Registro público
Informe de salud del softwareesquema 0.15.0 · métricas 1.13.0 · 2026-07-20 07:01 UTC

hhxsv5 / laravel-s

LaravelS is an out-of-the-box adapter between Laravel/Lumen and Swoole.

PHPMIT★ 3881 estrellas⑂ 465 forksdesde ene 2018Ver en GitHub ↗

hhxsv5/laravel-s tiene un índice de salud de 57 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (73/100) y la más baja, AI Readiness (25/100). Se actualizó por última vez hoy. Una sola persona concentra la mayor parte del trabajo reciente.

57
global / 100
Moderado

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

57
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

Biao XieCuenta personal
243 seguidores61 repositorios públicosdesde abr 2014@open-smf

Este repositorio pertenece a una cuenta personal. Un proyecto con un único propietario conlleva más riesgo de continuidad que uno respaldado por una organización.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
Packagisthhxsv5/laravel-sv3.8.74384231hace 183 díasperformancehttpwebsocketprocesstcpservertaskasynclaraveltimerudpinotifycoroutineswoolelumenlaravelslaravel-s

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

73Bueno · 22% del índice global
Cómo se puntúa
36/36Recencia de push — último push hace 0 días
6.9/36Cadencia de commits — 10/52 semanas con commits
12.1/18Volumen de commits — 21 commits en el último año
5/10OpenSSF Scorecard: Maintained — 7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
Datos de entrada utilizados
commits_last_year21
human_commit_share
days_since_last_push0
active_weeks_last_year10
Cómo se puntúa
27/27Publica versiones — 100 versiones publicadas
36/36Recencia de las versiones — última versión hace 0 días
19.8/27Cadencia de publicación — una versión cada ~64,9 días
0/10OpenSSF Scorecard: Signed-Releases — sin datos
Datos de entrada utilizados
releases_count100
latest_release_tagv3.8.8
releases_from_tagsno
days_since_latest_release0
mean_days_between_releases64,9
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

69Moderado · 18% del índice global
Cómo se puntúa
58.2/60Estrellas — 3881 estrellas
22.2/25Forks — 465 forks
12.7/15Observadores — 190 observadores
Datos de entrada utilizados
forks465
stars3881
watchers190
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Cómo se puntúa
22.5/22.5README
22.5/22.5Licencia — licencia reconocida (MIT)
0/18Guía CONTRIBUTING
0/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributingno
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno
Cómo se puntúa
48.6/80Descargas mensuales — 4384 descargas/mes en packagist
7.8/20Dependientes en el registro — 14 paquetes dependen de él
Datos de entrada utilizados
packageshhxsv5/laravel-s
dependents14
ecosystemspackagist
total_downloads694.175
monthly_downloads4384

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

63Moderado · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
1.1/22.5Distribución de commits — el principal contribuyente firma el 95% de los commits
13.5/13.5Amplitud de contribuyentes — 34 contribuyentes
10/10OpenSSF Scorecard: Contributors — project has 4 contributing companies or organizations
Datos de entrada utilizados
bus_factor1
contributors_sampled34
top_contributor_share0,951
Cómo se puntúa
39.5/46.8Resolución de issues — 84% de issues cerradas
33/38.3Aceptación de PR — 63/73 PR decididos fusionados
1.5/15OpenSSF Scorecard: Code-Review — Found 3/20 approved changesets -- score normalized to 1
Datos de entrada utilizados
merged_prs63
open_issues66
closed_issues357
issue_closed_ratio0,844
closed_unmerged_prs10
Cómo se puntúa
10/30Respaldo de la propiedad — cuenta personal (usuario)
0/20Dominio verificado — no aplicable a cuentas de usuario
17.2/25Alcance del propietario — 243 seguidores de hhxsv5
25/25Trayectoria — 61 repos públicos, cuenta de ~12 años
Datos de entrada utilizados
followers243
owner_typeUser
is_verified
owner_loginhhxsv5
public_repos61
account_age_days4480
Excluidos de la puntuación (sin datos o no aplicable): Dominio verificado. Los pesos restantes se han renormalizado.
Cómo se puntúa
25/25Publicado y resoluble — 1 paquete(s) en packagist
26/35Recencia de publicación — última publicación hace 183 días
20/20Historial de versiones — 231 versiones en el registro
20/20No obsoleto — activo, ni obsoleto ni retirado
Datos de entrada utilizados
packageshhxsv5/laravel-s
ecosystemspackagist
any_deprecatedno
min_days_since_publish183

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

38En riesgo · 20% del índice global
Cómo se puntúa
0/24Flujos de trabajo de CI
24/24Pruebas presentes
0/16Configuración de linter
0/9.6Hooks de pre-commit
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — 0 out of 6 merged PRs checked by a CI test -- score normalized to 0
Datos de entrada utilizados
has_cino
has_tests
has_editorconfigno
has_linter_configno
has_precommit_configno

Documentación

60Moderado
Cómo se puntúa
30/30README
0/25Directorio de documentación
0/15Sitio de documentación / página del proyecto
10/10Descripción del repositorio
10/10Topics — 13 topics
10/10Wiki
Datos de entrada utilizados
topicsswoole, laravel, lumen, async, server, http, websocket, tcp, udp, process, task, timer, performance
has_wiki
homepage
has_readme
has_docs_dirno
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

39En riesgo · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — sin datos
0/2.5CI-Tests — 0 out of 6 merged PRs checked by a CI test -- score normalized to 0
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0.8/7.5Code-Review — Found 3/20 approved changesets -- score normalized to 1
2.5/2.5Contributors — project has 4 contributing companies or organizations
0/10Dangerous-Workflow — sin datos
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Licencia — license file detected
3.8/7.5Maintained — 7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
0/5Packaging — sin datos
0/5Pinned-Dependencies — sin datos
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — sin datos
0/7.5Token-Permissions — sin datos
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated12
scorecard_versionv5.5.0
checks_inconclusive6
scorecard_aggregate3,9
Excluidos de la puntuación (sin datos o no aplicable): branch_protection, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Los pesos restantes se han renormalizado.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

25Crítico · 0% del índice global
Cómo se puntúa
0/45Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor
0/15Documentación legible por máquinas (llms.txt)
0/40Historial de commits legible — sin datos
Datos de entrada utilizados
has_llms_txtno
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Excluidos de la puntuación (sin datos o no aplicable): Historial de commits legible. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/18Arranque con un solo comando
22/22Pruebas automatizadas
0/11Configuración de lint / formato
0/11Verificación estática de tipos
0/10Entorno reproducible
0/10Práctica demostrada con agentes — sin datos
0/8Mantenimiento automatizado — sin datos
0/10OpenSSF Scorecard: Pinned-Dependencies — sin datos
Datos de entrada utilizados
has_nixno
has_tests
lockfiles
has_dockerfileno
typed_languageno
bootstrap_files
has_devcontainerno
has_linter_configno
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Excluidos de la puntuación (sin datos o no aplicable): Práctica demostrada con agentes, Mantenimiento automatizado, OpenSSF Scorecard: Pinned-Dependencies. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/45Código verificable por tipos — PHP sin configuración de verificación de tipos
55/55Tamaños de archivo manejables — 0/81 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languagePHP
largest_source_bytes15.120
source_files_sampled81
oversized_source_files0

Datos clave

3881estrellas de GitHub
34contribuidores
21commits en los últimos 12 meses
0días desde el último push
100versiones publicadas
1factor bus
66issues abiertas
Packagistecosistemas de paquetes

Más detalle

OpenSSF Scorecard 3.9 / 10
3.9agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-20 07:00 UTC

10Binary-Artifactsno binaries found in the repo
n/dBranch-Protectioninternal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md
0CI-Tests0 out of 6 merged PRs checked by a CI test -- score normalized to 0
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
1Code-ReviewFound 3/20 approved changesets -- score normalized to 1
10Contributorsproject has 4 contributing companies or organizations
n/dDangerous-Workflowno workflows found
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
5Maintained7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
n/dPackagingpackaging workflow not detected
n/dPinned-Dependenciesno dependencies found
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
n/dSigned-Releasesno releases found
n/dToken-PermissionsNo tokens found
10Vulnerabilities0 existing vulnerabilities detected
Dependencias directas 2
RegistroPaqueteRestricción de versiónManifiesto
Packagistswoole/ide-helper@devcomposer.json
Packagistsymfony/console>=6.4.0composer.json
Todas las dependencias 7

Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 2 paquetes directos y 5 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.

RegistroPaqueteVersiónRelación
Packagistswoole/ide-helperdirecta
Packagistsymfony/consoledirecta
Packagistext-curlindirecta
Packagistext-jsonindirecta
Packagistext-pcntlindirecta
Packagistphpindirecta
Packagistphpunit/phpunitindirecta
Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [
        "swoole",
        "laravel",
        "lumen",
        "async",
        "server",
        "http",
        "websocket",
        "tcp",
        "udp",
        "process",
        "task",
        "timer",
        "performance"
      ],
      "is_fork": false,
      "size_kb": 5774,
      "has_wiki": true,
      "homepage": null,
      "languages": {
        "PHP": 183874,
        "Shell": 1482
      },
      "pushed_at": "2026-07-20T06:59:04Z",
      "created_at": "2018-01-16T07:37:04Z",
      "owner_type": "User",
      "updated_at": "2026-07-20T06:58:02Z",
      "description": "LaravelS is an out-of-the-box adapter between Laravel/Lumen and Swoole.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "PHP-8.x",
      "license_spdx_raw": "MIT",
      "primary_language": "PHP",
      "significant_languages": [
        "PHP"
      ]
    },
    "owner": {
      "blog": "https://5200.dev",
      "name": "Biao Xie",
      "type": "User",
      "login": "hhxsv5",
      "company": "@open-smf",
      "location": "Chengdu, China",
      "followers": 243,
      "avatar_url": "https://avatars.githubusercontent.com/u/7278743?v=4",
      "created_at": "2014-04-13T07:58:46Z",
      "is_verified": null,
      "public_repos": 61,
      "account_age_days": 4480
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases_count": 100,
      "commits_last_year": 21,
      "latest_release_at": "2026-07-20T06:59:04Z",
      "latest_release_tag": "v3.8.8",
      "releases_from_tags": false,
      "days_since_last_push": 0,
      "active_weeks_last_year": 10,
      "days_since_latest_release": 0,
      "mean_days_between_releases": 64.9
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 57,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "hhxsv5/laravel-s",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "performance",
            "http",
            "websocket",
            "process",
            "tcp",
            "server",
            "task",
            "async",
            "laravel",
            "timer",
            "udp",
            "inotify",
            "coroutine",
            "swoole",
            "lumen",
            "LaravelS",
            "laravel-s"
          ],
          "ecosystem": "packagist",
          "matches_repo": true,
          "registry_url": "https://packagist.org/packages/hhxsv5/laravel-s",
          "is_deprecated": false,
          "latest_version": "v3.8.7",
          "repository_url": "https://github.com/hhxsv5/laravel-s",
          "versions_count": 231,
          "total_downloads": 694175,
          "dependents_count": 14,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": 4384,
          "first_published_at": null,
          "latest_published_at": "2026-01-17T09:14:03Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 183
        }
      ]
    },
    "popularity": {
      "forks": 465,
      "stars": 3881,
      "watchers": 190,
      "open_issues_and_prs": 70
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "largest_source_bytes": 15120,
      "source_files_sampled": 81,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "composer.json"
      ],
      "ecosystems": [
        "packagist"
      ],
      "dependencies": [
        {
          "name": "swoole/ide-helper",
          "manifest": "composer.json",
          "ecosystem": "packagist",
          "version_constraint": "@dev"
        },
        {
          "name": "symfony/console",
          "manifest": "composer.json",
          "ecosystem": "packagist",
          "version_constraint": ">=6.4.0"
        }
      ],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "swoole/ide-helper",
            "direct": true,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "symfony/console",
            "direct": true,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "ext-curl",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "ext-json",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "ext-pcntl",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "php",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "phpunit/phpunit",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 7,
        "direct_count": 2,
        "indirect_count": 5
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 4,
        "merged_prs": 63,
        "open_issues": 66,
        "closed_ratio": 0.844,
        "closed_issues": 357,
        "closed_unmerged_prs": 10
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "hhxsv5",
          "commits": 1624,
          "avatar_url": "https://avatars.githubusercontent.com/u/7278743?v=4"
        },
        {
          "type": "User",
          "login": "Louis-Ni",
          "commits": 13,
          "avatar_url": "https://avatars.githubusercontent.com/u/56672404?v=4"
        },
        {
          "type": "User",
          "login": "dizys",
          "commits": 9,
          "avatar_url": "https://avatars.githubusercontent.com/u/23469706?v=4"
        },
        {
          "type": "User",
          "login": "PrintNow",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/u/28396104?v=4"
        },
        {
          "type": "User",
          "login": "eleven26",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/u/10000532?v=4"
        },
        {
          "type": "User",
          "login": "davidhhuan",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/u/449399?v=4"
        },
        {
          "type": "User",
          "login": "drzippie",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/239421?v=4"
        },
        {
          "type": "User",
          "login": "reatang",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/8022923?v=4"
        },
        {
          "type": "User",
          "login": "woann",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/25681022?v=4"
        },
        {
          "type": "User",
          "login": "never615",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/9959927?v=4"
        }
      ],
      "contributors_sampled": 34,
      "top_contributor_share": 0.951
    },
    "quality_signals": {
      "has_ci": false,
      "has_tests": true,
      "ci_workflows": [],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": null,
            "reason": "internal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 0,
            "reason": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 1,
            "reason": "Found 3/20 approved changesets -- score normalized to 1",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 4 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": null,
            "reason": "no workflows found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 5,
            "reason": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": null,
            "reason": "no dependencies found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": null,
            "reason": "No tokens found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "aac9fb39350a182eb80e2086a7452ef60cd0aa68",
        "ran_at": "2026-07-20T07:00:37Z",
        "aggregate_score": 3.9,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/hhxsv5/laravel-s",
    "host": "github.com",
    "name": "laravel-s",
    "owner": "hhxsv5"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 57,
      "inputs": {
        "security": 39,
        "vitality": 73,
        "community": 69,
        "governance": 63,
        "engineering": 38
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 73,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 60,
            "inputs": {
              "commits_last_year": 21,
              "human_commit_share": null,
              "days_since_last_push": 0,
              "active_weeks_last_year": 10
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "10/52 weeks with commits",
                "points": 6.9,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 10
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "21 commits in the last year",
                "points": 12.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 21
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 5,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 92,
            "inputs": {
              "releases_count": 100,
              "latest_release_tag": "v3.8.8",
              "releases_from_tags": false,
              "days_since_latest_release": 0,
              "mean_days_between_releases": 64.9
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "100 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 100
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~64.9 days",
                "points": 19.8,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 64.9
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "no_commit_sample",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 69,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "excellent",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 93,
            "inputs": {
              "forks": 465,
              "stars": 3881,
              "watchers": 190,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "3,881 stars",
                "points": 58.2,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 3881
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "465 forks",
                "points": 22.2,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 465
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "190 watchers",
                "points": 12.7,
                "status": "partial",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 190
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": null,
            "notes": [],
            "value": 56,
            "inputs": {
              "packages": [
                "hhxsv5/laravel-s"
              ],
              "dependents": 14,
              "ecosystems": "packagist",
              "total_downloads": 694175,
              "monthly_downloads": 4384
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "4,384 downloads/month across packagist",
                "points": 48.6,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 4384,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "14 packages depend on it",
                "points": 7.8,
                "status": "partial",
                "details": [
                  {
                    "code": "registry_dependents",
                    "params": {
                      "count": 14
                    }
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 63,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "at_risk",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 34,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 34,
              "top_contributor_share": 0.951
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 95% of commits",
                "points": 1.1,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 95
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "34 contributors",
                "points": 13.5,
                "status": "met",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 34
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 4 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "good",
            "name": "Issue & PR responsiveness",
            "note": null,
            "notes": [],
            "value": 74,
            "inputs": {
              "merged_prs": 63,
              "open_issues": 66,
              "closed_issues": 357,
              "issue_closed_ratio": 0.844,
              "closed_unmerged_prs": 10
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "84% of issues closed",
                "points": 39.5,
                "status": "partial",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 84
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "63/73 decided PRs merged",
                "points": 33,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 63,
                      "decided": 73
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 3/20 approved changesets -- score normalized to 1",
                "points": 1.5,
                "status": "partial",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "verified_domain"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 65,
            "inputs": {
              "followers": 243,
              "owner_type": "User",
              "is_verified": null,
              "owner_login": "hhxsv5",
              "public_repos": 61,
              "account_age_days": 4480
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "personal (user) account",
                "points": 10,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_personal",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": "not applicable to user accounts",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_applicable_to_user_accounts",
                    "params": {}
                  }
                ],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "243 followers of hhxsv5",
                "points": 17.2,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 243,
                      "login": "hhxsv5"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "61 public repos, account ~12 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 61
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 12
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 91,
            "inputs": {
              "packages": [
                "hhxsv5/laravel-s"
              ],
              "ecosystems": "packagist",
              "any_deprecated": false,
              "min_days_since_publish": 183
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on packagist",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 183 days ago",
                "points": 26,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 183
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "231 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 231
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "at_risk",
        "name": "Engineering Quality",
        "value": 38,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "critical",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 24,
            "inputs": {
              "has_ci": false,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 60,
            "inputs": {
              "topics": [
                "swoole",
                "laravel",
                "lumen",
                "async",
                "server",
                "http",
                "websocket",
                "tcp",
                "udp",
                "process",
                "task",
                "timer",
                "performance"
              ],
              "has_wiki": true,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "13 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 13
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 39,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Branch-Protection, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "branch_protection",
                    "dangerous_workflow",
                    "packaging",
                    "pinned_dependencies",
                    "signed_releases",
                    "token_permissions"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 39,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 12,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 6,
              "scorecard_aggregate": 3.9
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "internal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 3/20 approved changesets -- score normalized to 1",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 4 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no workflows found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 3.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "No tokens found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 11
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 25,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance",
                    "openssf_scorecard_pinned_dependencies"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 31,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "primary_language": "PHP",
              "largest_source_bytes": 15120,
              "source_files_sampled": 81,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "PHP without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "PHP"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/81 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 81,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [],
  "report_type": "repository",
  "generated_at": "2026-07-20T07:01:00.949217Z",
  "schema_version": "0.15.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/h/hhxsv5/laravel-s.svg",
  "full_name": "hhxsv5/laravel-s",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.15.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasPackagist.