Öffentliches RegisterMittel
Software-GesundheitsberichtSchema 0.12.0 · Metriken 1.13.0 · 2026-07-17 15:44 UTC
robofinsystems / robosystems-typescript-client
Official TypeScript Client for the RoboSystems Financial Knowledge Graph API. Access comprehensive financial data including accounting transactions, financial reports, and advanced graph analytics through a type-safe, modern TypeScript interface.
robofinsystems/robosystems-typescript-client erreicht einen Gesundheitsindex von 65 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Vitality (96/100) ab, am schwächsten bei Community & Adoption (39/100). Zuletzt vor 3 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
65
gesamt / 100Software-Gesundheitsindex
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
65
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
Bewertungsprofil
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Eigentümerschaft
RFSOrganisation
5 Follower12 öffentliche Reposseit Mai 2025
Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.
Paket-Ökosysteme
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | @robosystems/client | 0.5.1 | 2.648 | 109 | vor 4 Tagen | robosystemsfinancialgraphapisdktypescriptknowledge-graph |
Metriken nach Kategorie
Vitalität
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
96
Entwicklungsaktivität
93Exzellent
Wie die Bewertung erfolgt
| 36/36 | Push-Aktualität — letzter Push vor 3 Tagen |
| 29.1/36 | Commit-Rhythmus — 42/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 473 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Verwendete Eingangsdaten
| commits_last_year | 473 |
| human_commit_share | — |
| days_since_last_push | 3 |
| active_weeks_last_year | 42 |
Release-Disziplin
100Exzellent
Wie die Bewertung erfolgt
| 27/27 | Liefert Releases aus — 100 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 4 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 5 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
Verwendete Eingangsdaten
| releases_count | 100 |
| latest_release_tag | v0.5.1 |
| releases_from_tags | nein |
| days_since_latest_release | 4 |
| mean_days_between_releases | 5 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.
Community & Verbreitung
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
39
Popularität & Verbreitung
1Kritisch
Wie die Bewertung erfolgt
| 0/60 | Stars — 1 Stars |
| 0/25 | Forks — 0 Forks |
| 0/15 | Watcher — 0 Watcher |
Verwendete Eingangsdaten
| forks | 0 |
| stars | 1 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community-Gesundheit
70Gut
Wie die Bewertung erfolgt
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 18/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
Verwendete Eingangsdaten
| has_readme | ja |
| has_license | ja |
| has_contributing | ja |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | nein |
Wie die Bewertung erfolgt
| 45.6/80 | Downloads pro Monat — 2.648 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
Verwendete Eingangsdaten
| packages | @robosystems/client |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 2.648 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.
Nachhaltigkeit & Governance
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
56
Maintainer-Resilienz (Bus-Faktor)
22Kritisch
Wie die Bewertung erfolgt
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 4.8/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 79 % der Commits |
| 2.7/13.5 | Breite der Beitragenden — 2 Beitragende |
| 6/10 | OpenSSF Scorecard: Contributors — project has 2 contributing companies or organizations -- score normalized to 6 |
Verwendete Eingangsdaten
| bus_factor | 1 |
| contributors_sampled | 2 |
| top_contributor_share | 0,786 |
Wie die Bewertung erfolgt
| 0/46.8 | Issue-Lösungsquote — keine Issues oder keine Daten |
| 37.7/38.3 | PR-Annahme — 146/148 entschiedene PRs gemergt |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/15 approved changesets -- score normalized to 0 |
Verwendete Eingangsdaten
| merged_prs | 146 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 2 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Issue-Lösungsquote. Die verbleibenden Gewichte wurden renormalisiert.
Eigentümerschaft & Trägerschaft
46Gefährdet
Wie die Bewertung erfolgt
| 30/30 | Organisatorische Trägerschaft — im Besitz einer Organisation |
| 0/20 | Verifizierte Domain |
| 5.6/25 | Reichweite des Inhabers — 5 Follower von RoboFinSystems |
| 10.4/25 | Kontohistorie — 12 öffentliche Repos, Kontoalter ca. 1 Jahre |
Verwendete Eingangsdaten
| followers | 5 |
| owner_type | Organization |
| is_verified | — |
| owner_login | RoboFinSystems |
| public_repos | 12 |
| account_age_days | 414 |
Paketpflege
100Exzellent
Wie die Bewertung erfolgt
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 4 Tagen |
| 20/20 | Versionshistorie — 109 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
Verwendete Eingangsdaten
| packages | @robosystems/client |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 4 |
Engineering-Qualität
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
76
Wie die Bewertung erfolgt
| 24/24 | CI-Workflows — 5 Workflow(s) |
| 24/24 | Tests vorhanden |
| 16/16 | Linter-Konfiguration — eslint.config.mjs |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 8 out of 8 merged PRs checked by a CI test -- score normalized to 10 |
Verwendete Eingangsdaten
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | ja |
| has_precommit_config | nein |
Dokumentation
65Mittel
Wie die Bewertung erfolgt
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://www.npmjs.com/package/@robosystems/client |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 11 Topics |
| 0/10 | Wiki |
Verwendete Eingangsdaten
| topics | javascript, typescript, client, financial, graph, sdk, financial-data, financial-analysis, accounting, robosystems, graph-api |
| has_wiki | nein |
| homepage | https://www.npmjs.com/package/@robosystems/client |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sicherheit
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
53
Sicherheitslage
53Mittel
Wie die Bewertung erfolgt
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 2.2/7.5 | Branch-Protection — branch protection is not maximal on development and all release branches |
| 2.5/2.5 | CI-Tests — 8 out of 8 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/15 approved changesets -- score normalized to 0 |
| 1.5/2.5 | Contributors — project has 2 contributing companies or organizations -- score normalized to 6 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — keine Daten |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Verwendete Eingangsdaten
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5,3 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): packaging, signed_releases. Die verbleibenden Gewichte wurden renormalisiert.
AI Readiness
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
43
AI-Agentenkontext & Leitlinien
1Kritisch
Wie die Bewertung erfolgt
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
Verwendete Eingangsdaten
| has_llms_txt | nein |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Lesbare Commit-Historie. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 11/11 | Lint-/Format-Konfiguration — eslint.config.mjs |
| 11/11 | Statische Typprüfung — tsconfig.json |
| 0/10 | Reproduzierbare Umgebung |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 5/8 | Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Verwendete Eingangsdaten
| has_nix | nein |
| has_tests | ja |
| lockfiles | — |
| has_dockerfile | nein |
| typed_language | ja |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | ja |
| typecheck_configs | tsconfig.json |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Belegte Agentenpraxis. Die verbleibenden Gewichte wurden renormalisiert.
AI-Code-Lesbarkeit für Modelle
98Exzellent
Wie die Bewertung erfolgt
| 45/45 | Typprüfbarer Code — TypeScript (statisch typisiert) |
| 52.6/55 | Handhabbare Dateigrößen — 4/90 Quelldateien über 60 KB |
Verwendete Eingangsdaten
| primary_language | TypeScript |
| largest_source_bytes | 507.684 |
| source_files_sampled | 90 |
| oversized_source_files | 4 |
Eckdaten
1GitHub-Sterne
2Mitwirkende
473Commits, letzte 12 Monate
3Tage seit letztem Push
100Releases
1Bus-Faktor
0offene Issues
npmPaket-Ökosysteme
Weitere Details
OpenSSF Scorecard 5.3 / 10
5.3Gesamtwert
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 3 | Branch-Protection | branch protection is not maximal on development and all release branches |
| 10 | CI-Tests | 8 out of 8 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/15 approved changesets -- score normalized to 0 |
| 6 | Contributors | project has 2 contributing companies or organizations -- score normalized to 6 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| k. A. | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Direkte Abhängigkeiten 3
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| npm | @graphql-typed-document-node/core | ^3.2.0 | package.json |
| npm | graphql | ^16.13.2 | package.json |
| npm | graphql-request | ^7.4.0 | package.json |
Alle Abhängigkeiten 25
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 3 direkte und 22 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| npm | @graphql-typed-document-node/core | ^3.2.0 | direkt |
| npm | graphql | ^16.13.2 | direkt |
| npm | graphql-request | ^7.4.0 | direkt |
| npm | @eslint/js | ^9.39.2 | indirekt |
| npm | @graphql-codegen/cli | ^6.3.0 | indirekt |
| npm | @graphql-codegen/typed-document-node | ^6.1.8 | indirekt |
| npm | @graphql-codegen/typescript | ^5.0.10 | indirekt |
| npm | @graphql-codegen/typescript-operations | ^5.1.0 | indirekt |
| npm | @hey-api/openapi-ts | ^0.97.3 | indirekt |
| npm | @testing-library/react | ^16.3.0 | indirekt |
| npm | @types/node | ^22.0.0 | indirekt |
| npm | @types/react | ^19.1.9 | indirekt |
| npm | @typescript-eslint/eslint-plugin | ^8.0.0 | indirekt |
| npm | @typescript-eslint/parser | ^8.0.0 | indirekt |
| npm | eslint | ^9.39.2 | indirekt |
| npm | eslint-config-prettier | ^10.0.0 | indirekt |
| npm | eslint-plugin-prettier | ^5.0.0 | indirekt |
| npm | happy-dom | ^20.0.8 | indirekt |
| npm | prettier | ^3.0.0 | indirekt |
| npm | prettier-plugin-organize-imports | ^4.0.0 | indirekt |
| npm | react | ^19.2.0 | indirekt |
| npm | react-dom | ^19.2.0 | indirekt |
| npm | typescript | ^5.7.2 | indirekt |
| npm | typescript-eslint | ^8.54.0 | indirekt |
| npm | vitest | ^4.1.4 | indirekt |
JSON-Rohbericht maschinenlesbar
{
"data": {
"repo": {
"topics": [
"javascript",
"typescript",
"client",
"financial",
"graph",
"sdk",
"financial-data",
"financial-analysis",
"accounting",
"robosystems",
"graph-api"
],
"is_fork": false,
"size_kb": 1880,
"has_wiki": false,
"homepage": "https://www.npmjs.com/package/@robosystems/client",
"languages": {
"Shell": 7385,
"JavaScript": 11515,
"TypeScript": 1484040
},
"pushed_at": "2026-07-14T08:37:13Z",
"created_at": "2025-08-10T20:32:33Z",
"owner_type": "Organization",
"updated_at": "2026-07-14T08:37:15Z",
"description": "Official TypeScript Client for the RoboSystems Financial Knowledge Graph API. Access comprehensive financial data including accounting transactions, financial reports, and advanced graph analytics through a type-safe, modern TypeScript interface.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"primary_language": "TypeScript",
"significant_languages": [
"TypeScript"
]
},
"owner": {
"blog": "https://robosystems.ai",
"name": "RFS",
"type": "Organization",
"login": "RoboFinSystems",
"company": null,
"location": "United States of America",
"followers": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/213902224?v=4",
"created_at": "2025-05-29T03:16:13Z",
"is_verified": null,
"public_repos": 12,
"account_age_days": 414
},
"activity": {
"releases_count": 100,
"commits_last_year": 473,
"latest_release_at": "2026-07-13T02:19:57Z",
"latest_release_tag": "v0.5.1",
"releases_from_tags": false,
"days_since_last_push": 3,
"active_weeks_last_year": 42,
"days_since_latest_release": 4,
"mean_days_between_releases": 5
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 62,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "@robosystems/client",
"exists": true,
"license": "MIT",
"keywords": [
"robosystems",
"financial",
"graph",
"api",
"sdk",
"typescript",
"knowledge-graph"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/@robosystems/client",
"is_deprecated": false,
"latest_version": "0.5.1",
"repository_url": "git+https://github.com/RoboFinSystems/robosystems-typescript-client.git",
"versions_count": 109,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 2648,
"first_published_at": "2025-08-11T04:22:30.887000Z",
"latest_published_at": "2026-07-13T02:20:22.909000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 4
}
]
},
"popularity": {
"forks": 0,
"stars": 1,
"watchers": 0,
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"tsconfig.json"
],
"largest_source_bytes": 507684,
"source_files_sampled": 90,
"oversized_source_files": 4,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"package.json"
],
"ecosystems": [
"npm"
],
"dependencies": [
{
"name": "@graphql-typed-document-node/core",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^3.2.0"
},
{
"name": "graphql",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^16.13.2"
},
{
"name": "graphql-request",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^7.4.0"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "@graphql-typed-document-node/core",
"direct": true,
"version": "^3.2.0",
"ecosystem": "npm"
},
{
"name": "graphql",
"direct": true,
"version": "^16.13.2",
"ecosystem": "npm"
},
{
"name": "graphql-request",
"direct": true,
"version": "^7.4.0",
"ecosystem": "npm"
},
{
"name": "@eslint/js",
"direct": false,
"version": "^9.39.2",
"ecosystem": "npm"
},
{
"name": "@graphql-codegen/cli",
"direct": false,
"version": "^6.3.0",
"ecosystem": "npm"
},
{
"name": "@graphql-codegen/typed-document-node",
"direct": false,
"version": "^6.1.8",
"ecosystem": "npm"
},
{
"name": "@graphql-codegen/typescript",
"direct": false,
"version": "^5.0.10",
"ecosystem": "npm"
},
{
"name": "@graphql-codegen/typescript-operations",
"direct": false,
"version": "^5.1.0",
"ecosystem": "npm"
},
{
"name": "@hey-api/openapi-ts",
"direct": false,
"version": "^0.97.3",
"ecosystem": "npm"
},
{
"name": "@testing-library/react",
"direct": false,
"version": "^16.3.0",
"ecosystem": "npm"
},
{
"name": "@types/node",
"direct": false,
"version": "^22.0.0",
"ecosystem": "npm"
},
{
"name": "@types/react",
"direct": false,
"version": "^19.1.9",
"ecosystem": "npm"
},
{
"name": "@typescript-eslint/eslint-plugin",
"direct": false,
"version": "^8.0.0",
"ecosystem": "npm"
},
{
"name": "@typescript-eslint/parser",
"direct": false,
"version": "^8.0.0",
"ecosystem": "npm"
},
{
"name": "eslint",
"direct": false,
"version": "^9.39.2",
"ecosystem": "npm"
},
{
"name": "eslint-config-prettier",
"direct": false,
"version": "^10.0.0",
"ecosystem": "npm"
},
{
"name": "eslint-plugin-prettier",
"direct": false,
"version": "^5.0.0",
"ecosystem": "npm"
},
{
"name": "happy-dom",
"direct": false,
"version": "^20.0.8",
"ecosystem": "npm"
},
{
"name": "prettier",
"direct": false,
"version": "^3.0.0",
"ecosystem": "npm"
},
{
"name": "prettier-plugin-organize-imports",
"direct": false,
"version": "^4.0.0",
"ecosystem": "npm"
},
{
"name": "react",
"direct": false,
"version": "^19.2.0",
"ecosystem": "npm"
},
{
"name": "react-dom",
"direct": false,
"version": "^19.2.0",
"ecosystem": "npm"
},
{
"name": "typescript",
"direct": false,
"version": "^5.7.2",
"ecosystem": "npm"
},
{
"name": "typescript-eslint",
"direct": false,
"version": "^8.54.0",
"ecosystem": "npm"
},
{
"name": "vitest",
"direct": false,
"version": "^4.1.4",
"ecosystem": "npm"
}
],
"collected": true,
"truncated": false,
"total_count": 25,
"direct_count": 3,
"indirect_count": 22
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 146,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 2
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "jfrench9",
"commits": 372,
"avatar_url": "https://avatars.githubusercontent.com/u/2874579?u=72aa47f7b2e4da66645e5b578ba0bc867132082f&v=4"
},
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 101,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
}
],
"contributors_sampled": 2,
"top_contributor_share": 0.786
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"claude.yml",
"create-release.yml",
"publish.yml",
"tag-release.yml",
"test.yml"
],
"has_docs_dir": false,
"linter_configs": [
"eslint.config.mjs"
],
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 3,
"reason": "branch protection is not maximal on development and all release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 10,
"reason": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/15 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 6,
"reason": "project has 2 contributing companies or organizations -- score normalized to 6",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "511fbde71838bd6ca27c0f727f7e5205f0c47502",
"ran_at": "2026-07-17T15:44:06Z",
"aggregate_score": 5.3,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/robofinsystems/robosystems-typescript-client",
"host": "github.com",
"name": "robosystems-typescript-client",
"owner": "robofinsystems"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 65,
"inputs": {
"security": 53,
"vitality": 96,
"community": 39,
"governance": 56,
"engineering": 76
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 96,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 93,
"inputs": {
"commits_last_year": 473,
"human_commit_share": null,
"days_since_last_push": 3,
"active_weeks_last_year": 42
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 3 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 3
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "42/52 weeks with commits",
"points": 29.1,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 42
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "473 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 473
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 100,
"inputs": {
"releases_count": 100,
"latest_release_tag": "v0.5.1",
"releases_from_tags": false,
"days_since_latest_release": 4,
"mean_days_between_releases": 5
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~5 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 5
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 39,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 0,
"stars": 1,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "1 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 1
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "0 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 0
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 70,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 57,
"inputs": {
"packages": [
"@robosystems/client"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 2648
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "2,648 downloads/month across npm",
"points": 45.6,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 2648,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 56,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 22,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 2,
"top_contributor_share": 0.786
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 79% of commits",
"points": 4.8,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 79
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "2 contributors",
"points": 2.7,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 2
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 2 contributing companies or organizations -- score normalized to 6",
"points": 6,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "good",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 71,
"inputs": {
"merged_prs": 146,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 2
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "146/148 decided PRs merged",
"points": 37.7,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 146,
"decided": 148
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/15 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "at_risk",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 46,
"inputs": {
"followers": 5,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "RoboFinSystems",
"public_repos": 12,
"account_age_days": 414
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "5 followers of RoboFinSystems",
"points": 5.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 5,
"login": "RoboFinSystems"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "12 public repos, account ~1 yr old",
"points": 10.4,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 12
}
},
{
"code": "account_age_years",
"params": {
"years": 1
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"@robosystems/client"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 4
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 4 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 4
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "109 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 109
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "good",
"name": "Engineering Quality",
"value": 76,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "good",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 84,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "5 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 5
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": "eslint.config.mjs",
"points": 16,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "eslint.config.mjs"
}
}
],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
"points": 20,
"status": "met",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 65,
"inputs": {
"topics": [
"javascript",
"typescript",
"client",
"financial",
"graph",
"sdk",
"financial-data",
"financial-analysis",
"accounting",
"robosystems",
"graph-api"
],
"has_wiki": false,
"homepage": "https://www.npmjs.com/package/@robosystems/client",
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://www.npmjs.com/package/@robosystems/client",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "11 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 11
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 53,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"packaging",
"signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 53,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5.3
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection is not maximal on development and all release branches",
"points": 2.2,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/15 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 2 contributing companies or organizations -- score normalized to 6",
"points": 1.5,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 2
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 43,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "moderate",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 54,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": true,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [
"tsconfig.json"
],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": "eslint.config.mjs",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "eslint.config.mjs"
}
}
],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "excellent",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 98,
"inputs": {
"primary_language": "TypeScript",
"largest_source_bytes": 507684,
"source_files_sampled": 90,
"oversized_source_files": 4
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "TypeScript (statically typed)",
"points": 45,
"status": "met",
"details": [
{
"code": "statically_typed_language",
"params": {
"language": "TypeScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "4/90 source files over 60KB",
"points": 52.6,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 90,
"oversized": 4
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-17T15:44:19.016393Z",
"schema_version": "0.12.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/robofinsystems/robosystems-typescript-client.svg",
"full_name": "robofinsystems/robosystems-typescript-client",
"license_state": "standard",
"license_spdx": "MIT"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.12.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm.