LaravelS is an out-of-the-box adapter between Laravel/Lumen and Swoole.
hhxsv5/laravel-s має індекс здоров’я 57 зі 100, що відповідає смузі «Помірний». Найвищий показник — Vitality (73/100), найнижчий — AI Readiness (25/100). Останнє оновлення — сьогодні. Більшість нещодавньої роботи виконує один учасник.
Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.
Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.
Цей репозиторій належить особистому обліковому запису. Проєкт з єдиним власником несе більший ризик безперервності, ніж підтримуваний організацією.
| Реєстр | Пакет | Версія | Завантажень / міс | Версії | Остання публікація | Теги |
|---|---|---|---|---|---|---|
| Packagist | hhxsv5/laravel-s | v3.8.7 | 4 384 | 231 | 183 дні тому | performancehttpwebsocketprocesstcpservertaskasynclaraveltimerudpinotifycoroutineswoolelumenlaravelslaravel-s |
Чи живий проєкт — чи пишеться код і чи виходять релізи?
| 36/36 | Свіжість push — останній push 0 дн. тому |
| 6.9/36 | Ритм комітів — 10/52 тижнів із комітами |
| 12.1/18 | Обсяг комітів — 21 комітів за останній рік |
| 5/10 | OpenSSF Scorecard: Maintained — 7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| commits_last_year | 21 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 10 |
| 27/27 | Випускає релізи — опубліковано 100 релізів |
| 36/36 | Свіжість релізів — останній реліз 0 дн. тому |
| 19.8/27 | Ритм релізів — реліз кожні ~64,9 дн. |
| 0/10 | OpenSSF Scorecard: Signed-Releases — немає даних |
| releases_count | 100 |
| latest_release_tag | v3.8.8 |
| releases_from_tags | ні |
| days_since_latest_release | 0 |
| mean_days_between_releases | 64,9 |
Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?
| 58.2/60 | Зірки — 3 881 зірок |
| 22.2/25 | Форки — 465 форків |
| 12.7/15 | Спостерігачі — 190 спостерігачів |
| forks | 465 |
| stars | 3 881 |
| watchers | 190 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Ліцензія — визнана ліцензія (MIT) |
| 0/18 | Настанови CONTRIBUTING |
| 0/13.5 | Кодекс поведінки |
| 0/7.2 | Шаблон issue |
| 0/6.3 | Шаблон PR |
| has_readme | так |
| has_license | так |
| has_contributing | ні |
| has_issue_template | ні |
| has_code_of_conduct | ні |
| has_pull_request_template | ні |
| 48.6/80 | Щомісячні завантаження — 4 384 завантажень/місяць у packagist |
| 7.8/20 | Залежні пакети в реєстрі — залежних пакетів: 14 |
| packages | hhxsv5/laravel-s |
| dependents | 14 |
| ecosystems | packagist |
| total_downloads | 694 175 |
| monthly_downloads | 4 384 |
Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?
| 9/54 | Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів |
| 1.1/22.5 | Розподіл комітів — головний контриб’ютор — автор 95% комітів |
| 13.5/13.5 | Широта контриб’юторів — 34 контриб’юторів |
| 10/10 | OpenSSF Scorecard: Contributors — project has 4 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 34 |
| top_contributor_share | 0,951 |
| 39.5/46.8 | Вирішення issue — закрито 84% issue |
| 33/38.3 | Прийняття PR — злито 63/73 вирішених PR |
| 1.5/15 | OpenSSF Scorecard: Code-Review — Found 3/20 approved changesets -- score normalized to 1 |
| merged_prs | 63 |
| open_issues | 66 |
| closed_issues | 357 |
| issue_closed_ratio | 0,844 |
| closed_unmerged_prs | 10 |
| 10/30 | Підтримка власника — особистий (користувацький) обліковий запис |
| 0/20 | Верифікований домен — не застосовно до користувацьких облікових записів |
| 17.2/25 | Охоплення власника — 243 підписників у hhxsv5 |
| 25/25 | Послужний список — 61 публічних репозиторіїв, вік облікового запису ~12 р. |
| followers | 243 |
| owner_type | User |
| is_verified | — |
| owner_login | hhxsv5 |
| public_repos | 61 |
| account_age_days | 4 480 |
| 25/25 | Опубліковано й доступно — 1 пакет(ів) у packagist |
| 26/35 | Свіжість публікацій — остання публікація 183 дн. тому |
| 20/20 | Історія версій — 231 опублікованих версій |
| 20/20 | Не застарілий — активний, не deprecated і не yanked |
| packages | hhxsv5/laravel-s |
| ecosystems | packagist |
| any_deprecated | ні |
| min_days_since_publish | 183 |
Чи наявні базові інженерні практики та документація?
| 0/24 | Процеси CI |
| 24/24 | Наявні тести |
| 0/16 | Конфігурація лінтера |
| 0/9.6 | Pre-commit-хуки |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — 0 out of 6 merged PRs checked by a CI test -- score normalized to 0 |
| has_ci | ні |
| has_tests | так |
| has_editorconfig | ні |
| has_linter_config | ні |
| has_precommit_config | ні |
| 30/30 | README |
| 0/25 | Каталог документації |
| 0/15 | Сайт документації / домашня сторінка |
| 10/10 | Опис репозиторію |
| 10/10 | Теми — 13 тем |
| 10/10 | Wiki |
| topics | swoole, laravel, lumen, async, server, http, websocket, tcp, udp, process, task, timer, performance |
| has_wiki | так |
| homepage | — |
| has_readme | так |
| has_docs_dir | ні |
| has_description | так |
Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — немає даних |
| 0/2.5 | CI-Tests — 0 out of 6 merged PRs checked by a CI test -- score normalized to 0 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0.8/7.5 | Code-Review — Found 3/20 approved changesets -- score normalized to 1 |
| 2.5/2.5 | Contributors — project has 4 contributing companies or organizations |
| 0/10 | Dangerous-Workflow — немає даних |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Ліцензія — license file detected |
| 3.8/7.5 | Maintained — 7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| 0/5 | Packaging — немає даних |
| 0/5 | Pinned-Dependencies — немає даних |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — немає даних |
| 0/7.5 | Token-Permissions — немає даних |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 3,9 |
Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.
| 0/45 | Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора |
| 0/15 | Машиночитана документація (llms.txt) |
| 0/40 | Читабельна історія комітів — немає даних |
| has_llms_txt | ні |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | Розгортання однією командою |
| 22/22 | Автоматизовані тести |
| 0/11 | Конфігурація лінтера / форматера |
| 0/11 | Статична перевірка типів |
| 0/10 | Відтворюване середовище |
| 0/10 | Підтверджена практика роботи з агентами — немає даних |
| 0/8 | Автоматизоване супроводження — немає даних |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — немає даних |
| has_nix | ні |
| has_tests | так |
| lockfiles | — |
| has_dockerfile | ні |
| typed_language | ні |
| bootstrap_files | — |
| has_devcontainer | ні |
| has_linter_config | ні |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 0/45 | Типізований код — PHP без конфігурації перевірки типів |
| 55/55 | Керовані розміри файлів — 0/81 файлів вихідного коду понад 60 КБ |
| primary_language | PHP |
| largest_source_bytes | 15 120 |
| source_files_sampled | 81 |
| oversized_source_files | 0 |
Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).
| 10 | Binary-Artifacts | no binaries found in the repo |
| н/д | Branch-Protection | internal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 0 | CI-Tests | 0 out of 6 merged PRs checked by a CI test -- score normalized to 0 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 1 | Code-Review | Found 3/20 approved changesets -- score normalized to 1 |
| 10 | Contributors | project has 4 contributing companies or organizations |
| н/д | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 5 | Maintained | 7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| н/д | Packaging | packaging workflow not detected |
| н/д | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| н/д | Signed-Releases | no releases found |
| н/д | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Реєстр | Пакет | Обмеження версії | Маніфест |
|---|---|---|---|
| Packagist | swoole/ide-helper | @dev | composer.json |
| Packagist | symfony/console | >=6.4.0 | composer.json |
Повний розв'язаний набір залежностей із графа залежностей GitHub: 2 прямих і 5 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.
| Реєстр | Пакет | Версія | Зв'язок |
|---|---|---|---|
| Packagist | swoole/ide-helper | — | пряма |
| Packagist | symfony/console | — | пряма |
| Packagist | ext-curl | — | непряма |
| Packagist | ext-json | — | непряма |
| Packagist | ext-pcntl | — | непряма |
| Packagist | php | — | непряма |
| Packagist | phpunit/phpunit | — | непряма |
{
"data": {
"repo": {
"topics": [
"swoole",
"laravel",
"lumen",
"async",
"server",
"http",
"websocket",
"tcp",
"udp",
"process",
"task",
"timer",
"performance"
],
"is_fork": false,
"size_kb": 5774,
"has_wiki": true,
"homepage": null,
"languages": {
"PHP": 183874,
"Shell": 1482
},
"pushed_at": "2026-07-20T06:59:04Z",
"created_at": "2018-01-16T07:37:04Z",
"owner_type": "User",
"updated_at": "2026-07-20T06:58:02Z",
"description": "LaravelS is an out-of-the-box adapter between Laravel/Lumen and Swoole.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "PHP-8.x",
"license_spdx_raw": "MIT",
"primary_language": "PHP",
"significant_languages": [
"PHP"
]
},
"owner": {
"blog": "https://5200.dev",
"name": "Biao Xie",
"type": "User",
"login": "hhxsv5",
"company": "@open-smf",
"location": "Chengdu, China",
"followers": 243,
"avatar_url": "https://avatars.githubusercontent.com/u/7278743?v=4",
"created_at": "2014-04-13T07:58:46Z",
"is_verified": null,
"public_repos": 61,
"account_age_days": 4480
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 100,
"commits_last_year": 21,
"latest_release_at": "2026-07-20T06:59:04Z",
"latest_release_tag": "v3.8.8",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 10,
"days_since_latest_release": 0,
"mean_days_between_releases": 64.9
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 57,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "hhxsv5/laravel-s",
"exists": true,
"license": "MIT",
"keywords": [
"performance",
"http",
"websocket",
"process",
"tcp",
"server",
"task",
"async",
"laravel",
"timer",
"udp",
"inotify",
"coroutine",
"swoole",
"lumen",
"LaravelS",
"laravel-s"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/hhxsv5/laravel-s",
"is_deprecated": false,
"latest_version": "v3.8.7",
"repository_url": "https://github.com/hhxsv5/laravel-s",
"versions_count": 231,
"total_downloads": 694175,
"dependents_count": 14,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 4384,
"first_published_at": null,
"latest_published_at": "2026-01-17T09:14:03Z",
"latest_version_yanked": null,
"days_since_latest_publish": 183
}
]
},
"popularity": {
"forks": 465,
"stars": 3881,
"watchers": 190,
"open_issues_and_prs": 70
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 15120,
"source_files_sampled": 81,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json"
],
"ecosystems": [
"packagist"
],
"dependencies": [
{
"name": "swoole/ide-helper",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "@dev"
},
{
"name": "symfony/console",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": ">=6.4.0"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "swoole/ide-helper",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "symfony/console",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "ext-curl",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "ext-json",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "ext-pcntl",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "php",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "phpunit/phpunit",
"direct": false,
"version": null,
"ecosystem": "packagist"
}
],
"collected": true,
"truncated": false,
"total_count": 7,
"direct_count": 2,
"indirect_count": 5
}
},
"maintainership": {
"issues": {
"open_prs": 4,
"merged_prs": 63,
"open_issues": 66,
"closed_ratio": 0.844,
"closed_issues": 357,
"closed_unmerged_prs": 10
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "hhxsv5",
"commits": 1624,
"avatar_url": "https://avatars.githubusercontent.com/u/7278743?v=4"
},
{
"type": "User",
"login": "Louis-Ni",
"commits": 13,
"avatar_url": "https://avatars.githubusercontent.com/u/56672404?v=4"
},
{
"type": "User",
"login": "dizys",
"commits": 9,
"avatar_url": "https://avatars.githubusercontent.com/u/23469706?v=4"
},
{
"type": "User",
"login": "PrintNow",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/28396104?v=4"
},
{
"type": "User",
"login": "eleven26",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/10000532?v=4"
},
{
"type": "User",
"login": "davidhhuan",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/449399?v=4"
},
{
"type": "User",
"login": "drzippie",
"commits": 4,
"avatar_url": "https://avatars.githubusercontent.com/u/239421?v=4"
},
{
"type": "User",
"login": "reatang",
"commits": 4,
"avatar_url": "https://avatars.githubusercontent.com/u/8022923?v=4"
},
{
"type": "User",
"login": "woann",
"commits": 4,
"avatar_url": "https://avatars.githubusercontent.com/u/25681022?v=4"
},
{
"type": "User",
"login": "never615",
"commits": 4,
"avatar_url": "https://avatars.githubusercontent.com/u/9959927?v=4"
}
],
"contributors_sampled": 34,
"top_contributor_share": 0.951
},
"quality_signals": {
"has_ci": false,
"has_tests": true,
"ci_workflows": [],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 0,
"reason": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 1,
"reason": "Found 3/20 approved changesets -- score normalized to 1",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 4 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 5,
"reason": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "aac9fb39350a182eb80e2086a7452ef60cd0aa68",
"ran_at": "2026-07-20T07:00:37Z",
"aggregate_score": 3.9,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/hhxsv5/laravel-s",
"host": "github.com",
"name": "laravel-s",
"owner": "hhxsv5"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 57,
"inputs": {
"security": 39,
"vitality": 73,
"community": 69,
"governance": 63,
"engineering": 38
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 73,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 60,
"inputs": {
"commits_last_year": 21,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 10
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "10/52 weeks with commits",
"points": 6.9,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 10
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "21 commits in the last year",
"points": 12.1,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 21
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 5,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"releases_count": 100,
"latest_release_tag": "v3.8.8",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 64.9
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~64.9 days",
"points": 19.8,
"status": "partial",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 64.9
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 69,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "excellent",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 93,
"inputs": {
"forks": 465,
"stars": 3881,
"watchers": 190,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "3,881 stars",
"points": 58.2,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 3881
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "465 forks",
"points": 22.2,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 465
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "190 watchers",
"points": 12.7,
"status": "partial",
"details": [
{
"code": "watchers",
"params": {
"count": 190
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"packages": [
"hhxsv5/laravel-s"
],
"dependents": 14,
"ecosystems": "packagist",
"total_downloads": 694175,
"monthly_downloads": 4384
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "4,384 downloads/month across packagist",
"points": 48.6,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 4384,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "14 packages depend on it",
"points": 7.8,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 14
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 63,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 34,
"top_contributor_share": 0.951
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 95% of commits",
"points": 1.1,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 95
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "34 contributors",
"points": 13.5,
"status": "met",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 34
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "good",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"merged_prs": 63,
"open_issues": 66,
"closed_issues": 357,
"issue_closed_ratio": 0.844,
"closed_unmerged_prs": 10
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "84% of issues closed",
"points": 39.5,
"status": "partial",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 84
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "63/73 decided PRs merged",
"points": 33,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 63,
"decided": 73
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 3/20 approved changesets -- score normalized to 1",
"points": 1.5,
"status": "partial",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 65,
"inputs": {
"followers": 243,
"owner_type": "User",
"is_verified": null,
"owner_login": "hhxsv5",
"public_repos": 61,
"account_age_days": 4480
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "243 followers of hhxsv5",
"points": 17.2,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 243,
"login": "hhxsv5"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "61 public repos, account ~12 yr old",
"points": 25,
"status": "met",
"details": [
{
"code": "public_repos",
"params": {
"count": 61
}
},
{
"code": "account_age_years",
"params": {
"years": 12
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 91,
"inputs": {
"packages": [
"hhxsv5/laravel-s"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 183
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 183 days ago",
"points": 26,
"status": "partial",
"details": [
{
"code": "publish_recency",
"params": {
"days": 183
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "231 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 231
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "at_risk",
"name": "Engineering Quality",
"value": 38,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "critical",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 24,
"inputs": {
"has_ci": false,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 60,
"inputs": {
"topics": [
"swoole",
"laravel",
"lumen",
"async",
"server",
"http",
"websocket",
"tcp",
"udp",
"process",
"task",
"timer",
"performance"
],
"has_wiki": true,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "13 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 13
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 39,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 39,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 12,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 6,
"scorecard_aggregate": 3.9
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during GetBranch(PHP-7.x): error during branchesHandler.query: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "0 out of 6 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 3/20 approved changesets -- score normalized to 1",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "7 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 11
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 25,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "at_risk",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice",
"automated_maintenance",
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 31,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": null
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "PHP",
"largest_source_bytes": 15120,
"source_files_sampled": 81,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "PHP without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "PHP"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/81 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 81,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-20T07:01:00.949217Z",
"schema_version": "0.15.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/h/hhxsv5/laravel-s.svg",
"full_name": "hhxsv5/laravel-s",
"license_state": "standard",
"license_spdx": "MIT"
}Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.
Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.15.0 — повна методологія · вікі метрик.
Як окремий результат виглядає на тлі всього реєстру: сукупна статистика — Packagist.