Run AI models locally on your machine with node.js bindings for llama.cpp. Enforce a JSON schema on the model output on the generation level
therealtimex/node-llama-cpp erreicht einen Gesundheitsindex von 62 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Vitality (88/100) ab, am schwächsten bei Community & Adoption (28/100). Zuletzt vor 2 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
Metriken werden auf einer standardisierten Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr gewichtetes Mittel, kalibriert auf die Verteilung des öffentlichen Registers, sodass die Stufen Perzentilbedeutung tragen; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze Gefährdet von 34.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Der gewichtete Gesamtwert 58 wird auf der veröffentlichten Indexskala auf 62 kalibriert (Register-Kalibrierung 2026-08-02).
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | @realtimex/node-llama-cpp | 0.283.0 | 41.206 | 278 | vor 2 Tagen | llamallama-cppllama.cppbindingsaicmakecmake-jsprebuilt-binariesllmggufmetalcudavulkangrammarembeddingrerankrerankingjson-grammarjson-schema-grammarfunctionsfunction-callingtoken-predictionspeculative-decodingtemperatureminptopktoppseedxtcjson-schemaraspberry-piself-hostedlocalcataimistraldeepseekqwenqwqgptgpt-osstypescriptlorabatchinggpu |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 2 Tagen |
| 21.5/36 | Commit-Rhythmus — 31/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 507 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 1 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 507 |
| human_commit_share | — |
| days_since_last_push | 2 |
| active_weeks_last_year | 31 |
| 27/27 | Liefert Releases aus — 100 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 22 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 0,3 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 100 |
| latest_release_tag | realtimex-v0.239.0 |
| releases_from_tags | nein |
| days_since_latest_release | 22 |
| mean_days_between_releases | 0,3 |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 0/60 | Stars — 1 Stars |
| 0/25 | Forks — 0 Forks |
| 0/15 | Watcher — 0 Watcher |
| forks | 0 |
| stars | 1 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 0/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
| has_readme | nein |
| has_license | nein |
| readme_badges | — |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| readme_badge_services | — |
| has_pull_request_template | nein |
| 61.5/80 | Downloads pro Monat — 41.206 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
| packages | @realtimex/node-llama-cpp |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 41.206 |
| unverified_packages_excluded | — |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 8.9/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 61 % der Commits |
| 13.5/13.5 | Breite der Beitragenden — 14 Beitragende |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 1 |
| contributors_sampled | 14 |
| top_contributor_share | 0,606 |
| 42/42 | Issue-Lösungsquote — 100 % der Issues geschlossen |
| 30/30 | PR-Annahme — 5/5 entschiedene PRs gemergt |
| 0/13 | Newcomer PR acceptance — kein PR eines Erstbeitragenden in 30 Tagen entschieden |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 5 |
| open_issues | 0 |
| closed_issues | 1 |
| prs_merged_7d | — |
| prs_decided_7d | — |
| prs_merged_30d | — |
| prs_decided_30d | — |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 0 |
| first_time_authors_30d | — |
| first_time_prs_merged_30d | — |
| first_time_prs_decided_30d | — |
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 8.7/25 | Reichweite des Inhabers — 15 Follower von therealtimex |
| 18.1/25 | Kontohistorie — 1.083 öffentliche Repos, Kontoalter ca. 2 Jahre |
| followers | 15 |
| owner_type | User |
| is_verified | — |
| owner_login | therealtimex |
| public_repos | 1.083 |
| account_age_days | 938 |
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 2 Tagen |
| 20/20 | Versionshistorie — 278 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | @realtimex/node-llama-cpp |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 2 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 24/24 | CI-Workflows — 4 Workflow(s) |
| 24/24 | Tests vorhanden |
| 16/16 | Linter-Konfiguration — eslint.config.js |
| 0/9.6 | Pre-Commit-Hooks |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — keine Daten |
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | ja |
| has_linter_config | ja |
| has_precommit_config | nein |
| 0/30 | README |
| 25/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://realtimex.ai |
| 0/10 | Repository-Beschreibung |
| 0/10 | Topics |
| 0/10 | Wiki |
| topics | — |
| has_wiki | nein |
| homepage | https://realtimex.ai |
| docs_site | https://realtimex.ai |
| has_readme | nein |
| has_docs_dir | ja |
| has_description | nein |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — keine Daten |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 1 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 1.5/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 3 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 55 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 17 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 1 |
| scorecard_aggregate | 3,4 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Trägt ein bewusst kleines Gewicht (4 %): Agenten-Tooling ist ein echtes Pflegesignal, doch ein Repository ohne jedes Signal kann weiterhin 100/100 erreichen.
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
| has_llms_txt | nein |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 11/11 | Lint-/Format-Konfiguration — eslint.config.js |
| 11/11 | Statische Typprüfung — .vitepress/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-arm64/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-armv7l/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64-cuda-ext/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64-cuda/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64-vulkan/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64/tsconfig.json, packages/@realtimex/node-llama-cpp-mac-arm64-metal/tsconfig.json, packages/@realtimex/node-llama-cpp-mac-x64/tsconfig.json, packages/@realtimex/node-llama-cpp-win-arm64/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64-cuda-ext/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64-cuda/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64-vulkan/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64/tsconfig.json, packages/create-node-llama-cpp/tsconfig.json, templates/electron-typescript-react/tsconfig.json, templates/node-typescript/tsconfig.json, tsconfig.json |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 0/8 | Automatisierte Wartung — keine Daten |
| 3/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 3 |
| has_nix | nein |
| has_tests | ja |
| lockfiles | package-lock.json |
| has_dockerfile | nein |
| typed_language | ja |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | ja |
| typecheck_configs | .vitepress/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-arm64/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-armv7l/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64-cuda-ext/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64-cuda/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64-vulkan/tsconfig.json, packages/@realtimex/node-llama-cpp-linux-x64/tsconfig.json, packages/@realtimex/node-llama-cpp-mac-arm64-metal/tsconfig.json, packages/@realtimex/node-llama-cpp-mac-x64/tsconfig.json, packages/@realtimex/node-llama-cpp-win-arm64/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64-cuda-ext/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64-cuda/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64-vulkan/tsconfig.json, packages/@realtimex/node-llama-cpp-win-x64/tsconfig.json, packages/create-node-llama-cpp/tsconfig.json, templates/electron-typescript-react/tsconfig.json, templates/node-typescript/tsconfig.json, tsconfig.json |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 45/45 | Typprüfbarer Code — TypeScript (statisch typisiert) |
| 54.3/55 | Handhabbare Dateigrößen — 6/477 Quelldateien über 60 KB |
| primary_language | TypeScript |
| largest_source_bytes | 184.012 |
| source_files_sampled | 477 |
| oversized_source_files | 6 |
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| k. A. | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 1 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 3 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 3 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 55 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| npm | @huggingface/jinja | ^0.5.6 | package.json |
| npm | async-retry | ^1.3.3 | package.json |
| npm | bytes | ^3.1.2 | package.json |
| npm | chalk | ^5.6.2 | package.json |
| npm | chmodrp | ^1.0.2 | package.json |
| npm | cmake-js | ^8.0.0 | package.json |
| npm | cross-spawn | ^7.0.6 | package.json |
| npm | env-var | ^7.5.0 | package.json |
| npm | filenamify | ^6.0.0 | package.json |
| npm | fs-extra | ^11.3.4 | package.json |
| npm | ignore | ^7.0.4 | package.json |
| npm | ipull | ^3.9.5 | package.json |
| npm | is-unicode-supported | ^2.1.0 | package.json |
| npm | lifecycle-utils | ^3.1.1 | package.json |
| npm | log-symbols | ^7.0.1 | package.json |
| npm | nanoid | ^5.1.6 | package.json |
| npm | node-addon-api | ^8.6.0 | package.json |
| npm | ora | ^9.3.0 | package.json |
| npm | pretty-ms | ^9.3.0 | package.json |
| npm | proper-lockfile | ^4.1.2 | package.json |
| npm | semver | ^7.7.1 | package.json |
| npm | simple-git | 3.33.0 | package.json |
| npm | slice-ansi | ^8.0.0 | package.json |
| npm | stdout-update | ^4.0.1 | package.json |
| npm | strip-ansi | ^7.2.0 | package.json |
| npm | validate-npm-package-name | ^7.0.2 | package.json |
| npm | which | ^6.0.1 | package.json |
| npm | yargs | ^17.7.2 | package.json |
Der aufgelöste Abhängigkeitssatz konnte für diesen Bericht nicht erhoben werden: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Stimmt etwas in diesem Bericht nicht, oder gibt es Gedanken dazu? Falsche Messungen, übersehene Tools, Ideen, Fragen — alles ist willkommen. Jede Nachricht wird gelesen und beantwortet.
Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v2.10.0, Schema v0.11.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm.