Registro público
Informe de salud del softwareesquema 0.12.0 · métricas 1.13.0 · 2026-07-17 15:44 UTC

robofinsystems / robosystems-typescript-client

Official TypeScript Client for the RoboSystems Financial Knowledge Graph API. Access comprehensive financial data including accounting transactions, financial reports, and advanced graph analytics through a type-safe, modern TypeScript interface.

TypeScriptMIT★ 1 estrella⑂ 0 forksdesde ago 2025Ver en GitHub ↗

robofinsystems/robosystems-typescript-client tiene un índice de salud de 65 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (96/100) y la más baja, Community & Adoption (39/100). Se actualizó por última vez hace 3 días. Una sola persona concentra la mayor parte del trabajo reciente.

65
global / 100
Moderado

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

65
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

RFSOrganización
5 seguidores12 repositorios públicosdesde may 2025

Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
npm@robosystems/client0.5.12648109hace 4 díasrobosystemsfinancialgraphapisdktypescriptknowledge-graph

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

96Excelente · 22% del índice global
Cómo se puntúa
36/36Recencia de push — último push hace 3 días
29.1/36Cadencia de commits — 42/52 semanas con commits
18/18Volumen de commits — 473 commits en el último año
10/10OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
Datos de entrada utilizados
commits_last_year473
human_commit_share
days_since_last_push3
active_weeks_last_year42
Cómo se puntúa
27/27Publica versiones — 100 versiones publicadas
36/36Recencia de las versiones — última versión hace 4 días
27/27Cadencia de publicación — una versión cada ~5 días
0/10OpenSSF Scorecard: Signed-Releases — sin datos
Datos de entrada utilizados
releases_count100
latest_release_tagv0.5.1
releases_from_tagsno
days_since_latest_release4
mean_days_between_releases5
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

39En riesgo · 18% del índice global
Cómo se puntúa
0/60Estrellas — 1 estrellas
0/25Forks — 0 forks
0/15Observadores — 0 observadores
Datos de entrada utilizados
forks0
stars1
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Cómo se puntúa
22.5/22.5README
22.5/22.5Licencia — licencia reconocida (MIT)
18/18Guía CONTRIBUTING
0/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributing
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno
Cómo se puntúa
45.6/80Descargas mensuales — 2648 descargas/mes en npm
0/20Dependientes en el registro — no lo informa este ecosistema
Datos de entrada utilizados
packages@robosystems/client
dependents
ecosystemsnpm
total_downloads
monthly_downloads2648
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

56Moderado · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
4.8/22.5Distribución de commits — el principal contribuyente firma el 79% de los commits
2.7/13.5Amplitud de contribuyentes — 2 contribuyentes
6/10OpenSSF Scorecard: Contributors — project has 2 contributing companies or organizations -- score normalized to 6
Datos de entrada utilizados
bus_factor1
contributors_sampled2
top_contributor_share0,786
Cómo se puntúa
0/46.8Resolución de issues — sin issues o sin datos
37.7/38.3Aceptación de PR — 146/148 PR decididos fusionados
0/15OpenSSF Scorecard: Code-Review — Found 0/15 approved changesets -- score normalized to 0
Datos de entrada utilizados
merged_prs146
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs2
Excluidos de la puntuación (sin datos o no aplicable): Resolución de issues. Los pesos restantes se han renormalizado.
Cómo se puntúa
30/30Respaldo de la propiedad — propiedad de una organización
0/20Dominio verificado
5.6/25Alcance del propietario — 5 seguidores de RoboFinSystems
10.4/25Trayectoria — 12 repos públicos, cuenta de ~1 años
Datos de entrada utilizados
followers5
owner_typeOrganization
is_verified
owner_loginRoboFinSystems
public_repos12
account_age_days414
Cómo se puntúa
25/25Publicado y resoluble — 1 paquete(s) en npm
35/35Recencia de publicación — última publicación hace 4 días
20/20Historial de versiones — 109 versiones en el registro
20/20No obsoleto — activo, ni obsoleto ni retirado
Datos de entrada utilizados
packages@robosystems/client
ecosystemsnpm
any_deprecatedno
min_days_since_publish4

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

76Bueno · 20% del índice global
Cómo se puntúa
24/24Flujos de trabajo de CI — 5 flujo(s) de trabajo
24/24Pruebas presentes
16/16Configuración de linter — eslint.config.mjs
0/9.6Hooks de pre-commit
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 8 out of 8 merged PRs checked by a CI test -- score normalized to 10
Datos de entrada utilizados
has_ci
has_tests
has_editorconfigno
has_linter_config
has_precommit_configno

Documentación

65Moderado
Cómo se puntúa
30/30README
0/25Directorio de documentación
15/15Sitio de documentación / página del proyecto — https://www.npmjs.com/package/@robosystems/client
10/10Descripción del repositorio
10/10Topics — 11 topics
0/10Wiki
Datos de entrada utilizados
topicsjavascript, typescript, client, financial, graph, sdk, financial-data, financial-analysis, accounting, robosystems, graph-api
has_wikino
homepagehttps://www.npmjs.com/package/@robosystems/client
has_readme
has_docs_dirno
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

53Moderado · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
2.2/7.5Branch-Protection — branch protection is not maximal on development and all release branches
2.5/2.5CI-Tests — 8 out of 8 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/15 approved changesets -- score normalized to 0
1.5/2.5Contributors — project has 2 contributing companies or organizations -- score normalized to 6
10/10Dangerous-Workflow — no dangerous workflow patterns detected
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Licencia — license file detected
7.5/7.5Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
0/5Packaging — sin datos
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — sin datos
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated16
scorecard_versionv5.5.0
checks_inconclusive2
scorecard_aggregate5,3
Excluidos de la puntuación (sin datos o no aplicable): packaging, signed_releases. Los pesos restantes se han renormalizado.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

43En riesgo · 0% del índice global
Cómo se puntúa
0/45Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor
0/15Documentación legible por máquinas (llms.txt)
0/40Historial de commits legible — sin datos
Datos de entrada utilizados
has_llms_txtno
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Excluidos de la puntuación (sin datos o no aplicable): Historial de commits legible. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/18Arranque con un solo comando
22/22Pruebas automatizadas
11/11Configuración de lint / formato — eslint.config.mjs
11/11Verificación estática de tipos — tsconfig.json
0/10Entorno reproducible
0/10Práctica demostrada con agentes — sin datos
5/8Mantenimiento automatizado — automatización de dependencias configurada, no observada en los commits muestreados
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Datos de entrada utilizados
has_nixno
has_tests
lockfiles
has_dockerfileno
typed_language
bootstrap_files
has_devcontainerno
has_linter_config
typecheck_configstsconfig.json
agent_commit_share
toolchain_manifests
dependency_bot_commit_share0
Excluidos de la puntuación (sin datos o no aplicable): Práctica demostrada con agentes. Los pesos restantes se han renormalizado.
Cómo se puntúa
45/45Código verificable por tipos — TypeScript (tipado estático)
52.6/55Tamaños de archivo manejables — 4/90 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languageTypeScript
largest_source_bytes507.684
source_files_sampled90
oversized_source_files4

Datos clave

1estrellas de GitHub
2contribuidores
473commits en los últimos 12 meses
3días desde el último push
100versiones publicadas
1factor bus
0issues abiertas
npmecosistemas de paquetes

Más detalle

OpenSSF Scorecard 5.3 / 10
5.3agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-17 15:44 UTC

10Binary-Artifactsno binaries found in the repo
3Branch-Protectionbranch protection is not maximal on development and all release branches
10CI-Tests8 out of 8 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/15 approved changesets -- score normalized to 0
6Contributorsproject has 2 contributing companies or organizations -- score normalized to 6
10Dangerous-Workflowno dangerous workflow patterns detected
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
10Maintained30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
n/dPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
n/dSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Dependencias directas 3
RegistroPaqueteRestricción de versiónManifiesto
npm@graphql-typed-document-node/core^3.2.0package.json
npmgraphql^16.13.2package.json
npmgraphql-request^7.4.0package.json
Todas las dependencias 25

Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 3 paquetes directos y 22 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.

RegistroPaqueteVersiónRelación
npm@graphql-typed-document-node/core^3.2.0directa
npmgraphql^16.13.2directa
npmgraphql-request^7.4.0directa
npm@eslint/js^9.39.2indirecta
npm@graphql-codegen/cli^6.3.0indirecta
npm@graphql-codegen/typed-document-node^6.1.8indirecta
npm@graphql-codegen/typescript^5.0.10indirecta
npm@graphql-codegen/typescript-operations^5.1.0indirecta
npm@hey-api/openapi-ts^0.97.3indirecta
npm@testing-library/react^16.3.0indirecta
npm@types/node^22.0.0indirecta
npm@types/react^19.1.9indirecta
npm@typescript-eslint/eslint-plugin^8.0.0indirecta
npm@typescript-eslint/parser^8.0.0indirecta
npmeslint^9.39.2indirecta
npmeslint-config-prettier^10.0.0indirecta
npmeslint-plugin-prettier^5.0.0indirecta
npmhappy-dom^20.0.8indirecta
npmprettier^3.0.0indirecta
npmprettier-plugin-organize-imports^4.0.0indirecta
npmreact^19.2.0indirecta
npmreact-dom^19.2.0indirecta
npmtypescript^5.7.2indirecta
npmtypescript-eslint^8.54.0indirecta
npmvitest^4.1.4indirecta
Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [
        "javascript",
        "typescript",
        "client",
        "financial",
        "graph",
        "sdk",
        "financial-data",
        "financial-analysis",
        "accounting",
        "robosystems",
        "graph-api"
      ],
      "is_fork": false,
      "size_kb": 1880,
      "has_wiki": false,
      "homepage": "https://www.npmjs.com/package/@robosystems/client",
      "languages": {
        "Shell": 7385,
        "JavaScript": 11515,
        "TypeScript": 1484040
      },
      "pushed_at": "2026-07-14T08:37:13Z",
      "created_at": "2025-08-10T20:32:33Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-14T08:37:15Z",
      "description": "Official TypeScript Client for the RoboSystems Financial Knowledge Graph API. Access comprehensive financial data including accounting transactions, financial reports, and advanced graph analytics through a type-safe, modern TypeScript interface.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "primary_language": "TypeScript",
      "significant_languages": [
        "TypeScript"
      ]
    },
    "owner": {
      "blog": "https://robosystems.ai",
      "name": "RFS",
      "type": "Organization",
      "login": "RoboFinSystems",
      "company": null,
      "location": "United States of America",
      "followers": 5,
      "avatar_url": "https://avatars.githubusercontent.com/u/213902224?v=4",
      "created_at": "2025-05-29T03:16:13Z",
      "is_verified": null,
      "public_repos": 12,
      "account_age_days": 414
    },
    "activity": {
      "releases_count": 100,
      "commits_last_year": 473,
      "latest_release_at": "2026-07-13T02:19:57Z",
      "latest_release_tag": "v0.5.1",
      "releases_from_tags": false,
      "days_since_last_push": 3,
      "active_weeks_last_year": 42,
      "days_since_latest_release": 4,
      "mean_days_between_releases": 5
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": true,
      "health_percentage": 62,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "@robosystems/client",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "robosystems",
            "financial",
            "graph",
            "api",
            "sdk",
            "typescript",
            "knowledge-graph"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/@robosystems/client",
          "is_deprecated": false,
          "latest_version": "0.5.1",
          "repository_url": "git+https://github.com/RoboFinSystems/robosystems-typescript-client.git",
          "versions_count": 109,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 2648,
          "first_published_at": "2025-08-11T04:22:30.887000Z",
          "latest_published_at": "2026-07-13T02:20:22.909000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 4
        }
      ]
    },
    "popularity": {
      "forks": 0,
      "stars": 1,
      "watchers": 0,
      "open_issues_and_prs": 0
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "largest_source_bytes": 507684,
      "source_files_sampled": 90,
      "oversized_source_files": 4,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "ecosystems": [
        "npm"
      ],
      "dependencies": [
        {
          "name": "@graphql-typed-document-node/core",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^3.2.0"
        },
        {
          "name": "graphql",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^16.13.2"
        },
        {
          "name": "graphql-request",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^7.4.0"
        }
      ],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@graphql-typed-document-node/core",
            "direct": true,
            "version": "^3.2.0",
            "ecosystem": "npm"
          },
          {
            "name": "graphql",
            "direct": true,
            "version": "^16.13.2",
            "ecosystem": "npm"
          },
          {
            "name": "graphql-request",
            "direct": true,
            "version": "^7.4.0",
            "ecosystem": "npm"
          },
          {
            "name": "@eslint/js",
            "direct": false,
            "version": "^9.39.2",
            "ecosystem": "npm"
          },
          {
            "name": "@graphql-codegen/cli",
            "direct": false,
            "version": "^6.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "@graphql-codegen/typed-document-node",
            "direct": false,
            "version": "^6.1.8",
            "ecosystem": "npm"
          },
          {
            "name": "@graphql-codegen/typescript",
            "direct": false,
            "version": "^5.0.10",
            "ecosystem": "npm"
          },
          {
            "name": "@graphql-codegen/typescript-operations",
            "direct": false,
            "version": "^5.1.0",
            "ecosystem": "npm"
          },
          {
            "name": "@hey-api/openapi-ts",
            "direct": false,
            "version": "^0.97.3",
            "ecosystem": "npm"
          },
          {
            "name": "@testing-library/react",
            "direct": false,
            "version": "^16.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "@types/node",
            "direct": false,
            "version": "^22.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "@types/react",
            "direct": false,
            "version": "^19.1.9",
            "ecosystem": "npm"
          },
          {
            "name": "@typescript-eslint/eslint-plugin",
            "direct": false,
            "version": "^8.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "@typescript-eslint/parser",
            "direct": false,
            "version": "^8.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint",
            "direct": false,
            "version": "^9.39.2",
            "ecosystem": "npm"
          },
          {
            "name": "eslint-config-prettier",
            "direct": false,
            "version": "^10.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint-plugin-prettier",
            "direct": false,
            "version": "^5.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "happy-dom",
            "direct": false,
            "version": "^20.0.8",
            "ecosystem": "npm"
          },
          {
            "name": "prettier",
            "direct": false,
            "version": "^3.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "prettier-plugin-organize-imports",
            "direct": false,
            "version": "^4.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "react",
            "direct": false,
            "version": "^19.2.0",
            "ecosystem": "npm"
          },
          {
            "name": "react-dom",
            "direct": false,
            "version": "^19.2.0",
            "ecosystem": "npm"
          },
          {
            "name": "typescript",
            "direct": false,
            "version": "^5.7.2",
            "ecosystem": "npm"
          },
          {
            "name": "typescript-eslint",
            "direct": false,
            "version": "^8.54.0",
            "ecosystem": "npm"
          },
          {
            "name": "vitest",
            "direct": false,
            "version": "^4.1.4",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 25,
        "direct_count": 3,
        "indirect_count": 22
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 146,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 2
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "jfrench9",
          "commits": 372,
          "avatar_url": "https://avatars.githubusercontent.com/u/2874579?u=72aa47f7b2e4da66645e5b578ba0bc867132082f&v=4"
        },
        {
          "type": "Bot",
          "login": "github-actions[bot]",
          "commits": 101,
          "avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
        }
      ],
      "contributors_sampled": 2,
      "top_contributor_share": 0.786
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "claude.yml",
        "create-release.yml",
        "publish.yml",
        "tag-release.yml",
        "test.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [
        "eslint.config.mjs"
      ],
      "has_editorconfig": false,
      "has_linter_config": true,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 3,
            "reason": "branch protection is not maximal on development and all release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/15 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 6,
            "reason": "project has 2 contributing companies or organizations -- score normalized to 6",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 10,
            "reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "511fbde71838bd6ca27c0f727f7e5205f0c47502",
        "ran_at": "2026-07-17T15:44:06Z",
        "aggregate_score": 5.3,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": true
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/robofinsystems/robosystems-typescript-client",
    "host": "github.com",
    "name": "robosystems-typescript-client",
    "owner": "robofinsystems"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 65,
      "inputs": {
        "security": 53,
        "vitality": 96,
        "community": 39,
        "governance": 56,
        "engineering": 76
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "excellent",
        "name": "Vitality",
        "value": 96,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "excellent",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 93,
            "inputs": {
              "commits_last_year": 473,
              "human_commit_share": null,
              "days_since_last_push": 3,
              "active_weeks_last_year": 42
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 3 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 3
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "42/52 weeks with commits",
                "points": 29.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 42
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "473 commits in the last year",
                "points": 18,
                "status": "met",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 473
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "releases_count": 100,
              "latest_release_tag": "v0.5.1",
              "releases_from_tags": false,
              "days_since_latest_release": 4,
              "mean_days_between_releases": 5
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "100 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 100
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~5 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 5
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "no_commit_sample",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 39,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 0,
              "stars": 1,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "0 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "good",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 70,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": true,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 18,
                "status": "met",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 57,
            "inputs": {
              "packages": [
                "@robosystems/client"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 2648
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "2,648 downloads/month across npm",
                "points": 45.6,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 2648,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 56,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 22,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 2,
              "top_contributor_share": 0.786
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 79% of commits",
                "points": 4.8,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 79
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "2 contributors",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 2 contributing companies or organizations -- score normalized to 6",
                "points": 6,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "good",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 71,
            "inputs": {
              "merged_prs": 146,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 2
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "146/148 decided PRs merged",
                "points": 37.7,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 146,
                      "decided": 148
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/15 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "at_risk",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 46,
            "inputs": {
              "followers": 5,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "RoboFinSystems",
              "public_repos": 12,
              "account_age_days": 414
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "5 followers of RoboFinSystems",
                "points": 5.6,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 5,
                      "login": "RoboFinSystems"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "12 public repos, account ~1 yr old",
                "points": 10.4,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 12
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 1
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "@robosystems/client"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 4
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 4 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "109 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 109
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "good",
        "name": "Engineering Quality",
        "value": 76,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "good",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 84,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": true,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "5 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": "eslint.config.mjs",
                "points": 16,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "eslint.config.mjs"
                    }
                  }
                ],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 65,
            "inputs": {
              "topics": [
                "javascript",
                "typescript",
                "client",
                "financial",
                "graph",
                "sdk",
                "financial-data",
                "financial-analysis",
                "accounting",
                "robosystems",
                "graph-api"
              ],
              "has_wiki": false,
              "homepage": "https://www.npmjs.com/package/@robosystems/client",
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": "https://www.npmjs.com/package/@robosystems/client",
                "points": 15,
                "status": "met",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "11 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 11
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 53,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "moderate",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 53,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 16,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 2,
              "scorecard_aggregate": 5.3
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection is not maximal on development and all release branches",
                "points": 2.2,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/15 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 2 contributing companies or organizations -- score normalized to 6",
                "points": 1.5,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 2
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "at_risk",
        "name": "AI Readiness",
        "value": 43,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "moderate",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 54,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": true,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": "eslint.config.mjs",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "eslint.config.mjs"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "dependency automation configured, none observed in the sampled commits",
                "points": 5,
                "status": "partial",
                "details": [
                  {
                    "code": "dependency_bot_config_only",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 98,
            "inputs": {
              "primary_language": "TypeScript",
              "largest_source_bytes": 507684,
              "source_files_sampled": 90,
              "oversized_source_files": 4
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "TypeScript (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "TypeScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "4/90 source files over 60KB",
                "points": 52.6,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 90,
                      "oversized": 4
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [],
  "report_type": "repository",
  "generated_at": "2026-07-17T15:44:19.016393Z",
  "schema_version": "0.12.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/robofinsystems/robosystems-typescript-client.svg",
  "full_name": "robofinsystems/robosystems-typescript-client",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.12.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasnpm.