Публічний реєстр
Звіт про здоров'я програмного забезпеченнясхема 0.15.0 · метрики 1.13.0 · 2026-07-20 07:01 UTC

hhxsv5 / laravel-s

LaravelS is an out-of-the-box adapter between Laravel/Lumen and Swoole.

PHPMIT★ 3 881 зірка⑂ 465 форківз січ. 2018 р.Переглянути на GitHub ↗

hhxsv5/laravel-s має індекс здоров’я 57 зі 100, що відповідає смузі «Помірний». Найвищий показник — Vitality (73/100), найнижчий — AI Readiness (25/100). Останнє оновлення — сьогодні. Більшість нещодавньої роботи виконує один учасник.

57
загалом / 100
Помірний

Індекс здоров'я програмного забезпечення

Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.

57
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
ЖиттєздатністьСпільнота тавпровадженняСталість таврядуванняІнженернаякістьБезпекаГотовність доШІ

Профіль оцінок

Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.

Власність

Biao XieОсобистий обліковий запис
243 підписники61 публічний репозиторійз квіт. 2014 р.@open-smf

Цей репозиторій належить особистому обліковому запису. Проєкт з єдиним власником несе більший ризик безперервності, ніж підтримуваний організацією.

Пакетні екосистеми

РеєстрПакетВерсіяЗавантажень / місВерсіїОстання публікаціяТеги
Packagisthhxsv5/laravel-sv3.8.74 384231183 дні томуperformancehttpwebsocketprocesstcpservertaskasynclaraveltimerudpinotifycoroutineswoolelumenlaravelslaravel-s

Метрики за категоріями

Життєздатність

Чи живий проєкт — чи пишеться код і чи виходять релізи?

73Добрий · 22% загального індексу
Як обчислюється оцінка
36/36Свіжість push — останній push 0 дн. тому
6.9/36Ритм комітів — 10/52 тижнів із комітами
12.1/18Обсяг комітів — 21 комітів за останній рік
5/10OpenSSF Scorecard: Maintained — 7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
Використані вхідні дані
commits_last_year21
human_commit_share
days_since_last_push0
active_weeks_last_year10
Як обчислюється оцінка
27/27Випускає релізи — опубліковано 100 релізів
36/36Свіжість релізів — останній реліз 0 дн. тому
19.8/27Ритм релізів — реліз кожні ~64,9 дн.
0/10OpenSSF Scorecard: Signed-Releases — немає даних
Використані вхідні дані
releases_count100
latest_release_tagv3.8.8
releases_from_tagsні
days_since_latest_release0
mean_days_between_releases64,9
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Signed-Releases. Залишкові ваги перенормовано.

Спільнота та впровадження

Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?

69Помірний · 18% загального індексу
Як обчислюється оцінка
58.2/60Зірки — 3 881 зірок
22.2/25Форки — 465 форків
12.7/15Спостерігачі — 190 спостерігачів
Використані вхідні дані
forks465
stars3 881
watchers190
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Як обчислюється оцінка
22.5/22.5README
22.5/22.5Ліцензія — визнана ліцензія (MIT)
0/18Настанови CONTRIBUTING
0/13.5Кодекс поведінки
0/7.2Шаблон issue
0/6.3Шаблон PR
Використані вхідні дані
has_readmeтак
has_licenseтак
has_contributingні
has_issue_templateні
has_code_of_conductні
has_pull_request_templateні
Як обчислюється оцінка
48.6/80Щомісячні завантаження — 4 384 завантажень/місяць у packagist
7.8/20Залежні пакети в реєстрі — залежних пакетів: 14
Використані вхідні дані
packageshhxsv5/laravel-s
dependents14
ecosystemspackagist
total_downloads694 175
monthly_downloads4 384

Сталість та врядування

Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?

63Помірний · 24% загального індексу
Як обчислюється оцінка
9/54Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів
1.1/22.5Розподіл комітів — головний контриб’ютор — автор 95% комітів
13.5/13.5Широта контриб’юторів — 34 контриб’юторів
10/10OpenSSF Scorecard: Contributors — project has 4 contributing companies or organizations
Використані вхідні дані
bus_factor1
contributors_sampled34
top_contributor_share0,951
Як обчислюється оцінка
39.5/46.8Вирішення issue — закрито 84% issue
33/38.3Прийняття PR — злито 63/73 вирішених PR
1.5/15OpenSSF Scorecard: Code-Review — Found 3/20 approved changesets -- score normalized to 1
Використані вхідні дані
merged_prs63
open_issues66
closed_issues357
issue_closed_ratio0,844
closed_unmerged_prs10
Як обчислюється оцінка
10/30Підтримка власника — особистий (користувацький) обліковий запис
0/20Верифікований домен — не застосовно до користувацьких облікових записів
17.2/25Охоплення власника — 243 підписників у hhxsv5
25/25Послужний список — 61 публічних репозиторіїв, вік облікового запису ~12 р.
Використані вхідні дані
followers243
owner_typeUser
is_verified
owner_loginhhxsv5
public_repos61
account_age_days4 480
Виключено з оцінювання (немає даних або не застосовно): Верифікований домен. Залишкові ваги перенормовано.
Як обчислюється оцінка
25/25Опубліковано й доступно — 1 пакет(ів) у packagist
26/35Свіжість публікацій — остання публікація 183 дн. тому
20/20Історія версій — 231 опублікованих версій
20/20Не застарілий — активний, не deprecated і не yanked
Використані вхідні дані
packageshhxsv5/laravel-s
ecosystemspackagist
any_deprecatedні
min_days_since_publish183

Інженерна якість

Чи наявні базові інженерні практики та документація?

38У зоні ризику · 20% загального індексу
Як обчислюється оцінка
0/24Процеси CI
24/24Наявні тести
0/16Конфігурація лінтера
0/9.6Pre-commit-хуки
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — 0 out of 6 merged PRs checked by a CI test -- score normalized to 0
Використані вхідні дані
has_ciні
has_testsтак
has_editorconfigні
has_linter_configні
has_precommit_configні

Документація

60Помірний
Як обчислюється оцінка
30/30README
0/25Каталог документації
0/15Сайт документації / домашня сторінка
10/10Опис репозиторію
10/10Теми — 13 тем
10/10Wiki
Використані вхідні дані
topicsswoole, laravel, lumen, async, server, http, websocket, tcp, udp, process, task, timer, performance
has_wikiтак
homepage
has_readmeтак
has_docs_dirні
has_descriptionтак

Безпека

Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?

39У зоні ризику · 16% загального індексу

Стан безпеки

39У зоні ризику
Як обчислюється оцінка
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — немає даних
0/2.5CI-Tests — 0 out of 6 merged PRs checked by a CI test -- score normalized to 0
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0.8/7.5Code-Review — Found 3/20 approved changesets -- score normalized to 1
2.5/2.5Contributors — project has 4 contributing companies or organizations
0/10Dangerous-Workflow — немає даних
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Ліцензія — license file detected
3.8/7.5Maintained — 7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
0/5Packaging — немає даних
0/5Pinned-Dependencies — немає даних
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — немає даних
0/7.5Token-Permissions — немає даних
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Використані вхідні дані
sourceopenssf_scorecard
checks_evaluated12
scorecard_versionv5.5.0
checks_inconclusive6
scorecard_aggregate3,9
Виключено з оцінювання (немає даних або не застосовно): branch_protection, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Залишкові ваги перенормовано.

Готовність до ШІ

Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.

25Критичний · 0% загального індексу
Як обчислюється оцінка
0/45Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора
0/15Машиночитана документація (llms.txt)
0/40Читабельна історія комітів — немає даних
Використані вхідні дані
has_llms_txtні
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Виключено з оцінювання (немає даних або не застосовно): Читабельна історія комітів. Залишкові ваги перенормовано.
Як обчислюється оцінка
0/18Розгортання однією командою
22/22Автоматизовані тести
0/11Конфігурація лінтера / форматера
0/11Статична перевірка типів
0/10Відтворюване середовище
0/10Підтверджена практика роботи з агентами — немає даних
0/8Автоматизоване супроводження — немає даних
0/10OpenSSF Scorecard: Pinned-Dependencies — немає даних
Використані вхідні дані
has_nixні
has_testsтак
lockfiles
has_dockerfileні
typed_languageні
bootstrap_files
has_devcontainerні
has_linter_configні
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Виключено з оцінювання (немає даних або не застосовно): Підтверджена практика роботи з агентами, Автоматизоване супроводження, OpenSSF Scorecard: Pinned-Dependencies. Залишкові ваги перенормовано.
Як обчислюється оцінка
0/45Типізований код — PHP без конфігурації перевірки типів
55/55Керовані розміри файлів — 0/81 файлів вихідного коду понад 60 КБ
Використані вхідні дані
primary_languagePHP
largest_source_bytes15 120
source_files_sampled81
oversized_source_files0

Ключові факти

3 881зірок GitHub
34контриб'юторів
21комітів за останні 12 місяців
0днів від останнього пушу
100релізів
1бас-фактор
66відкритих issue
Packagistпакетних екосистем

Докладніше

OpenSSF Scorecard 3.9 / 10
3.9сукупно

Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).Scorecard v5.5.0 · 2026-07-20 07:00 UTC

10Binary-Artifactsno binaries found in the repo
н/дBranch-Protectioninternal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md
0CI-Tests0 out of 6 merged PRs checked by a CI test -- score normalized to 0
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
1Code-ReviewFound 3/20 approved changesets -- score normalized to 1
10Contributorsproject has 4 contributing companies or organizations
н/дDangerous-Workflowno workflows found
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
5Maintained7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
н/дPackagingpackaging workflow not detected
н/дPinned-Dependenciesno dependencies found
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
н/дSigned-Releasesno releases found
н/дToken-PermissionsNo tokens found
10Vulnerabilities0 existing vulnerabilities detected
Прямі залежності 2
РеєстрПакетОбмеження версіїМаніфест
Packagistswoole/ide-helper@devcomposer.json
Packagistsymfony/console>=6.4.0composer.json
Усі залежності 7

Повний розв'язаний набір залежностей із графа залежностей GitHub: 2 прямих і 5 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.

РеєстрПакетВерсіяЗв'язок
Packagistswoole/ide-helperпряма
Packagistsymfony/consoleпряма
Packagistext-curlнепряма
Packagistext-jsonнепряма
Packagistext-pcntlнепряма
Packagistphpнепряма
Packagistphpunit/phpunitнепряма
Звіт у форматі JSON машиночитний
{
  "data": {
    "repo": {
      "topics": [
        "swoole",
        "laravel",
        "lumen",
        "async",
        "server",
        "http",
        "websocket",
        "tcp",
        "udp",
        "process",
        "task",
        "timer",
        "performance"
      ],
      "is_fork": false,
      "size_kb": 5774,
      "has_wiki": true,
      "homepage": null,
      "languages": {
        "PHP": 183874,
        "Shell": 1482
      },
      "pushed_at": "2026-07-20T06:59:04Z",
      "created_at": "2018-01-16T07:37:04Z",
      "owner_type": "User",
      "updated_at": "2026-07-20T06:58:02Z",
      "description": "LaravelS is an out-of-the-box adapter between Laravel/Lumen and Swoole.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "PHP-8.x",
      "license_spdx_raw": "MIT",
      "primary_language": "PHP",
      "significant_languages": [
        "PHP"
      ]
    },
    "owner": {
      "blog": "https://5200.dev",
      "name": "Biao Xie",
      "type": "User",
      "login": "hhxsv5",
      "company": "@open-smf",
      "location": "Chengdu, China",
      "followers": 243,
      "avatar_url": "https://avatars.githubusercontent.com/u/7278743?v=4",
      "created_at": "2014-04-13T07:58:46Z",
      "is_verified": null,
      "public_repos": 61,
      "account_age_days": 4480
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases_count": 100,
      "commits_last_year": 21,
      "latest_release_at": "2026-07-20T06:59:04Z",
      "latest_release_tag": "v3.8.8",
      "releases_from_tags": false,
      "days_since_last_push": 0,
      "active_weeks_last_year": 10,
      "days_since_latest_release": 0,
      "mean_days_between_releases": 64.9
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 57,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "hhxsv5/laravel-s",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "performance",
            "http",
            "websocket",
            "process",
            "tcp",
            "server",
            "task",
            "async",
            "laravel",
            "timer",
            "udp",
            "inotify",
            "coroutine",
            "swoole",
            "lumen",
            "LaravelS",
            "laravel-s"
          ],
          "ecosystem": "packagist",
          "matches_repo": true,
          "registry_url": "https://packagist.org/packages/hhxsv5/laravel-s",
          "is_deprecated": false,
          "latest_version": "v3.8.7",
          "repository_url": "https://github.com/hhxsv5/laravel-s",
          "versions_count": 231,
          "total_downloads": 694175,
          "dependents_count": 14,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": 4384,
          "first_published_at": null,
          "latest_published_at": "2026-01-17T09:14:03Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 183
        }
      ]
    },
    "popularity": {
      "forks": 465,
      "stars": 3881,
      "watchers": 190,
      "open_issues_and_prs": 70
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "largest_source_bytes": 15120,
      "source_files_sampled": 81,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "composer.json"
      ],
      "ecosystems": [
        "packagist"
      ],
      "dependencies": [
        {
          "name": "swoole/ide-helper",
          "manifest": "composer.json",
          "ecosystem": "packagist",
          "version_constraint": "@dev"
        },
        {
          "name": "symfony/console",
          "manifest": "composer.json",
          "ecosystem": "packagist",
          "version_constraint": ">=6.4.0"
        }
      ],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "swoole/ide-helper",
            "direct": true,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "symfony/console",
            "direct": true,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "ext-curl",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "ext-json",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "ext-pcntl",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "php",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          },
          {
            "name": "phpunit/phpunit",
            "direct": false,
            "version": null,
            "ecosystem": "packagist"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 7,
        "direct_count": 2,
        "indirect_count": 5
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 4,
        "merged_prs": 63,
        "open_issues": 66,
        "closed_ratio": 0.844,
        "closed_issues": 357,
        "closed_unmerged_prs": 10
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "hhxsv5",
          "commits": 1624,
          "avatar_url": "https://avatars.githubusercontent.com/u/7278743?v=4"
        },
        {
          "type": "User",
          "login": "Louis-Ni",
          "commits": 13,
          "avatar_url": "https://avatars.githubusercontent.com/u/56672404?v=4"
        },
        {
          "type": "User",
          "login": "dizys",
          "commits": 9,
          "avatar_url": "https://avatars.githubusercontent.com/u/23469706?v=4"
        },
        {
          "type": "User",
          "login": "PrintNow",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/u/28396104?v=4"
        },
        {
          "type": "User",
          "login": "eleven26",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/u/10000532?v=4"
        },
        {
          "type": "User",
          "login": "davidhhuan",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/u/449399?v=4"
        },
        {
          "type": "User",
          "login": "drzippie",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/239421?v=4"
        },
        {
          "type": "User",
          "login": "reatang",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/8022923?v=4"
        },
        {
          "type": "User",
          "login": "woann",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/25681022?v=4"
        },
        {
          "type": "User",
          "login": "never615",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/9959927?v=4"
        }
      ],
      "contributors_sampled": 34,
      "top_contributor_share": 0.951
    },
    "quality_signals": {
      "has_ci": false,
      "has_tests": true,
      "ci_workflows": [],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": null,
            "reason": "internal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 0,
            "reason": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 1,
            "reason": "Found 3/20 approved changesets -- score normalized to 1",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 4 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": null,
            "reason": "no workflows found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 5,
            "reason": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": null,
            "reason": "no dependencies found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": null,
            "reason": "No tokens found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "aac9fb39350a182eb80e2086a7452ef60cd0aa68",
        "ran_at": "2026-07-20T07:00:37Z",
        "aggregate_score": 3.9,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/hhxsv5/laravel-s",
    "host": "github.com",
    "name": "laravel-s",
    "owner": "hhxsv5"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 57,
      "inputs": {
        "security": 39,
        "vitality": 73,
        "community": 69,
        "governance": 63,
        "engineering": 38
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 73,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 60,
            "inputs": {
              "commits_last_year": 21,
              "human_commit_share": null,
              "days_since_last_push": 0,
              "active_weeks_last_year": 10
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "10/52 weeks with commits",
                "points": 6.9,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 10
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "21 commits in the last year",
                "points": 12.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 21
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 5,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 92,
            "inputs": {
              "releases_count": 100,
              "latest_release_tag": "v3.8.8",
              "releases_from_tags": false,
              "days_since_latest_release": 0,
              "mean_days_between_releases": 64.9
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "100 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 100
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~64.9 days",
                "points": 19.8,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 64.9
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "no_commit_sample",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 69,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "excellent",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 93,
            "inputs": {
              "forks": 465,
              "stars": 3881,
              "watchers": 190,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "3,881 stars",
                "points": 58.2,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 3881
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "465 forks",
                "points": 22.2,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 465
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "190 watchers",
                "points": 12.7,
                "status": "partial",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 190
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": null,
            "notes": [],
            "value": 56,
            "inputs": {
              "packages": [
                "hhxsv5/laravel-s"
              ],
              "dependents": 14,
              "ecosystems": "packagist",
              "total_downloads": 694175,
              "monthly_downloads": 4384
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "4,384 downloads/month across packagist",
                "points": 48.6,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 4384,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "14 packages depend on it",
                "points": 7.8,
                "status": "partial",
                "details": [
                  {
                    "code": "registry_dependents",
                    "params": {
                      "count": 14
                    }
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 63,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "at_risk",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 34,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 34,
              "top_contributor_share": 0.951
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 95% of commits",
                "points": 1.1,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 95
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "34 contributors",
                "points": 13.5,
                "status": "met",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 34
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 4 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "good",
            "name": "Issue & PR responsiveness",
            "note": null,
            "notes": [],
            "value": 74,
            "inputs": {
              "merged_prs": 63,
              "open_issues": 66,
              "closed_issues": 357,
              "issue_closed_ratio": 0.844,
              "closed_unmerged_prs": 10
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "84% of issues closed",
                "points": 39.5,
                "status": "partial",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 84
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "63/73 decided PRs merged",
                "points": 33,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 63,
                      "decided": 73
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 3/20 approved changesets -- score normalized to 1",
                "points": 1.5,
                "status": "partial",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "verified_domain"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 65,
            "inputs": {
              "followers": 243,
              "owner_type": "User",
              "is_verified": null,
              "owner_login": "hhxsv5",
              "public_repos": 61,
              "account_age_days": 4480
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "personal (user) account",
                "points": 10,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_personal",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": "not applicable to user accounts",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_applicable_to_user_accounts",
                    "params": {}
                  }
                ],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "243 followers of hhxsv5",
                "points": 17.2,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 243,
                      "login": "hhxsv5"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "61 public repos, account ~12 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 61
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 12
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 91,
            "inputs": {
              "packages": [
                "hhxsv5/laravel-s"
              ],
              "ecosystems": "packagist",
              "any_deprecated": false,
              "min_days_since_publish": 183
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on packagist",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 183 days ago",
                "points": 26,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 183
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "231 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 231
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "at_risk",
        "name": "Engineering Quality",
        "value": 38,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "critical",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 24,
            "inputs": {
              "has_ci": false,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 60,
            "inputs": {
              "topics": [
                "swoole",
                "laravel",
                "lumen",
                "async",
                "server",
                "http",
                "websocket",
                "tcp",
                "udp",
                "process",
                "task",
                "timer",
                "performance"
              ],
              "has_wiki": true,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "13 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 13
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 39,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Branch-Protection, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "branch_protection",
                    "dangerous_workflow",
                    "packaging",
                    "pinned_dependencies",
                    "signed_releases",
                    "token_permissions"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 39,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 12,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 6,
              "scorecard_aggregate": 3.9
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "internal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 3/20 approved changesets -- score normalized to 1",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 4 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no workflows found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 3.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "No tokens found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 11
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 25,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance",
                    "openssf_scorecard_pinned_dependencies"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 31,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "primary_language": "PHP",
              "largest_source_bytes": 15120,
              "source_files_sampled": 81,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "PHP without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "PHP"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/81 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 81,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [],
  "report_type": "repository",
  "generated_at": "2026-07-20T07:01:00.949217Z",
  "schema_version": "0.15.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/h/hhxsv5/laravel-s.svg",
  "full_name": "hhxsv5/laravel-s",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.

Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.15.0 — повна методологія · вікі метрик.

Як окремий результат виглядає на тлі всього реєстру: сукупна статистикаPackagist.