Registro público
Informe de salud del softwareesquema 0.26.0 · métricas 1.13.0 · 2026-07-22 10:04 UTC

alva-ai / toolkit-ts

Better UX/DX/AX for Alva

TypeScriptMIT★ 0 estrellas⑂ 0 forksdesde abr 2026Ver en GitHub ↗

alva-ai/toolkit-ts tiene un índice de salud de 59 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (81/100) y la más baja, Community & Adoption (34/100). Se actualizó por última vez hoy. Una sola persona concentra la mayor parte del trabajo reciente.

59
global / 100
Moderado

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

59
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

AlvaOrganización
24 seguidores5 repositorios públicosdesde sept 2023

Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
npm@alva-ai/toolkit0.18.0615045hace 4 díasalvasdkcliapifinancetradingquant

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

81Bueno · 22% del índice global
Cómo se puntúa
36/36Recencia de push — último push hace 0 días
11.1/36Cadencia de commits — 16/52 semanas con commits
18/18Volumen de commits — 157 commits en el último año
10/10OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
Datos de entrada utilizados
commits_last_year157
human_commit_share1
days_since_last_push0
active_weeks_last_year16
Cómo se puntúa
27/27Publica versiones — 2 versiones publicadas
27/36Recencia de las versiones — última versión hace 99 días
27/27Cadencia de publicación — una versión cada ~5,9 días
0/10OpenSSF Scorecard: Signed-Releases — sin datos
Datos de entrada utilizados
releases_count2
latest_release_tagv0.1.5
releases_from_tagsno
days_since_latest_release99
mean_days_between_releases5,9
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

34En riesgo · 18% del índice global
Cómo se puntúa
0/60Estrellas — 0 estrellas
0/25Forks — 0 forks
0/15Observadores — 0 observadores
Datos de entrada utilizados
forks0
stars0
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Cómo se puntúa
22.5/22.5README
22.5/22.5Licencia — licencia reconocida (MIT)
0/18Guía CONTRIBUTING
0/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributingno
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno
Cómo se puntúa
50.5/80Descargas mensuales — 6150 descargas/mes en npm
0/20Dependientes en el registro — no lo informa este ecosistema
Datos de entrada utilizados
packages@alva-ai/toolkit
dependents
ecosystemsnpm
total_downloads
monthly_downloads6150
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

65Moderado · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
10.9/22.5Distribución de commits — el principal contribuyente firma el 52% de los commits
10.8/13.5Amplitud de contribuyentes — 8 contribuyentes
0/10OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0
Datos de entrada utilizados
bus_factor1
contributors_sampled8
top_contributor_share0,516
Cómo se puntúa
46.8/46.8Resolución de issues — 100% de issues cerradas
36.2/38.3Aceptación de PR — 125/132 PR decididos fusionados
9/15OpenSSF Scorecard: Code-Review — Found 20/30 approved changesets -- score normalized to 6
Datos de entrada utilizados
merged_prs125
open_issues0
closed_issues2
issue_closed_ratio1
closed_unmerged_prs7
Cómo se puntúa
30/30Respaldo de la propiedad — propiedad de una organización
0/20Dominio verificado
10.1/25Alcance del propietario — 24 seguidores de alva-ai
11.4/25Trayectoria — 5 repos públicos, cuenta de ~2 años
Datos de entrada utilizados
followers24
owner_typeOrganization
is_verified
owner_loginalva-ai
public_repos5
account_age_days1044
Cómo se puntúa
25/25Publicado y resoluble — 1 paquete(s) en npm
35/35Recencia de publicación — última publicación hace 4 días
20/20Historial de versiones — 45 versiones en el registro
20/20No obsoleto — activo, ni obsoleto ni retirado
Datos de entrada utilizados
packages@alva-ai/toolkit
ecosystemsnpm
any_deprecatedno
min_days_since_publish4

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

67Moderado · 20% del índice global
Cómo se puntúa
24/24Flujos de trabajo de CI — 2 flujo(s) de trabajo
24/24Pruebas presentes
0/16Configuración de linter
0/9.6Hooks de pre-commit
0/6.4.editorconfig
14/20OpenSSF Scorecard: CI-Tests — 18 out of 23 merged PRs checked by a CI test -- score normalized to 7
Datos de entrada utilizados
has_ci
has_tests
has_editorconfigno
has_linter_configno
has_precommit_configno
Cómo se puntúa
30/30README
25/25Directorio de documentación
0/15Sitio de documentación / página del proyecto
10/10Descripción del repositorio
0/10Topics
10/10Wiki
Datos de entrada utilizados
topics
has_wiki
homepage
has_readme
has_docs_dir
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

38En riesgo · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
1.8/2.5CI-Tests — 18 out of 23 merged PRs checked by a CI test -- score normalized to 7
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
4.5/7.5Code-Review — Found 20/30 approved changesets -- score normalized to 6
0/2.5Contributors — project has 0 contributing companies or organizations -- score normalized to 0
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Licencia — license file detected
7.5/7.5Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
0/5Packaging — sin datos
1/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — sin datos
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
0/7.5Vulnerabilities — 13 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated16
scorecard_versionv5.5.0
checks_inconclusive2
scorecard_aggregate3,8
Excluidos de la puntuación (sin datos o no aplicable): packaging, signed_releases. Los pesos restantes se han renormalizado.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

57Moderado · 0% del índice global
Cómo se puntúa
0/45Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor
0/15Documentación legible por máquinas (llms.txt)
40/40Historial de commits legible — 81 de 100 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo)
Datos de entrada utilizados
has_llms_txtno
legible_history_share0,81
agent_instruction_files
agent_instruction_max_bytes
Cómo se puntúa
0/18Arranque con un solo comando
22/22Pruebas automatizadas
0/11Configuración de lint / formato
11/11Verificación estática de tipos — tsconfig.json
10/10Entorno reproducible — lockfile
10/10Práctica demostrada con agentes — 24 de los últimos 100 commits con autoría o crédito de agente
0/8Mantenimiento automatizado — no se observan actualizaciones automáticas de dependencias
2/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
Datos de entrada utilizados
has_nixno
has_tests
lockfilespackage-lock.json
has_dockerfileno
typed_language
bootstrap_files
has_devcontainerno
has_linter_configno
typecheck_configstsconfig.json
agent_commit_share0,24
toolchain_manifests
dependency_bot_commit_share0
Cómo se puntúa
45/45Código verificable por tipos — TypeScript (tipado estático)
54/55Tamaños de archivo manejables — 2/114 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languageTypeScript
largest_source_bytes149.849
source_files_sampled114
oversized_source_files2

Datos clave

0estrellas de GitHub
8contribuidores
157commits en los últimos 12 meses
0días desde el último push
2versiones publicadas
1factor bus
0issues abiertas
npmecosistemas de paquetes

Advertencias de recopilación de datos

  • GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
  • deps.dev does not index npm:@alva-ai/toolkit@0.18.0; advisories assessed against the repository dependency graph instead

Más detalle

OpenSSF Scorecard 3.8 / 10
3.8agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-22 10:04 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
7CI-Tests18 out of 23 merged PRs checked by a CI test -- score normalized to 7
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
6Code-ReviewFound 20/30 approved changesets -- score normalized to 6
0Contributorsproject has 0 contributing companies or organizations -- score normalized to 0
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
10Maintained30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
n/dPackagingpackaging workflow not detected
2Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 2
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
n/dSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
0Vulnerabilities13 existing vulnerabilities detected
Dependencias directas 3
RegistroPaqueteRestricción de versiónManifiesto
npmcss-tree^3.2.1package.json
npmundici^6.24.1package.json
npmyaml^2.9.0package.json
Todas las dependencias no recopilado

No fue posible recopilar el conjunto de dependencias resuelto para este informe: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [],
      "is_fork": false,
      "size_kb": 1531,
      "has_wiki": true,
      "homepage": null,
      "languages": {
        "HTML": 2712,
        "Shell": 9748,
        "JavaScript": 16547,
        "TypeScript": 850913
      },
      "pushed_at": "2026-07-22T05:01:33Z",
      "created_at": "2026-04-07T18:05:00Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-20T03:12:43Z",
      "description": "Better UX/DX/AX for Alva",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "TypeScript",
      "significant_languages": [
        "TypeScript"
      ]
    },
    "owner": {
      "blog": "alva.ai",
      "name": "Alva",
      "type": "Organization",
      "login": "alva-ai",
      "company": null,
      "location": null,
      "followers": 24,
      "avatar_url": "https://avatars.githubusercontent.com/u/144748577?v=4",
      "created_at": "2023-09-12T00:33:21Z",
      "is_verified": null,
      "public_repos": 5,
      "account_age_days": 1044
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v0.1.5",
          "kind": "patch",
          "published_at": "2026-04-14T02:13:25Z"
        },
        {
          "tag": "v0.1.1",
          "kind": "patch",
          "published_at": "2026-04-08T03:47:24Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "d3d2ad94a3755b6a491eb2cc74b187908e30bfa1",
          "body": "Co-authored-by: likun <kunli@alva.xyz>",
          "is_bot": false,
          "headline": "feat(deploy): expose cronjob execution timeout (#138)",
          "author_name": "likun666661",
          "author_login": "likun666661",
          "committed_at": "2026-07-20T03:12:39Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "73c7ee44db988764376efd83dbb14faec5decb11",
          "body": null,
          "is_bot": false,
          "headline": "v0.18.0",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-17T10:45:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4a95e30c3200ef10570256618a5dbabdf99a13f7",
          "body": null,
          "is_bot": false,
          "headline": "refactor(cli): remove legacy channel command (#137)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-17T10:32:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bd8f3545a0638f317cff5be16cdc58a9dba85d74",
          "body": "* feat(cli): infer current group subscription session\n\n* feat(cli): add explicit group alert commands",
          "is_bot": false,
          "headline": "feat(cli): add explicit group alert commands (#136)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-17T09:23:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fcb7c2203a931f04c9cdf0da5251028742adfe97",
          "body": null,
          "is_bot": false,
          "headline": "fix(cli): preserve broker stdin intent identity (#135)",
          "author_name": "Grayman",
          "author_login": "Lqz13Th",
          "committed_at": "2026-07-17T07:08:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0cd458b1ea9520aa9e5f3255d4df93e1f11e5259",
          "body": null,
          "is_bot": false,
          "headline": "feat(loop): publish loops as automations (#134)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-16T08:22:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "224243267415c16ba2bd410966b0d78517c08a49",
          "body": null,
          "is_bot": false,
          "headline": "v0.17.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-15T11:34:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8918080399685e4791fb3986dda0f5ea48c8f172",
          "body": "Align SDK types and CLI commands with the gateway FEED-only contract while keeping playbook follows independent.",
          "is_bot": false,
          "headline": "refactor(alerts): expose feed-only subscriptions (#132)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-13T13:38:01Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c4588b44832467fc54b8d861cfad4750a17f8edf",
          "body": "Expose ALFS append semantics through the public SDK and CLI so callers can opt into appending text or raw file content.",
          "is_bot": false,
          "headline": "feat(fs): support append writes (#131)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-13T07:00:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "98b0bc90b336562eb523f5ac783ee1c5cd9e4bd5",
          "body": "Replace relative client-side expiry with explicit server-backed lifecycle bounds so loops can start in a defined window or stop after an exact number of admitted runs.",
          "is_bot": false,
          "headline": "feat(cli): add bounded loop lifecycle flags (#130)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-13T05:07:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a850027eec0ac18404c422d78055ce713187950",
          "body": null,
          "is_bot": false,
          "headline": "fix(user): expose all IM bindings in user me (#128)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-11T13:48:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "73062de9a0a4303818d79462157afcbd087bea42",
          "body": null,
          "is_bot": false,
          "headline": "feat(alerts-scheduler): add deploy run-status (#126)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-10T11:31:05Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "67608ab7c461efde8d4e3722b7da4fa92f450606",
          "body": "… (#127)\n\nSugar over 'alva deploy create' for the loop-scheduling paradigm's create\nslice. 'alva loop create --channel-id X --goal ... --cron ... [--expires-in]'\nseeds a shared per-user loop-runner (~/loops/_runner/index.js) that reads its\ngoal/channel from require('env').args and dispatches a fire-\n[…]\nts 30m|24h|7d or 'never' (unbounded, discouraged)\n- name derived from --goal (or --name override), validated by the backend\n- channelId omitted ⇒ the caller's DM/agent channel (relay nil-channel path)",
          "is_bot": false,
          "headline": "feat(cli): add 'alva loop create' — self-scheduled channel goal loops…",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-10T06:56:36Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "9377d811946860c8cec47f37e1fac7c8e5215999",
          "body": null,
          "is_bot": false,
          "headline": "v0.16.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-08T11:31:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "27856bea6c7a241bdb45265322c84debb58084ee",
          "body": "broker is dispatched and fully usable but was absent from the hand-maintained\nHELP_TEXT command list, so it never showed in `alva --help`. Add the one line.\n\nDeliberately NOT adding a COMMAND_HELP['broker'] entry: broker's --help must\nkeep forwarding to trex's self-describing `describe` (the command grammar IS\nthe contract), which a static per-command help string would shadow.",
          "is_bot": false,
          "headline": "docs(cli): list broker in top-level alva --help (#122)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-08T05:15:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e7718c62cfd8525785288f37a01f1eff4ff9857d",
          "body": null,
          "is_bot": false,
          "headline": "feat: add feed set-visibility CLI command and client method (#121)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-08T03:12:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4ce1b8f22d8cacbf0c2e3b9eea25ee4ad020d263",
          "body": null,
          "is_bot": false,
          "headline": "feat(alert): expose follows command (#120)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-07T07:21:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6d7f58c6f6d1822c15655f37018d835f96a34311",
          "body": "Switch CI back to ubuntu-latest so jobs are not stuck on unavailable self-hosted runners, sync skillTiers with the live Arrays registry, and tolerate audit PR creation failures when Actions tokens cannot open PRs.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
          "is_bot": false,
          "headline": "fix(ci): unblock GitHub Actions and sync skill registry",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-07T06:30:39Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "87c770708e45a441ce40185e44621a15b40504b1",
          "body": "stripGlobalFlags removed --api-key/--base-url/--profile/--arrays-endpoint\nfrom the ENTIRE argv, including everything after `broker`. Since broker is a\nraw argv passthrough to trex, a venue-native flag that collides with a CLI\nglobal was silently dropped with its value (adversarial review). Global flags\nare positional — they precede the command group — so stop stripping at the\n`broker` token and forward the remainder verbatim.",
          "is_bot": false,
          "headline": "fix(cli): stop stripping global flags at the broker passthrough (#119)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-07T05:16:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "739f6ef1367d8e18ac47936ccc75ca220b065751",
          "body": "* feat(sdk): channelGroupSubscriptions.getGroupChatHistory\n\nGroup-chat digest read: GET /api/v1/channel/group-history (admin-gated, per-user\nauth — NOT the shared-key sdk_relay). A digest feed runs as the group's admin and\npulls its own group's buffered messages in a time window, each with a permali\n[…]\nresponse/message types were added to types.ts\nbut not re-exported from src/index.ts, so consumers of @alva-ai/toolkit could not\nimport them. Add them to the root export allow-list (Codex review #118).",
          "is_bot": false,
          "headline": "[jaxxjj] feat(sdk): getGroupChatHistory for group-chat digest (#118)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-07T04:44:41Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "2cd7024803e677bc510ce74da8e8687e29aed164",
          "body": "…ice (#117)\n\n* feat(cli): alva broker — thin passthrough to trex BrokerService\n\nThe agentic execution surface reaches the CLI. `alva broker <argv>` forwards\nargv untouched to gateway POST /api/v1/broker/invoke (→ trex Invoke) and writes\nthe returned JSON envelope to stdout verbatim, exiting with its\n[…]\nflush stdout before exit: process.exit() right after write() can truncate a\n  large envelope on a pipe (agents pipe stdout) — now exits from the write\n  callback so the JSON envelope is never cut off.",
          "is_bot": false,
          "headline": "[jaxxjj] feat(cli): alva broker — thin passthrough to trex BrokerServ…",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-07-06T14:49:32Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "e23facba996cddcce72b085386d0c74fa3a0468b",
          "body": null,
          "is_bot": false,
          "headline": "feat(automation): add inspect command (#116)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-06T09:09:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "32878011e6b6c21be74edc55815716f43b9daada",
          "body": "Switch workflow jobs from GitHub-hosted ubuntu labels (and custom\nBackend-ci where applicable) to self-hosted. Runners must provide the\ntooling each workflow expects (Go/Node/Docker/etc.).",
          "is_bot": false,
          "headline": "chore(ci): use self-hosted runners for GitHub Actions workflows (#57)",
          "author_name": "Ruipeng",
          "author_login": "purebluesong",
          "committed_at": "2026-07-06T03:54:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c9acd01de95f496ad81977fb207e7730e708f89a",
          "body": "* feat(cli): add feed list command\n\n* feat(cli): add automation and alert surfaces",
          "is_bot": false,
          "headline": "feat(cli): add feed list command (#115)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-02T13:29:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f2d4f9ffee53df4735b6ad96f36aa66bc01562d0",
          "body": null,
          "is_bot": false,
          "headline": "v0.15.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-01T11:37:17Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bf36f95b496f2a2858bcc92df0ecea200834006f",
          "body": null,
          "is_bot": false,
          "headline": "chore: sync design contract",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-07-01T11:32:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5e3be12f3c2e0e5c5bb1e62a6b087c29f4b8ba6e",
          "body": "* feat(cli): alva service-account commands (issue #602, PR B)\n\nAdds the toolkit `alva service-account` command group + ServiceAccountResource\nso agents can manage restricted run-as identities:\n  alva service-account create --name <label>\n  alva service-account list\n  alva service-account delete --id\n[…]\ne-account id is preserved verbatim.\n\nCo-Authored-By: Claude Opus 4.8 <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Wu Alan <alan@alva.xyz>\nCo-authored-by: Claude Opus 4.8 <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(cli): alva service-account commands ( PR B — toolkit half) (#113)",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-07-01T03:17:16Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "c8e9f563de6590c3b2f2e041315ae24c24d1c631",
          "body": "…ad handles PDFs (#114)\n\n* fix(client): return non-JSON responses as bytes so fs.read handles PDFs\n\nThe binary-vs-JSON gate in _request used an allowlist (octet-stream,\ntext/*, image/*). A file served with any other mime — e.g. a PDF as\napplication/pdf — fell through to response.json() and threw a J\n[…]\nts (Application/JSON) fell through to\narrayBuffer(), breaking CreditsResource.graphql() with\nGRAPHQL_EMPTY_RESPONSE. Lowercase the media type and also treat the\n+json structured-suffix family as JSON.",
          "is_bot": false,
          "headline": "[yimingchen] fix(client): return non-JSON responses as bytes so fs.re…",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-30T03:09:04Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "1c7a7392d1e69ca525309081528ea5d40e3fc160",
          "body": null,
          "is_bot": false,
          "headline": "v0.14.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-25T09:40:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "82ee6b1f5032c8794464834b10e575727572bc32",
          "body": "* feat(playbooks): emit clickable /u/ playbook URLs in trending results\n\nPlaybook discovery results carried a relative `url_path` of\n`/<username>/playbooks/<name>`, which is missing the `/u/` segment the\nweb app actually routes on — concatenating it onto the web origin\nproduced a broken link.\n\n- Fix\n[…]\nooks help; add formatter + --json dispatch tests.\n\nCo-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Claude Opus 4.8 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(playbooks): clickable /u/ URLs + readable default output (#112)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-25T07:58:30Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "40c0fe40fc1db90d611556067d46e283b6b6c362",
          "body": "Co-authored-by: Kun Li <kun@alva.xyz>",
          "is_bot": false,
          "headline": "fix(client): treat text responses as bytes (#111)",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-06-24T02:37:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4bd0677f05a67902900ba8cd003b13fbeb91ba5e",
          "body": "Add an optional --agent-type flag (e.g. \"alpi\") to `alva release feed`,\nforwarded as agent_type to the gateway release endpoint. Marks the feed as an\nagent feed whose prompt (AGENTS.md) is editable; omit for a regular feed.\n\nCo-authored-by: Claude Opus 4.8 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(release): alva release feed --agent-type <type> (#110)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-24T02:29:06Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "ede65f3179704fb8e44f06c5e950e8139117c0af",
          "body": "Co-authored-by: Kun Li <kun@alva.xyz>",
          "is_bot": false,
          "headline": "Add credits wallet CLI (#109)",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-06-23T11:53:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f32599949dc60f60af52bf97529992ed224f018d",
          "body": null,
          "is_bot": false,
          "headline": "v0.13.1",
          "author_name": "Yumin Xia",
          "author_login": "Stumble",
          "committed_at": "2026-06-17T17:05:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f180267aa386bd111f34dec5f91927d587c9600f",
          "body": null,
          "is_bot": false,
          "headline": "export CliUsageError from toolkit (#106)",
          "author_name": "Yumin Xia",
          "author_login": "Stumble",
          "committed_at": "2026-06-17T16:45:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "05134a9bed90aeed1e28687f24e071e6a426705a",
          "body": null,
          "is_bot": false,
          "headline": "v0.13.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-17T10:38:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "cd6ea14f99d08fce47aba841ddff654ad43b924b",
          "body": "…(#105)\n\n* fix: emit raw base64 to stdout for screenshot --base64 in the CLI\n\nmain() pretty-printed the tagged {_image} envelope as JSON, so the standalone\n`alva screenshot --base64` did not emit pipeable base64 as documented. Add an\n_image special case (mirroring _help) that writes just the base64 \n[…]\nguard.\n\nCo-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Yumin Xia <yumin@alva.xyz>\nCo-authored-by: Claude Opus 4.8 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "[yumin-xia] fix: alva screenshot --base64 emits raw base64 to stdout …",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-06-16T21:26:28Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "e99125dd203f7a6735c11a07e02b5b9753371ad0",
          "body": "* feat: add --base64 stdout mode to alva screenshot\n\nAdds a base64 stdout mode so `alva screenshot` works in jagent (no local\nFS). Requires exactly one of --out/--base64. base64 mode skips the\nlocal-file guard, compresses by default (max-width 1280, quality 70),\nhonors explicit --compress-quality/--\n[…]\ns test\n\nCo-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Yumin Xia <yumin@alva.xyz>\nCo-authored-by: Claude Opus 4.8 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "[yumin-xia] feat: alva screenshot --base64 stdout mode (#104)",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-06-16T21:08:01Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "b5f3aebdb8824a8af45fc02ea8e7faca9e25e128",
          "body": "…les (#103)\n\nAlign vendored fallback CSS with the design system: add chart-cyan1-main, document line-l9, and use card-border tokens for markdown code/pre blocks.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
          "is_bot": false,
          "headline": "chore(lint): sync fallback bundle design tokens and markdown code sty…",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-16T09:53:26Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "db9ff9f9c71bde74542ce4cfcef214a4ef2cd43f",
          "body": "…ion (#100)\n\n* feat(client): forward X-Alva-Origin-Session-Id for artifact attribution\n\nAlvaClient now carries an optional originSessionId (env ALVA_SESSION_ID,\nread at the CLI config boundary) and forwards it as the\nX-Alva-Origin-Session-Id header on every request. This lets the backend\nattribute a\n[…]\ntion header is identity-scoped; a noAuth request\ncarries no caller identity to attribute work to, so skip the header there\n(mirrors how Authorization is gated on !options.noAuth). Addresses PR review.",
          "is_bot": false,
          "headline": "[jaxxjj] feat: forward X-Alva-Origin-Session-Id for artifact attribut…",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-15T08:45:32Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "ad4821989616518fc8711ceb25904e23e061a74f",
          "body": null,
          "is_bot": false,
          "headline": "[codex] fix jagent toolkit CLI edge cases (#102)",
          "author_name": "Yumin Xia",
          "author_login": "Stumble",
          "committed_at": "2026-06-15T07:05:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8c9a95aa9b0875dc8a231236e60ee3aa8ada48b7",
          "body": "* support jagent toolkit dispatch\n\n* Simplify jagent dispatch runtime deps\n\n* Simplify jagent CLI dispatch support",
          "is_bot": false,
          "headline": "[codex] support jagent toolkit dispatch (#101)",
          "author_name": "Yumin Xia",
          "author_login": "Stumble",
          "committed_at": "2026-06-14T05:46:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f151e893ce5c58f7fef4cba92e2b54fe5357401b",
          "body": "Make alva run wait longer for /api/v1/run by default, add --timeout-ms / ALVA_RUN_TIMEOUT_MS, keep timeout_ms client-only, and preserve structured network timeout details for status-0 failures.\\n\\nValidated by B:\\n- npm run format:check\\n- npm run lint\\n- npm run typecheck\\n- npm test\\n- npm run build",
          "is_bot": false,
          "headline": "fix(cli): make run timeout configurable",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-06-10T14:09:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c54aaee25a14bcdfa727ce84478c5dfa4dc6e0f8",
          "body": null,
          "is_bot": false,
          "headline": "v0.12.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-10T11:18:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "63053ac3f9cd135ee0c3ac22e205aa4b7c13d9dd",
          "body": "…iscovery (#584 W3) (#98)\n\n* feat(cli): follows, by-id bulk unsubscribe, playbook discovery + taxonomy help (mono-meta#584 W3)\n\nCLI wave of the subscriptions-surface agent fix, over the W2 gateway routes.\n\n- subscriptions follows — the social follow relation (the UI's 'Subscribed\n  Playbooks'), with\n[…]\nlic/paid rows (verified end-to-end). Match the\ntrending() precedent: auth optional, forwarded when present, server decides.\nfollows()/unsubscribeBatch() keep the client gate (caller-scoped resources).",
          "is_bot": false,
          "headline": "[yimingchen] feat(cli): follows + by-id bulk unsubscribe + playbook d…",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-10T11:03:07Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "146657c25ae9c2f7ca136f599ed16469d65b6a48",
          "body": "- Added new CSS variables for minimum spacing and button radius.\n- Adjusted existing radius values for consistency across components.\n- Updated sidebar selection color for better visibility.\n- Introduced new grey scale variables for enhanced design flexibility.\n- Modified dropdown and input styles for improved sizing and appearance.",
          "is_bot": false,
          "headline": "feat(lint): update fallback CSS variables for spacing and radius (#97)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-10T08:06:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9ccd19f345493dd195bcc13c3b52b37f5b2d4a91",
          "body": "* feat(playbook-runtime): add alva.subscribe.propose()\n\nAuthor-facing helper for the new feed-subscribe consent flow: a playbook\n(iframe) can only PROPOSE a subscription; it cannot subscribe directly.\npropose() posts 'alva:subscribe:propose' to the trusted parent and resolves\n('subscribed'|'declined\n[…]\n(e.g. a number from untyped JSON) made .trim() throw and reject the\npromise instead of resolving to the documented 'error'. Validate typeof ===\n'string' before trimming. Addresses Codex review on #96.",
          "is_bot": false,
          "headline": "[yimingchen] feat(playbook-runtime): add alva.subscribe.propose() (#96)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-10T08:02:13Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "206273c72c00dbacb857d2de52a6b0a47243db47",
          "body": "* audit: sync skillTiers with Arrays doc registry\n\nAuto-generated by .github/workflows/audit-skill-registry.yml.\nRun: https://github.com/alva-ai/toolkit-ts/actions/runs/27118015927\n\nReviewer must verify the tier on every row marked with TODO(audit).\n\n* audit: mark non-US stock endpoints free\n\n* audit: verify x-search tier\n\n---------\n\nCo-authored-by: github-actions[bot] <41898282+github-actions[bot]@users.noreply.github.com>",
          "is_bot": false,
          "headline": "audit: sync skillTiers with Arrays doc registry (#93)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-08T10:42:01Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c9e9ac4327439f9d2e460b8c4ce8eb9655430bbb",
          "body": "The whoami renderer already passes through every backend field (object spread),\nso 'alva whoami' surfaces slack_username as soon as the backend returns it. This\nadds the field to the UserProfile type and documents it in 'user me' help for\ntype-correctness and discoverability.",
          "is_bot": false,
          "headline": "feat(slack): add slack_username to UserProfile + whoami help (#94)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-08T10:06:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "19b1e47299f538c544da573976a7424fbaa9e55f",
          "body": null,
          "is_bot": false,
          "headline": "feat(functions): add playbook functions CLI (#91)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-05T03:00:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "702ebb8cd69ec1871d2722e70bce8c3a093d2a03",
          "body": "This reverts commit 724c14b1aefe33e4f2de19b0ad5566fad057604e.",
          "is_bot": false,
          "headline": "Revert \"[jaxxjj] feat(run): add --dry-run to alva run (#90)\" (#92)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-05T02:48:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "724c14b1aefe33e4f2de19b0ad5566fad057604e",
          "body": "* feat(run): add --dry-run to alva run\n\nRun a script to completion but never persist its writes — the runtime\nbuffers the store's @append / time-series writes and drops them. Lets an\nagent validate a feed/task script (e.g. force-running a morning-brief feed\nwhile building it) without polluting the p\n[…]\n\n\n* test(run): cover dry_run in RunResource expectations\n\nAdd dry_run to the exact request-body expectations (consistent with the\nother optional fields) and a case asserting dry_run:true is forwarded.",
          "is_bot": false,
          "headline": "[jaxxjj] feat(run): add --dry-run to alva run (#90)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-04T15:21:36Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "779ea6e3e625199a93355f7ceb676c794f501d6d",
          "body": null,
          "is_bot": false,
          "headline": "v0.11.2",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-03T10:29:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ae3d4cea170c08abc0bf1de19e0db0897084b4d3",
          "body": null,
          "is_bot": false,
          "headline": "feat(feed): add stop and resume commands (#88)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-03T06:33:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a0611ccea37019ca6a5cc41ec2bde08356134374",
          "body": "Leftover git worktrees under .worktrees/ were being pulled into the\nrelease scripts: git status --porcelain reported them as untracked,\ntripping the clean-tree pre-flight check in both release.sh and\nrelease-stg.sh, and `eslint .` / `prettier --check .` scanned the\nworktree's source copies. Ignoring .worktrees/ at the config layer\nfixes both release scripts at once.\n\nCo-authored-by: Claude Opus 4.8 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "chore: ignore .worktrees/ in git, eslint, prettier (#89)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-03T04:13:25Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "7b7fd9ca0734310296b012022a1d0a18e9a1963c",
          "body": null,
          "is_bot": false,
          "headline": "v0.11.1",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-02T09:03:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fb92f05baa8c3bd9b722d3dd74254c3a27778326",
          "body": "* feat(feedback): add feedback CLI command\n\n* fix(feedback): reject stale dedupe flag\n\n* fix(feedback): clarify optional diagnostic metadata",
          "is_bot": false,
          "headline": "feat(feedback): add feedback CLI command (#86)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-02T07:55:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "794dfc4edbc96a1c8bc2ee41290180ef7f27df26",
          "body": null,
          "is_bot": false,
          "headline": "v0.11.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-01T11:17:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c514edfb7e93cd7f942879319e9898ac9502cdfe",
          "body": "BREAKING: SDK client.pushSubscriptions -> client.subscriptions and CLI group\n'push-subscriptions' -> 'subscriptions', pointing at the gateway's\n/api/v1/subscriptions/... routes.\n\n- subscribePlaybook is now a CASCADE (follow + enable all push-enabled\n  automations); response {follow, subscribed_feed_\n[…]\nbookResponse + PlaybookFollow replace SubscribePushTargetResponse.\n- subscribeFeed/unsubscribeFeed unchanged (single feed alert).\n- Help/doc text updated to cascade semantics. Version 0.9.5 -> 0.10.0.",
          "is_bot": false,
          "headline": "feat!: rename push-subscriptions to unified subscribe surface (#87)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-06-01T09:28:12Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "3968478c9f1806e40363f1115cb9a73c502dcba7",
          "body": "* feat(skillhub): document visible skillhub reads\n\n* docs(skillhub): clarify disabled get behavior\n\n* docs(skillhub): clarify disabled file access\n\n* fix(skillhub): keep disabled state out of user docs",
          "is_bot": false,
          "headline": "fix(skillhub): keep visibility internals out of user docs (#85)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-06-01T08:41:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "67d79badf74dd80d3c06be4374490303381324a4",
          "body": null,
          "is_bot": false,
          "headline": "v0.9.5",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-29T06:38:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7ad8089cf63d07cc976b06dcd88f75af549dbcb8",
          "body": "Add `alva playbooks set-visibility --name <name> --visibility public|private|paid`,\nwiring the toolkit to the existing alva-gateway endpoint\n`POST /api/v1/playbook/:name/visibility` (backed by the backend\n`SetPlaybookVisibility` RPC).\n\n- `PlaybooksResource.setVisibility()` — auth-required POST, clie\n[…]\n; a free-tier user receives `PERMISSION_DENIED`, surfaced\nunchanged. No backend or gateway changes — those layers already shipped.\n\nCo-authored-by: Claude Opus 4.8 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(playbooks): add `set-visibility` CLI subcommand (#84)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-29T06:26:23Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "9a19af05cb7f27b454d2c88495d01bc46ebd40d9",
          "body": null,
          "is_bot": false,
          "headline": "v0.9.4",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-28T11:03:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9837bb249cfd86ef1f2c478a6aaad04f71fadbee",
          "body": "Co-authored-by: yancy <yancy@galxe.com>",
          "is_bot": false,
          "headline": "fix: normalize udf runtime responses (#83)",
          "author_name": "yancy-alva",
          "author_login": "yancy-alva",
          "committed_at": "2026-05-28T11:03:16Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "cdf8afeeecbdaa1f10a1bfade05836fdae2dac14",
          "body": "- Add max_heap_size_mb to CronjobCreateRequest, CronjobUpdateRequest,\n  and Cronjob response (server returns null when no override is set).\n- Add --max-heap-size-mb flag (1-2046) to deploy create/update.\n\nPairs with alva-backend#1271 and alva-gateway#444.",
          "is_bot": false,
          "headline": "feat(deploy): expose per-cronjob max_heap_size_mb override (#82)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-05-28T10:38:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8d1cb507768e82eba52d2697db23940abdfe4527",
          "body": null,
          "is_bot": false,
          "headline": "v0.9.3",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-28T03:45:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1e975d80bbcf689aeaa7a6644d9b56d0973ae6d8",
          "body": "Co-authored-by: yancy <yancy@galxe.com>",
          "is_bot": false,
          "headline": "fix: default playbook runtime API origin to prd (#81)",
          "author_name": "yancy-alva",
          "author_login": "yancy-alva",
          "committed_at": "2026-05-28T03:39:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d37ac38dbb77ede49f18cebffc9de1f298df05a1",
          "body": null,
          "is_bot": false,
          "headline": "v0.9.2",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T13:17:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f574247749e09c0c2695e9f6fa568cf60368fc5d",
          "body": null,
          "is_bot": false,
          "headline": "v0.9.1",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T10:52:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5db0addf5537e2085cb2cfc6393c8e25d7c5b283",
          "body": "* feat(cli): add `alva portfolio` resource for connected accounts\n\nNew commands:\n- alva portfolio accounts — list all connected accounts (TREX + SnapTrade)\n- alva portfolio summary --account-id trex:123 — holdings + balance\n- alva portfolio activities --account-id snaptrade:456 — paginated activity\n\nBacked by the new GET /api/v1/portfolio/* REST surface on gateway.\nDecouples read-only account viewing from trading semantics.\n\n* style: format portfolio files with prettier",
          "is_bot": false,
          "headline": "[codex] feat(cli): add alva portfolio resource (#80)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-05-27T10:49:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "edf21f7e5c84349cd52f93ebf22b6599effe2335",
          "body": null,
          "is_bot": false,
          "headline": "v0.9.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T10:40:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dd13505edbf395a009ce7099eb41324265744ebc",
          "body": "skills#442 added global.required-scripts to the contract (ECharts +\nrequestAnimationFrame rule). The committed fallback-contract.ts on\nmain was vendored before #442 published, so the offline-fallback path\nin the toolkit doesn't know about the new rule. Live-fetch from CDN\nworks, but offline / CDN-de\n[…]\nis unchanged (CDN bundle hasn't\nmoved since #439's body font-family fix was vendored).\n\nBuild-time gate still passes: 'Delight' as root font-family verified,\nall 3 anti-aliasing declarations verified.",
          "is_bot": false,
          "headline": "chore: refresh vendored fallback to current CDN (#79)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T09:32:05Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "0eee3bc05ca6e6e48df1144e0e22a7a731aea389",
          "body": "The CLI now ships an OAuth 2.0 Authorization Code + PKCE login that\nsupersedes the manual `alva configure --api-key …` flow for most\nusers. Document both paths in the Quick Start, and fix the CLI\nCommands signature to reflect --browser / --no-browser flags.\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "docs(readme): document alva auth login (OAuth + PKCE flow) (#78)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T09:26:19Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "cc9558b01d4d34e3281ee63a2ed716d7111e1c03",
          "body": "…+ PKCE (#68)\n\n* feat(cli): add PKCE + mode-select helpers\n\nPure helpers for the upcoming no-browser auth flow:\n- pkce.ts: generateCodeVerifier (43-char base64url) and deriveChallenge\n  (S256, RFC 7636).\n- modeSelect.ts: selectMode picks 'browser' vs 'no-browser' from flags +\n  env + platform; pure \n[…]\nrowser failure is non-fatal\n  - --profile honored\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(cli): alva auth login --no-browser via OAuth Authorization Code …",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T08:40:33Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "ccaf71bed614140f43f15a71144e6d1f08a331e2",
          "body": "… (#75)\n\n* lint: vendor design-system bundle + verify font-family-root auto-pass\n\nThe font-family-root rule auto-passes whenever a playbook <link>s a\ncanonical-css-urls URL — it trusts the bundle on CDN delivers the\nroot font-family the contract promises. That trust was unchecked\nfor months, and a r\n[…]\ne → error per missing with \"bundle\"/\"drifted\" wording;\n  any-selector lenience preserved (matches inline-check semantics);\n  wrong-value rejected. Pre-existing 6 tests unchanged.\n\nTests: 448/448 pass.",
          "is_bot": false,
          "headline": "lint: vendor design-system bundle + verify font-family-root auto-pass…",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T08:03:32Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "9c2af5595d22de48943523359c8f2130f0400126",
          "body": "The required-script-fragments rule was only ever component-scoped:\neach entry sat under a component (e.g. tab) and fired when that\ncomponent was present. The ECharts resize requirement lived under\n'tab' as 'when chart-card also present, must contain resize()' — so\nplaybooks with charts but no tabs s\n[…]\neparately —\n'global.required-scripts' with when-script-contains: ['echarts.init']\nand must-contain: ['requestAnimationFrame']. Toolkit picks it up\nautomatically once skills publishes (live CDN fetch).",
          "is_bot": false,
          "headline": "lint: support global required-scripts (cross-cutting script rules) (#77)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-27T07:28:00Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "fa88e0f0ed87dd7f762d0a077628cb6c143f5cca",
          "body": "…nfig + env (#74)\n\n* wip: task 5 — toolkit-ts AlvaClient GA header injection\n\n* wip: task 6 — read GA env vars + forward into AlvaClient ctor in CLI dispatch\n\n---------\n\nCo-authored-by: Saya Zhang <saya@alva.xyz>",
          "is_bot": false,
          "headline": "[saya-zhang] feat: forward GA4 attribution headers from AlvaClient co…",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-05-27T03:12:54Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4f441449952432823547747b049e335d1f84e114",
          "body": "Expose jagent's per-run heap override through the alva run CLI and the\nRunResource SDK as max_heap_size_mb, validated client-side to 1-2048.\n\nCo-authored-by: Forge Agent <forge@alva.ai>\nCo-authored-by: Claude Opus 4.7 <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(run): add --max-heap-size-mb flag and SDK field (#71)",
          "author_name": "alva-bot01",
          "author_login": "alva-bot01",
          "committed_at": "2026-05-26T23:51:09Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "3e31f731839e5f3c734ae7430777ae1253e2efff",
          "body": "Co-authored-by: yancy <yancy@galxe.com>",
          "is_bot": false,
          "headline": "fix: send numeric playbook id for udf invoke (#73)",
          "author_name": "yancy-alva",
          "author_login": "yancy-alva",
          "committed_at": "2026-05-26T11:00:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d3cf26554564f475891d6ecdc739b9cc005bce24",
          "body": "…pt-contains) (#72)\n\nAdds 'when-script-contains' to ScriptRequirement schema. Lets requirements\nfire based on substrings in <script> content, not just on canonical\ncomponent-root presence. AND-conjunctive with whenAlso when both are set.\n\nMotivation: the existing 'when-also: chart-card' gate only ca\n[…]\nhandler is required regardless of class names'.\n\nAdded 4 tests covering: positive trigger (no .chart-container needed),\nno-fire when absent, passes when handler present, AND-conjunction with\nwhenAlso.",
          "is_bot": false,
          "headline": "feat(lint): semantic trigger for required-script-fragments (when-scri…",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-26T08:14:41Z",
          "body_truncated": true,
          "is_coding_agent": false
        },
        {
          "oid": "442a8a3f1fc09a42fd936e2bbd5999317f05b914",
          "body": "…-css-urls + forbid-core-selector-override) (#64)\n\n* feat(lint): types for any-of stylesheets + canonicalCssUrls\n\n* feat(lint): contract loader supports any-of + canonical-css-urls (backward-compat)\n\n* feat(lint): required-stylesheet supports any-of groups\n\n* feat(lint): font-family-root auto-passes\n[…]\nection-hint message updated\n- Test renamed and assertions updated\n\nAll 402 tests still pass; behavior identical to commit fd84b34.\n\n---------\n\nCo-authored-by: Claude Sonnet 4.6 <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(lint): support v1 CDN CSS bundle (any-of stylesheets + canonical…",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-25T12:08:07Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "3be7c7d63d82ce245d57cea4031c7a03cc08c857",
          "body": "Co-authored-by: yancy <yancy@galxe.com>",
          "is_bot": false,
          "headline": "feat: add playbook UDF runtime SDK (#69)",
          "author_name": "yancy-alva",
          "author_login": "yancy-alva",
          "committed_at": "2026-05-25T10:47:05Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "785a2e150e43bab9a0234a7c313ca1f16f0c98f6",
          "body": null,
          "is_bot": false,
          "headline": "add notification preferences command (#70)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-05-25T10:45:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "310d3461108b3d97cd1ec1ddf0b852a169e2064d",
          "body": null,
          "is_bot": false,
          "headline": "feat: add playbooks trending discovery (#67)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-05-22T06:41:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "16d79040ea7f96df0975065ab6ea0adeffa9a7e9",
          "body": "Co-authored-by: likun <kunli@alva.xyz>",
          "is_bot": false,
          "headline": "fix(lint): ship runtime parser dependencies (#66)",
          "author_name": "likun666661",
          "author_login": "likun666661",
          "committed_at": "2026-05-21T17:07:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "98a85d030ba7781c82274a59f1b88e0ff10bb6ec",
          "body": "* ci: daily audit of skillTiers against live Arrays doc registry\n\nAdds a scheduled GitHub Actions job (and on-demand workflow_dispatch)\nthat diffs `src/resources/skillTiers.ts` against the live\n`/api/v1/skills` doc API.\n\nFor every local row it confirms the doc registry recognizes the\n`(skill, file)`\n[…]\nit cleanly\n- typecheck, prettier, audit all green\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "ci(audit): daily doc-registry drift check with auto-fix PR (#65)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-21T10:54:39Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "a4dc41a1b7c0ba1c72d4c82b3430a3d5b50c4000",
          "body": "* chore(lint): add devDeps for design linter (parsers, yaml)\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>\n\n* feat(lint): define core types for contract, model, findings\n\n* feat(lint): contract loader (YAML kebab → typed Contract)\n\n* feat(lint): HTML+CSS parser (node-html-parser + css-t\n[…]\nclares the substrings + an optional 'when-also'\nco-presence gate.\n\nParser now collects <script> textContent into DomModel.scripts.\n\n---------\n\nCo-authored-by: Claude Sonnet 4.6 <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(lint): design linter + hard gate on alva release playbook (#61)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-21T09:31:28Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "901fcaaff0b058895d95ca232fb9ed2c12ff0a16",
          "body": "The local SKILL_ENDPOINT_METADATA table drifted from the backend. CLI\n`data-skills summary` appends this hardcoded table to backend doc output, so\nstale entries surface as bogus endpoints — and missing entries hide real ones.\n\nAudit (probed every (skill, file) against live `/api/v1/skills/<name>?end\n[…]\ning kline endpoints.\n\nAfter the fix, every local entry resolves OK on the backend and every\nbackend-declared file has a local row.\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "fix(data-skills): align endpoint metadata with live Arrays backend (#63)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-21T07:57:43Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "42264b2a5536a6288d965ebe8865dadfea6bfbd0",
          "body": null,
          "is_bot": false,
          "headline": "v0.8.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-20T10:57:59Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "75cf5ef9a599d13b2d5d14053f4d85bee696133a",
          "body": "…ts (#62)\n\n* feat(cli): rename --template-id to --skill-id; skillhub list as bullets\n\n- Release: rename `--template-id` flag (and request field) to `--skill-id`,\n  sent as JSON `skill_id` to the gateway. Help text and examples updated.\n- Skillhub: switch `skillhub list` output from table to bullet p\n[…]\nh the CLI help and the PlaybookDraftRequest type.\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(cli): rename --template-id to --skill-id; skillhub list as bulle…",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-20T08:53:07Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "ba4ee2fea0d6a2774eaee73d41ff8cd9894f2bbb",
          "body": null,
          "is_bot": false,
          "headline": "feat(cli): add notification history command (#60)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-05-19T12:57:47Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6a451acc8cb0f80bab9f43bfb56658fc41fed25d",
          "body": "Replace removed widget-scrap/twitter with widget-scrap/news in help\nexamples; keep search-grok-x for unified_search / X topic queries.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
          "is_bot": false,
          "headline": "fix(cli): update sdk doc example after twitter module removal (#59)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-19T10:02:08Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "a2a2344e0e1cac0f681b59906334e9ed31bcabe3",
          "body": "Surfaces the new CreatePlaybookDraft `tags` parameter through the CLI\nand SDK so agents can set a playbook's discovery tags at draft time\ninstead of leaving them empty.\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(cli): add --tags flag to release playbook-draft (#58)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-18T07:06:18Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "df66fd70030bcb286493bc8a94504aa9d2ac25cb",
          "body": "Wraps gateway REST `DELETE /api/v1/feed/:id` in a new `FeedResource`\nexposed via `client.feed.delete({ id })` and a new `feed` CLI command\ngroup. Validates the id is a positive integer client-side before\nhitting the network.\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(cli): add `alva feed delete` command (#56)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-14T04:10:22Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "8e33a54ca3a82b0bef9bb641078bba72dedd27ce",
          "body": null,
          "is_bot": false,
          "headline": "feat(cli): add notification history command (#55)",
          "author_name": "jaxxjj",
          "author_login": "jaxxjj",
          "committed_at": "2026-05-14T03:26:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b8236a177507fd0f8400e7ed11959e0e2ffb7d91",
          "body": null,
          "is_bot": false,
          "headline": "v0.7.0",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-13T11:17:17Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7bf2f899c9b800a381a4ed3908bafd93daf2380e",
          "body": "Rename the playbook-skills CLI surface from `skills` to `skillhub` to\ndisambiguate from the unrelated `data-skills` command (Arrays data API\ndocs). Internal SDK names (`client.playbookSkills`) and the\n`data-skills` command are unchanged.\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(cli): rename `alva skills` to `alva skillhub` (#54)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-13T07:51:02Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "d318900baa6a0ed8cdaf6ffa069af7098a1348b8",
          "body": "Adds `scripts/release-stg.sh` (also wired as `npm run release:stg`) which\npublishes a beta build to npm under the `next` dist-tag, so default\n`npm install @alva-ai/toolkit` is unaffected. Internal consumers opt in via\n`npm install @alva-ai/toolkit@next`.\n\nDifferences from `scripts/release.sh`:\n- Doe\n[…]\ntg` continues the current beta series\n(0.6.1-beta.3 -> 0.6.1-beta.4). Pass `prepatch`/`preminor`/`premajor` to\nstart a new series.\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(release): add staging release workflow (#53)",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-13T07:26:39Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "f8f2256be7454d59bc6d07257f8e01c01adc8017",
          "body": "…#52)\n\nThe server-side validator (alva-backend) now accepts only the absolute\nALFS path \"/alva/home/<username>/playbooks/<name>/README.md\". Update\nthe `alva release` help text, workflow step 6, and the playbook\nexample to show the absolute form instead of the relative\n\"<name>/README.md\" shorthand. Test fixtures use the absolute form so\nthey stay consistent with documentation.\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "docs(cli): release playbook --readme-url is absolute ALFS path only (…",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-12T12:22:32Z",
          "body_truncated": false,
          "is_coding_agent": true
        },
        {
          "oid": "ca1756a6a820b3470103b267fac6e2ad65348c2a",
          "body": "…ile fetch (#51)\n\n* refactor(cli): remove broken templates command and TemplatesResource\n\nThe /api/v1/templates gateway routes were renamed to /api/v1/skills\nin gateway #348, leaving `alva templates` broken at the network layer.\nRemove the dead CLI subcommand, COMMAND_HELP entry, top-level help\ntabl\n[…]\nply@anthropic.com>\n\n* style: prettier format pass\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>\n\n---------\n\nCo-authored-by: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "feat(cli): rename templates→skills, skills→data-skills, progressive f…",
          "author_name": "Ming Yan",
          "author_login": "ming-galxe",
          "committed_at": "2026-05-12T06:20:07Z",
          "body_truncated": true,
          "is_coding_agent": true
        }
      ],
      "releases_count": 2,
      "commits_last_year": 157,
      "latest_release_at": "2026-04-14T02:13:25Z",
      "latest_release_tag": "v0.1.5",
      "releases_from_tags": false,
      "days_since_last_push": 0,
      "active_weeks_last_year": 16,
      "days_since_latest_release": 99,
      "mean_days_between_releases": 5.9
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "@alva-ai/toolkit",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "alva",
            "sdk",
            "cli",
            "api",
            "finance",
            "trading",
            "quant"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/@alva-ai/toolkit",
          "is_deprecated": false,
          "latest_version": "0.18.0",
          "repository_url": "https://github.com/alva-ai/toolkit-ts",
          "versions_count": 45,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 3,
          "monthly_downloads": 6150,
          "first_published_at": "2026-04-08T00:06:38.602000Z",
          "latest_published_at": "2026-07-17T10:46:25.558000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 4
        }
      ]
    },
    "popularity": {
      "forks": 0,
      "stars": 0,
      "watchers": 0,
      "fork_history": {
        "days": [],
        "complete": true,
        "collected": 0,
        "total_forks": 0
      },
      "star_history": {
        "days": [],
        "complete": true,
        "collected": 0,
        "total_stars": 0
      },
      "open_issues_and_prs": 4
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "toolchain_manifests": [],
      "largest_source_bytes": 149849,
      "source_files_sampled": 114,
      "oversized_source_files": 2,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": null,
        "source": null,
        "findings": [],
        "collected": false,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 0,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [
        {
          "name": "css-tree",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^3.2.1"
        },
        {
          "name": "undici",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^6.24.1"
        },
        {
          "name": "yaml",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^2.9.0"
        }
      ],
      "all_dependencies": {
        "error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
        "source": null,
        "packages": [],
        "collected": false,
        "truncated": false,
        "total_count": null,
        "direct_count": null,
        "indirect_count": null
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 4,
        "merged_prs": 125,
        "open_issues": 0,
        "closed_ratio": 1,
        "closed_issues": 2,
        "closed_unmerged_prs": 7
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "ming-galxe",
          "commits": 81,
          "avatar_url": "https://avatars.githubusercontent.com/u/162130354?v=4"
        },
        {
          "type": "User",
          "login": "jaxxjj",
          "commits": 40,
          "avatar_url": "https://avatars.githubusercontent.com/u/149285747?v=4"
        },
        {
          "type": "User",
          "login": "alva-bot01",
          "commits": 16,
          "avatar_url": "https://avatars.githubusercontent.com/u/266918130?v=4"
        },
        {
          "type": "User",
          "login": "Stumble",
          "commits": 9,
          "avatar_url": "https://avatars.githubusercontent.com/u/3461891?v=4"
        },
        {
          "type": "User",
          "login": "likun666661",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/u/90952590?v=4"
        },
        {
          "type": "User",
          "login": "yancy-alva",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/284875261?v=4"
        },
        {
          "type": "User",
          "login": "Lqz13Th",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/59284190?v=4"
        },
        {
          "type": "User",
          "login": "purebluesong",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/7992195?v=4"
        }
      ],
      "contributors_sampled": 8,
      "top_contributor_share": 0.516
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "audit-skill-registry.yml",
        "ci.yml"
      ],
      "has_docs_dir": true,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "package-lock.json"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 7,
            "reason": "18 out of 23 merged PRs checked by a CI test -- score normalized to 7",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 6,
            "reason": "Found 20/30 approved changesets -- score normalized to 6",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 0,
            "reason": "project has 0 contributing companies or organizations -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 10,
            "reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 2,
            "reason": "dependency not pinned by hash detected -- score normalized to 2",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 0,
            "reason": "13 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "d3d2ad94a3755b6a491eb2cc74b187908e30bfa1",
        "ran_at": "2026-07-22T10:04:05Z",
        "aggregate_score": 3.8,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-22T05:01:39Z",
      "oldest_open_prs": [
        {
          "number": 123,
          "created_at": "2026-07-08T08:37:30Z",
          "last_comment_at": null,
          "last_comment_author": null
        },
        {
          "number": 125,
          "created_at": "2026-07-09T09:08:57Z",
          "last_comment_at": null,
          "last_comment_author": null
        },
        {
          "number": 129,
          "created_at": "2026-07-13T03:03:27Z",
          "last_comment_at": null,
          "last_comment_author": null
        },
        {
          "number": 133,
          "created_at": "2026-07-16T06:21:46Z",
          "last_comment_at": null,
          "last_comment_author": null
        }
      ],
      "last_merged_pr_at": "2026-07-20T03:12:39Z",
      "ci_last_conclusion": "FAILURE",
      "oldest_open_issues": []
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/alva-ai/toolkit-ts",
    "host": "github.com",
    "name": "toolkit-ts",
    "owner": "alva-ai"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 59,
      "inputs": {
        "security": 38,
        "vitality": 81,
        "community": 34,
        "governance": 65,
        "engineering": 67
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 81,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "good",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 75,
            "inputs": {
              "commits_last_year": 157,
              "human_commit_share": 1,
              "days_since_last_push": 0,
              "active_weeks_last_year": 16
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "16/52 weeks with commits",
                "points": 11.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 16
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "157 commits in the last year",
                "points": 18,
                "status": "met",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 157
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 90,
            "inputs": {
              "releases_count": 2,
              "latest_release_tag": "v0.1.5",
              "releases_from_tags": false,
              "days_since_latest_release": 99,
              "mean_days_between_releases": 5.9
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "2 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 99 days ago",
                "points": 27,
                "status": "partial",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 99
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~5.9 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 5.9
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 34,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 0,
              "stars": 0,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "0 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "0 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 63,
            "inputs": {
              "packages": [
                "@alva-ai/toolkit"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 6150
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "6,150 downloads/month across npm",
                "points": 50.5,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 6150,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 65,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "at_risk",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 31,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 8,
              "top_contributor_share": 0.516
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 52% of commits",
                "points": 10.9,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 52
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "8 contributors",
                "points": 10.8,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 8
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "excellent",
            "name": "Issue & PR responsiveness",
            "note": null,
            "notes": [],
            "value": 92,
            "inputs": {
              "merged_prs": 125,
              "open_issues": 0,
              "closed_issues": 2,
              "issue_closed_ratio": 1,
              "closed_unmerged_prs": 7
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "100% of issues closed",
                "points": 46.8,
                "status": "met",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "125/132 decided PRs merged",
                "points": 36.2,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 125,
                      "decided": 132
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 20/30 approved changesets -- score normalized to 6",
                "points": 9,
                "status": "partial",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 52,
            "inputs": {
              "followers": 24,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "alva-ai",
              "public_repos": 5,
              "account_age_days": 1044
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "24 followers of alva-ai",
                "points": 10.1,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 24,
                      "login": "alva-ai"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "5 public repos, account ~2 yr old",
                "points": 11.4,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 5
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 2
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "@alva-ai/toolkit"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 4
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 4 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "45 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 45
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "moderate",
        "name": "Engineering Quality",
        "value": 67,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "moderate",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 62,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "2 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "18 out of 23 merged PRs checked by a CI test -- score normalized to 7",
                "points": 14,
                "status": "partial",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "good",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 75,
            "inputs": {
              "topics": [],
              "has_wiki": true,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": true,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 25,
                "status": "met",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 38,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 38,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 16,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 2,
              "scorecard_aggregate": 3.8
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "18 out of 23 merged PRs checked by a CI test -- score normalized to 7",
                "points": 1.8,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 20/30 approved changesets -- score normalized to 6",
                "points": 4.5,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 1,
                "status": "partial",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "13 existing vulnerabilities detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 2
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 57,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "at_risk",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 40,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0.81,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "81 of 100 human commits state their intent (structured subject or explanatory body)",
                "points": 40,
                "status": "met",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 81,
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "moderate",
            "name": "Verify loop (build / test / typecheck)",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [
                "package-lock.json"
              ],
              "has_dockerfile": false,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": 0.24,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "24 of the last 100 commits agent-authored or agent-credited",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "agent_authored_commits",
                    "params": {
                      "count": 24,
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no automated dependency updates observed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_dependency_automation",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 2,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 99,
            "inputs": {
              "primary_language": "TypeScript",
              "largest_source_bytes": 149849,
              "source_files_sampled": 114,
              "oversized_source_files": 2
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "TypeScript (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "TypeScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "2/114 source files over 60KB",
                "points": 54,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 114,
                      "oversized": 2
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
    "deps.dev does not index npm:@alva-ai/toolkit@0.18.0; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T10:04:20.956089Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/a/alva-ai/toolkit-ts.svg",
  "full_name": "alva-ai/toolkit-ts",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.26.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasnpm.