name": "yargs-parser",
"direct": false,
"version": "22.0.0",
"ecosystem": "npm"
},
{
"name": "yoctocolors",
"direct": false,
"version": "2.1.2",
"ecosystem": "npm"
},
{
"name": "zod-to-json-schema",
"direct": false,
"version": "3.25.1",
"ecosystem": "npm"
}
],
"collected": true,
"truncated": false,
"total_count": 423,
"direct_count": 5,
"indirect_count": 418
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 106,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 43
},
"bus_factor": 4,
"top_contributors": [
{
"type": "User",
"login": "agoldis",
"commits": 47,
"avatar_url": "https://avatars.githubusercontent.com/u/1637928?v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 38,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "User",
"login": "miguelangaranocurrents",
"commits": 29,
"avatar_url": "https://avatars.githubusercontent.com/u/140348970?v=4"
},
{
"type": "User",
"login": "ynahmany",
"commits": 26,
"avatar_url": "https://avatars.githubusercontent.com/u/7278548?v=4"
},
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 24,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
},
{
"type": "User",
"login": "miguelangarano",
"commits": 23,
"avatar_url": "https://avatars.githubusercontent.com/u/26367577?v=4"
},
{
"type": "User",
"login": "waltergalvao",
"commits": 20,
"avatar_url": "https://avatars.githubusercontent.com/u/1367578?v=4"
},
{
"type": "User",
"login": "cursoragent",
"commits": 6,
"avatar_url": "https://avatars.githubusercontent.com/u/199161495?v=4"
},
{
"type": "User",
"login": "maxigimenez",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/1178139?v=4"
},
{
"type": "User",
"login": "calclavia",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/1828968?v=4"
}
],
"contributors_sampled": 15,
"top_contributor_share": 0.205
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"auto-pr-parity-branch.yaml",
"dependabot-review.yml",
"linear-release.yaml",
"parity-pr-merged.yaml",
"post-release.yaml",
"promote.yaml",
"publish.yaml",
"release.yaml",
"test.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 10,
"reason": "17 out of 17 merged PRs checked by a CI test -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 4,
"reason": "Found 4/9 approved changesets -- score normalized to 4",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 3,
"reason": "project has 1 contributing companies or organizations -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 0,
"reason": "dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 2,
"reason": "dependency not pinned by hash detected -- score normalized to 2",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "3e76b01b7b5b14140c9845db65206de4a307153d",
"ran_at": "2026-07-20T22:03:48Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/currents-dev/currents-mcp",
"host": "github.com",
"name": "currents-mcp",
"owner": "currents-dev"
},
"metrics": {
"overall": {
"key": "overall",
"band": "good",
"name": "Overall health",
"note": null,
"notes": [],
"value": 71,
"inputs": {
"security": 60,
"vitality": 93,
"community": 50,
"governance": 75,
"engineering": 71
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 93,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 89,
"inputs": {
"commits_last_year": 208,
"human_commit_share": null,
"days_since_last_push": 4,
"active_weeks_last_year": 36
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "36/52 weeks with commits",
"points": 24.9,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 36
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "208 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 208
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 100,
"inputs": {
"releases_count": 7,
"latest_release_tag": "v2.3.1",
"releases_from_tags": false,
"days_since_latest_release": 62,
"mean_days_between_releases": 40.6
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "7 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 7
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 62 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 62
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~40.6 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 40.6
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 50,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 29,
"inputs": {
"forks": 14,
"stars": 17,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "17 stars",
"points": 19.5,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 17
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "14 forks",
"points": 9.3,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 14
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (Apache-2.0)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "Apache-2.0"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "good",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 82,
"inputs": {
"packages": [
"@currents/mcp"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 78006
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "78,006 downloads/month across npm",
"points": 65.2,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 78006,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "good",
"name": "Sustainability & Governance",
"value": 75,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "good",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 78,
"inputs": {
"bus_factor": 4,
"contributors_sampled": 15,
"top_contributor_share": 0.205
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "4 contributor(s) cover half of all commits",
"points": 43.2,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 4
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 20% of commits",
"points": 17.9,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 20
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "15 contributors",
"points": 13.5,
"status": "met",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 15
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 62,
"inputs": {
"merged_prs": 106,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 43
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "106/149 decided PRs merged",
"points": 27.2,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 106,
"decided": 149
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 4/9 approved changesets -- score normalized to 4",
"points": 6,
"status": "partial",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 66,
"inputs": {
"followers": 58,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "currents-dev",
"public_repos": 57,
"account_age_days": 1948
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "58 followers of currents-dev",
"points": 12.7,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 58,
"login": "currents-dev"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "57 public repos, account ~5 yr old",
"points": 23.5,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 57
}
},
{
"code": "account_age_years",
"params": {
"years": 5
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"@currents/mcp"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 35
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 35 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 35
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "35 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 35
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "good",
"name": "Engineering Quality",
"value": 71,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 68,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "9 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 9
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "17 out of 17 merged PRs checked by a CI test -- score normalized to 10",
"points": 20,
"status": "met",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [
"ai",
"currents",
"mcp",
"playwright"
],
"has_wiki": true,
"homepage": "https://currents.dev",
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://currents.dev",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "4 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 4
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 60,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "17 out of 17 merged PRs checked by a CI test -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 4/9 approved changesets -- score normalized to 4",
"points": 3,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "dangerous workflow patterns detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 2",
"points": 1,
"status": "partial",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "dependency_advisories",
"band": "excellent",
"name": "Dependency advisories",
"note": "Excluded from scoring (no data or not applicable): No advisories left outstanding. Remaining weights renormalized. Matched the npm:@currents/mcp@2.3.3 runtime dependency closure — what installing the published package pulls in — 122 packages. Reachability is not analyzed.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"no_advisories_left_outstanding"
]
}
},
{
"code": "weights_renormalized",
"params": {}
},
{
"code": "advisories_scope_published",
"params": {
"package": "npm:@currents/mcp@2.3.3",
"assessed": 122
}
},
{
"code": "advisories_reachability",
"params": {}
}
],
"value": 100,
"inputs": {
"source": "osv",
"advisories": 0,
"affected_packages": 0,
"assessed_packages": 122,
"unassessed_packages": 0,
"affected_by_severity": "none",
"direct_affected_packages": 0
},
"components": [
{
"key": "direct_dependencies_free_of_known_advisories",
"name": "Direct dependencies free of known advisories",
"detail": "no direct dependency carries a known advisory",
"points": 35,
"status": "met",
"details": [
{
"code": "no_direct_advisories",
"params": {}
}
],
"max_points": 35
},
{
"key": "indirect_dependencies_free_of_known_advisories",
"name": "Indirect dependencies free of known advisories",
"detail": "no indirect dependency carries a known advisory",
"points": 25,
"status": "met",
"details": [
{
"code": "no_indirect_advisories",
"params": {}
}
],
"max_points": 25
},
{
"key": "no_advisories_left_outstanding",
"name": "No advisories left outstanding",
"detail": "no advisory carries a publication date",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_no_publication_date",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "malicious_dependencies",
"band": "excellent",
"name": "Malicious dependencies",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"source": "osv",
"meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
"packages": [],
"red_flag": false,
"assessed_packages": 122,
"malicious_packages": 0,
"direct_malicious_packages": 0,
"withdrawn_malicious_packages": 0,
"installable_malicious_packages": 0
},
"components": [
{
"key": "no_dependency_reported_as_a_malicious_package",
"name": "No dependency reported as a malicious package",
"detail": "no dependency is reported as a malicious package",
"points": 100,
"status": "met",
"details": [
{
"code": "no_malicious_dependencies",
"params": {}
}
],
"max_points": 100
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 5
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 40,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "moderate",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice",
"automated_maintenance"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 55,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": true,
"typed_language": true,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"mcp-server/tsconfig.json"
],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": null
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "mcp-server/tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "mcp-server/tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 2",
"points": 2,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "excellent",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"primary_language": "TypeScript",
"largest_source_bytes": 18905,
"source_files_sampled": 70,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "TypeScript (statically typed)",
"points": 45,
"status": "met",
"details": [
{
"code": "statically_typed_language",
"params": {
"language": "TypeScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/70 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 70,
"oversized": 0
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "critical",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 20,
"inputs": {
"example_dirs": [],
"has_mcp_signal": true,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 20,
"status": "met",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-20T22:04:11.454457Z",
"schema_version": "0.16.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/c/currents-dev/currents-mcp.svg",
"full_name": "currents-dev/currents-mcp",
"license_state": "standard",
"license_spdx": "Apache-2.0"
}Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.16.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.