Public recordModerate
Software health reportschema 0.27.0 · metrics 1.13.0 · 2026-07-23 00:03 UTC
rawilk / filament-password-input
Enhanced password input component for filament.
rawilk/filament-password-input holds a health index of 61 out of 100, placing it in the Moderate band. It scores highest on Vitality (69/100) and lowest on AI Readiness (28/100). It was last updated 30 days ago. A single contributor accounts for most of its recent work.
61
overall / 100Software health index
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.
61
Excellent85-100Exemplary; meets essentially all checked criteria
Good70-84Healthy; minor gaps
Moderate50-69Acceptable with notable gaps; review recommended
At risk30-49Significant weaknesses; adoption warrants caution
Critical1-29Severe problems (abandoned, single-maintainer, no hygiene)
Score profile
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
Ownership
Randall WilkPersonal account
108 followers32 public repossince Oct 2016Randall Wilk
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
Package ecosystems
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| Packagist | rawilk/filament-password-input | v3.2.0 | 12,675 | 15 | 84 days ago | uipasswordformslaravelfilamentrawilkfilament-password-input |
Metrics by category
Vitality
Is the project alive — is code being written and are releases shipping?
69
Development activity
54Moderate
How it's scored
| 28.8/36 | Push recency — last push 30 days ago |
| 4.8/36 | Commit cadence — 7/52 weeks with commits |
| 15.3/18 | Commit volume — 49 commits in the last year |
| 5/10 | OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
Inputs used
| commits_last_year | 49 |
| human_commit_share | 0.75 |
| days_since_last_push | 30 |
| active_weeks_last_year | 7 |
Release discipline
92Excellent
How it's scored
| 27/27 | Ships releases — 15 releases published |
| 36/36 | Release recency — latest release 84 days ago |
| 19.8/27 | Release cadence — a release every ~94.8 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
Inputs used
| releases_count | 15 |
| latest_release_tag | v3.2.0 |
| releases_from_tags | no |
| days_since_latest_release | 84 |
| mean_days_between_releases | 94.8 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.
Community & Adoption
Does the project have users, downloads, attention, and a welcoming setup for contributors?
57
Popularity & adoption
38At risk
How it's scored
| 27.7/60 | Stars — 52 stars |
| 10.3/25 | Forks — 18 forks |
| 0/15 | Watchers — 1 watchers |
Inputs used
| forks | 18 |
| stars | 52 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community health
77Good
How it's scored
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 18/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 6.3/6.3 | PR template |
Inputs used
| has_readme | yes |
| has_license | yes |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | yes |
Ecosystem adoption (downloads)
60Moderate
How it's scored
| 54.7/80 | Monthly downloads — 12,675 downloads/month across packagist |
| 5.2/20 | Registry dependents — 5 packages depend on it |
Inputs used
| packages | rawilk/filament-password-input |
| dependents | 5 |
| ecosystems | packagist |
| total_downloads | 272,286 |
| monthly_downloads | 12,675 |
Sustainability & Governance
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
65
Maintainer resilience (bus factor)
34At risk
How it's scored
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 2.9/22.5 | Commit distribution — top contributor authored 87% of commits |
| 12.2/13.5 | Contributor breadth — 9 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 4 contributing companies or organizations |
Inputs used
| bus_factor | 1 |
| contributors_sampled | 9 |
| top_contributor_share | 0.872 |
How it's scored
| 46.8/46.8 | Issue resolution — 100% of issues closed |
| 32.2/38.3 | PR acceptance — 32/38 decided PRs merged |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 2/28 approved changesets -- score normalized to 0 |
Inputs used
| merged_prs | 32 |
| open_issues | 0 |
| closed_issues | 2 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 6 |
Ownership & stewardship
60Moderate
How it's scored
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 14.6/25 | Owner reach — 108 followers of rawilk |
| 23.1/25 | Track record — 32 public repos, account ~9 yr old |
Inputs used
| followers | 108 |
| owner_type | User |
| is_verified | — |
| owner_login | rawilk |
| public_repos | 32 |
| account_age_days | 3,568 |
Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.
Package maintenance
100Excellent
How it's scored
| 25/25 | Published & resolvable — 1 package(s) on packagist |
| 35/35 | Publish recency — latest publish 84 days ago |
| 20/20 | Version history — 15 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
Inputs used
| packages | rawilk/filament-password-input |
| ecosystems | packagist |
| any_deprecated | no |
| min_days_since_publish | 84 |
Engineering Quality
Are baseline engineering and documentation practices in place?
62
Engineering practices
54Moderate
How it's scored
| 24/24 | CI workflows — 5 workflow(s) |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
Inputs used
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | yes |
| has_linter_config | no |
| has_precommit_config | no |
Documentation
75Good
How it's scored
| 30/30 | README |
| 25/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 10/10 | Topics — 4 topics |
| 0/10 | Wiki |
Inputs used
| topics | filamentphp, forms, password-input, ui |
| has_wiki | no |
| homepage | — |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Security
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
45
Security posture
45At risk
How it's scored
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 2/28 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 4 contributing companies or organizations |
| 0/10 | Dangerous-Workflow — no data |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 3.8/7.5 | Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — no data |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — no data |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Inputs used
| source | openssf_scorecard |
| checks_evaluated | 13 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 5 |
| scorecard_aggregate | 4.5 |
Excluded from scoring (no data or not applicable): dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Remaining weights renormalized.
AI Readiness
How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.
28
Agent context & guidance
8Critical
How it's scored
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 8.5/40 | Legible commit history — 12 of 75 human commits state their intent (structured subject or explanatory body) |
Inputs used
| has_llms_txt | no |
| legible_history_share | 0.16 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
How it's scored
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 0/11 | Static type checking |
| 0/10 | Reproducible environment |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 8/8 | Automated maintenance — 15 of the last 100 commits are automated dependency updates |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — no data |
Inputs used
| has_nix | no |
| has_tests | yes |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0.15 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.
Code legibility for models
55Moderate
How it's scored
| 0/45 | Type-checkable code — PHP without a type-check config |
| 55/55 | Manageable file sizes — 0/16 source files over 60KB |
Inputs used
| primary_language | PHP |
| largest_source_bytes | 2,468 |
| source_files_sampled | 16 |
| oversized_source_files | 0 |
Key facts
52GitHub stars
9contributors
49commits, last 12 months
30days since last push
15releases
1bus factor
0open issues
Packagistpackage ecosystems
Data collection warnings
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
- No resolved dependencies carried a version and a supported ecosystem
More detail
Star and fork history 0 ★ / 18 ⇿
0Stars
18Forks
12Releases
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Major 2Minor 3Patch 7
Each point covers 3 days.
OpenSSF Scorecard 4.5 / 10
4.5aggregate
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 0 | CI-Tests | 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 2/28 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 4 contributing companies or organizations |
| n/a | Dangerous-Workflow | no workflows found |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 5 | Maintained | 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| n/a | Packaging | packaging workflow not detected |
| n/a | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| n/a | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Direct dependencies 3
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| Packagist | filament/forms | ^4.0|^5.0 | composer.json |
| Packagist | illuminate/contracts | ^11.28|^12.0|^13.0 | composer.json |
| Packagist | spatie/laravel-package-tools | ^1.14 | composer.json |
All dependencies 11
Full resolved dependency set from the GitHub dependency graph: 3 direct and 8 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| Packagist | filament/forms | — | direct |
| Packagist | illuminate/contracts | — | direct |
| Packagist | spatie/laravel-package-tools | — | direct |
| Packagist | laravel/pint | — | indirect |
| Packagist | nunomaduro/collision | — | indirect |
| Packagist | orchestra/testbench | — | indirect |
| Packagist | pestphp/pest | — | indirect |
| Packagist | pestphp/pest-plugin-laravel | — | indirect |
| Packagist | pestphp/pest-plugin-livewire | — | indirect |
| Packagist | php | — | indirect |
| Packagist | spatie/laravel-ray | — | indirect |
Dependency advisories not assessed
Advisory matching could not run for this report: No resolved dependencies carried a version and a supported ecosystem
Raw JSON report machine-readable
{
"data": {
"repo": {
"topics": [
"filamentphp",
"forms",
"password-input",
"ui"
],
"is_fork": false,
"size_kb": 338,
"has_wiki": false,
"homepage": null,
"languages": {
"PHP": 13041,
"Shell": 28
},
"pushed_at": "2026-06-22T21:12:45Z",
"created_at": "2023-10-17T18:32:06Z",
"owner_type": "User",
"updated_at": "2026-04-29T21:29:11Z",
"description": "Enhanced password input component for filament.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "PHP",
"significant_languages": [
"PHP"
]
},
"owner": {
"blog": "https://randallwilk.dev",
"name": "Randall Wilk",
"type": "User",
"login": "rawilk",
"company": "Randall Wilk",
"location": "Wisconsin, United States",
"followers": 108,
"avatar_url": "https://avatars.githubusercontent.com/u/22842525?v=4",
"created_at": "2016-10-14T16:46:24Z",
"is_verified": null,
"public_repos": 32,
"account_age_days": 3568
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v3.2.0",
"kind": "minor",
"published_at": "2026-04-29T21:28:55Z"
},
{
"tag": "v3.1.0",
"kind": "minor",
"published_at": "2026-03-09T20:22:49Z"
},
{
"tag": "v2.1.1",
"kind": "patch",
"published_at": "2026-03-09T19:40:43Z"
},
{
"tag": "v3.0.0",
"kind": "major",
"published_at": "2026-03-09T19:27:58Z"
},
{
"tag": "v2.1.0",
"kind": "minor",
"published_at": "2025-05-18T20:19:35Z"
},
{
"tag": "v2.0.3",
"kind": "patch",
"published_at": "2025-02-25T14:10:46Z"
},
{
"tag": "v2.0.2",
"kind": "patch",
"published_at": "2024-10-01T14:28:57Z"
},
{
"tag": "v2.0.1",
"kind": "patch",
"published_at": "2024-03-05T15:03:16Z"
},
{
"tag": "v2.0.0",
"kind": "major",
"published_at": "2024-01-23T01:01:25Z"
},
{
"tag": "v1.1.3",
"kind": "patch",
"published_at": "2023-12-28T19:10:10Z"
},
{
"tag": "v1.1.2",
"kind": "patch",
"published_at": "2023-12-26T13:31:59Z"
},
{
"tag": "v1.1.1",
"kind": "patch",
"published_at": "2023-12-04T13:51:58Z"
},
{
"tag": "v1.1.0",
"kind": "minor",
"published_at": "2023-10-29T22:23:51Z"
},
{
"tag": "v1.0.1",
"kind": "patch",
"published_at": "2023-10-19T14:32:56Z"
},
{
"tag": "v1.0.0",
"kind": "major",
"published_at": "2023-10-19T00:51:32Z"
}
],
"recent_commits": [
{
"oid": "7e93fb2523bf16b57a4b24fbd401f1e1284b9bae",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:29:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7cd33992591cd09d77c9b25cdf6fcfddea8ad0ea",
"body": null,
"is_bot": false,
"headline": "Clean up commented-out matrix entries in Pest workflow configuration",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:26:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f49172d1afd425573506000f2c4c5d835aa4e887",
"body": null,
"is_bot": false,
"headline": "Update test config",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:24:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "734906d7788acf3e45069dd809d3a47f41fc2ad8",
"body": "* Bump dependabot/fetch-metadata from 2.5.0 to 3.0.0\n\nBumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.5.0 to 3.0.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.5.0.\n[…]\nabot[bot] <support@github.com>\n\n* PHP Linting (Pint)\n\n---------\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.5.0 to 3.0.0 (#43)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-04-29T21:19:42Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "990b8b6fe6b46759633a1c045bdde2f6c8367d76",
"body": null,
"is_bot": false,
"headline": "PHP Linting (Pint)",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:19:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0bfce69b08875933d15b4cf5ff61ea7a8de8f7e9",
"body": "Add support for Laravel 13",
"is_bot": false,
"headline": "Merge pull request #44 from hamrak/main",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:18:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "851c42514fe7e3678602cf638d2f8a0544459087",
"body": null,
"is_bot": false,
"headline": "Add support for Laravel 13",
"author_name": "Ján Hamrák",
"author_login": "hamrak",
"committed_at": "2026-04-06T20:28:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c0e159f3d34d303eb0990092969c8dcabf13333",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:23:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "edd9dd5fca0ee0e5de6c726abc5a9910d14834f1",
"body": null,
"is_bot": false,
"headline": "Rollback Laravel 13.x for n ow",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:18:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0afe48d91e9697142833fefbd6458c5ed1570a06",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:17:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0ca721231ba6dc50d719d949e1ce38a4fbfaf3a2",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:12:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a1b7f3209896a67b265aeeac9770eed7e2b5b1c2",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:11:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "77f4c6e2c3e1cd3bf1aefb78fa8750fdc5d8c4af",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:10:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b08a7d0efe974f3fcbe270f076d1018f6e576ae8",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:04:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "228d4f95343ce845737a43645801fba4fb4697cb",
"body": null,
"is_bot": false,
"headline": "Add PHP 8.5 to Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:00:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a305457947edf1aa058861abe4ec11f47203f4e",
"body": null,
"is_bot": false,
"headline": "Exclude Filament v5 from PHP 8.2 in Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:55:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f7e3f30ffa127a80f05d1c5f4dfb8dce3dc9d9b0",
"body": null,
"is_bot": false,
"headline": "Add Filament v4 and v5 to Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:53:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bada8bc8724119f0b212498612bc1e0def3bfbea",
"body": null,
"is_bot": false,
"headline": "Add Filament v4 and v5 compatibility to workflow matrices",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:48:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7fcf321b74320f0eb0db4850fbba3d0566d752d2",
"body": null,
"is_bot": false,
"headline": "Filament v5 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:45:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "eabd92858cac4b98ffe5f38ebffd4860001a920a",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:41:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "06123ad1d00a2c8ee355561b687f34bca7043271",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:28:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "14b3cab23177f3a658f33ff2df529905f0b71656",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:25:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ee618fdda49753920bea920f7c87d5de9e6f2238",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:24:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "198e0648e3d128dd9dc477582bf8ee18261b3218",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:22:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c62030030f000f11faa65fa8e7b2f4d618148bfd",
"body": null,
"is_bot": false,
"headline": "Exclude php 8.2 from laravel 13.x tests",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:18:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e561bfa57c820125a09554a0407bd12c30f7a23d",
"body": null,
"is_bot": false,
"headline": "Test for laravel 13.x compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:17:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c18f6405766dedff002462b81a49ec4596565328",
"body": null,
"is_bot": false,
"headline": "Test for php 8.5 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:15:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7417448caaeab59df32ec5171bc0979a40ab008a",
"body": null,
"is_bot": false,
"headline": "update yml formatting",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:13:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ea3563e9f964a0ef37f6e24c6badd5121f50fde3",
"body": "spanish translate",
"is_bot": false,
"headline": "Merge pull request #35 from gpibarra/lang_es",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:08:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8e78fa6630b4a6fbad6cf53208cdeae53dec8193",
"body": null,
"is_bot": false,
"headline": "Update UPGRADE.md with Laravel 11 and Filament v4 changes",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:06:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f45b750d44bc3ecc9b971702a29012416dbca50e",
"body": null,
"is_bot": false,
"headline": "Update README for Filament v4 compatibility adjustments",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:02:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e0ac95ad1f3b28aa27151aa362696932c90abde7",
"body": null,
"is_bot": false,
"headline": "Fix broken link to upgrade guide in README",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T18:53:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "de2412213aa9319e40f54410d10812a8b465499b",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:57:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c084f3d283be0530e731d21e34800b06c350223",
"body": null,
"is_bot": false,
"headline": "Filament v4 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:50:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "64d1c8a52ba75d5f5896bf9f34732c45ae694679",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:36:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6e6e0b06a3a093144a367ca4eb977b7d0a2ffa36",
"body": "Filament 4 update",
"is_bot": false,
"headline": "Merge pull request #38 from Jacobtims/filament-4-update",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:35:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5f62382272ad1b7d0882a2a0107a84a69eca996e",
"body": "Bumps [actions/checkout](https://github.com/actions/checkout) from 4 to 6.\n- [Release notes](https://github.com/actions/checkout/releases)\n- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)\n- [Commits](https://github.com/actions/checkout/compare/v4...v6)\n\n---\nupdated-dependenc\n[…]\nirect:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump actions/checkout from 4 to 6 (#40)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-09T14:32:26Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "f647d61382cd2100a54c5ea7057e038776eee88e",
"body": "Bumps [stefanzweifel/git-auto-commit-action](https://github.com/stefanzweifel/git-auto-commit-action) from 5 to 7.\n- [Release notes](https://github.com/stefanzweifel/git-auto-commit-action/releases)\n- [Changelog](https://github.com/stefanzweifel/git-auto-commit-action/blob/master/CHANGELOG.md)\n- [Co\n[…]\nirect:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump stefanzweifel/git-auto-commit-action from 5 to 7 (#39)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-09T14:31:52Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "927966abd81c4b838b233fbd7c1162ad6d1e0942",
"body": "…ot/fetch-metadata-2.5.0\n\nBump dependabot/fetch-metadata from 2.4.0 to 2.5.0",
"is_bot": true,
"headline": "Merge pull request #41 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2026-01-05T21:07:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d8a66343c425fa56badc7637810f58d2cbff3fe5",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.4.0 to 2.5.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.4.0...v2.5.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-version: 2.5.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.4.0 to 2.5.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-01-05T21:07:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "da6782d63dbc2b93cd458df54318e68e109fcd64",
"body": null,
"is_bot": false,
"headline": "Update README.md",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:11:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a3dc804c9d62b986525f9107b3081d4287f98480",
"body": null,
"is_bot": false,
"headline": "Update icons to use Heroicon class",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:08:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "92c7d764e416544995f9d6a8258af31592044493",
"body": null,
"is_bot": false,
"headline": "Fix action visibility",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:06:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "72d0c6971e6197392d1b209d6ee9359ef80ae101",
"body": null,
"is_bot": false,
"headline": "Fix isDisabled())",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:33:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "994c0f36eef62f53448a28eec6b1847c3646d4a0",
"body": null,
"is_bot": false,
"headline": "Align the copyable method with Filament's one",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:18:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c56ebafd9bfb1b97268f7f21c829bf3a9eda2d4a",
"body": null,
"is_bot": false,
"headline": "Update UPGRADE.md",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:05:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "291e4218b69727a435541be7f2fd9e81f208551a",
"body": null,
"is_bot": false,
"headline": "Update to Filament v4",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:03:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "52e7c0c7860b04a51f4a3618d200c464aa1c7ee0",
"body": "…i/laravel-pint-action-2.6\n\nBump aglipanci/laravel-pint-action from 2.5 to 2.6",
"is_bot": true,
"headline": "Merge pull request #36 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-07-28T23:25:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f941997245117d581ea6b6d4d467e5fde1e8e2c3",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.5 to 2.6.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.5...2.6)\n\n---\nupdated-dependencies:\n- dependenc\n[…]\nname: aglipanci/laravel-pint-action\n dependency-version: '2.6'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.5 to 2.6",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-07-28T23:25:20Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "74197afb52d1566a96a75285f8e2207c32cb68b3",
"body": null,
"is_bot": false,
"headline": "spanish translate",
"author_name": "Gerardo Ibarra",
"author_login": "gpibarra",
"committed_at": "2025-07-04T18:51:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "581f5e6c66e1c79e290fe345409af7c58d674308",
"body": "…ettier_action-4.6\n\nBump creyD/prettier_action from 4.5 to 4.6",
"is_bot": true,
"headline": "Merge pull request #33 from rawilk/dependabot/github_actions/creyD/pr…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-06-16T22:07:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1839f50ea8f87aca550f1c2f1dffa4ee27e9d58a",
"body": "Bumps [creyD/prettier_action](https://github.com/creyd/prettier_action) from 4.5 to 4.6.\n- [Release notes](https://github.com/creyd/prettier_action/releases)\n- [Commits](https://github.com/creyd/prettier_action/compare/v4.5...v4.6)\n\n---\nupdated-dependencies:\n- dependency-name: creyD/prettier_action\n dependency-version: '4.6'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump creyD/prettier_action from 4.5 to 4.6",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-06-16T22:06:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "87252824e736342406b53a29c32bce334846d97f",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:19:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "93436e072463838492addcd4f50eaef423a5b144",
"body": null,
"is_bot": false,
"headline": "Cleanup composer file",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:16:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "94064c4914114b7d75ec0e7849701e1d1caf8920",
"body": "added dutch translations",
"is_bot": false,
"headline": "Merge pull request #28 from klaare/lang/dutch",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:13:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d5ca4a628cf66edf4dbab60379a4515b92ce0746",
"body": "…ot/fetch-metadata-2.4.0\n\nBump dependabot/fetch-metadata from 2.3.0 to 2.4.0",
"is_bot": true,
"headline": "Merge pull request #30 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-05-12T22:00:47Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "691d05d11771bed60836e2e16b1f8d04deedfac3",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.3.0 to 2.4.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.3.0...v2.4.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-version: 2.4.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.3.0 to 2.4.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-12T22:00:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c65ba08ab0c0aff957e3442b11b200e712023052",
"body": "…ettier_action-4.5\n\nBump creyD/prettier_action from 4.3 to 4.5",
"is_bot": true,
"headline": "Merge pull request #29 from rawilk/dependabot/github_actions/creyD/pr…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-05-12T21:56:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bff3acde5651211a2800fcb52762f3adf4499dcc",
"body": "Bumps [creyD/prettier_action](https://github.com/creyd/prettier_action) from 4.3 to 4.5.\n- [Release notes](https://github.com/creyd/prettier_action/releases)\n- [Commits](https://github.com/creyd/prettier_action/compare/v4.3...v4.5)\n\n---\nupdated-dependencies:\n- dependency-name: creyD/prettier_action\n dependency-version: '4.5'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump creyD/prettier_action from 4.3 to 4.5",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-12T21:56:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a56fe0587596540622ae131d10370c03eeca26ab",
"body": null,
"is_bot": false,
"headline": "added dutch translations",
"author_name": "klaare",
"author_login": "klaare",
"committed_at": "2025-05-06T21:24:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c59680ef53b8f39e54133e95dad65fcc7f34564",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:11:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "92e7c098f6f7e04e68a88aabc0fcff7afbcc0dbd",
"body": null,
"is_bot": false,
"headline": "Merge pull request #27 from rawilk/php_8.4",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:07:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5c983362318212caa1b9043ca78373c8dc7ed2bf",
"body": null,
"is_bot": false,
"headline": "Test php 8.4 compatability",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:04:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c0c42f4d44ccec5218535ca604dc80e909e94be2",
"body": null,
"is_bot": false,
"headline": "Merge pull request #26 from rawilk/chore/remove-larastan",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:02:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a8e78076851495110b81c6036019979aba98bd5f",
"body": null,
"is_bot": false,
"headline": "Remove larastan workflow",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:58:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "234a80499e2f7f2a9a2b68ac3a8d9ed8471222a0",
"body": null,
"is_bot": false,
"headline": "Remove larastan dev requirement",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:58:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "25f71cf86e522dcc9fd900614dd33722c20c2e0a",
"body": null,
"is_bot": false,
"headline": "[Chore]: Cleanup Workflows (#25)",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:56:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "19d3840b3944482726b261f82f7af1e22b152c52",
"body": "Laravel 12.x Compatibility",
"is_bot": false,
"headline": "Merge pull request #23 from laravel-shift/l12-compatibility",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:40:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3169d7c6e0d7b6f78153be3e371e622b1d37462c",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "laravel-shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ff6243df0403b6c6a572b64e98bab6f4f42e4a47",
"body": null,
"is_bot": false,
"headline": "Update GitHub Actions for Laravel 12",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "392d9d3014e47c6d467f5381015e235d7dddecc8",
"body": null,
"is_bot": false,
"headline": "Bump dependencies for Laravel 12",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "32f7fd55672d1b19989fc6218cb45b27d683b3db",
"body": "…i/laravel-pint-action-2.5\n\nBump aglipanci/laravel-pint-action from 2.4 to 2.5",
"is_bot": true,
"headline": "Merge pull request #22 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-02-03T22:00:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ede867da0e2735fab8900d956186182a0798677a",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.4 to 2.5.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.4...2.5)\n\n---\nupdated-dependencies:\n- dependency-name: aglipanci/laravel-pint-action\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.4 to 2.5",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-02-03T21:59:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4e50eff8ed35a45c821e0d9909e7e12bb992cba2",
"body": "…ot/fetch-metadata-2.3.0\n\nBump dependabot/fetch-metadata from 2.2.0 to 2.3.0",
"is_bot": true,
"headline": "Merge pull request #21 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-01-27T21:07:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "05dffa61e55574a77ce4b853be4b0378094a4a40",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.2.0 to 2.3.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.2.0...v2.3.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.2.0 to 2.3.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-01-27T21:07:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f062541c757068e560bbf5169e766ff730b6854e",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-10-01T14:29:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bd898d5db4d4e66709094f2d1a78732a4ce9bb48",
"body": "Adds Brazilian Portuguese translation",
"is_bot": false,
"headline": "Merge pull request #18 from patriciomartinns/add-pt-br-translation",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-10-01T14:28:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "460a7574ff554fcf0549ea80b1a417d796d8079c",
"body": "…ot/fetch-metadata-2.2.0\n\nBump dependabot/fetch-metadata from 2.1.0 to 2.2.0",
"is_bot": true,
"headline": "Merge pull request #19 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-07-08T22:01:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3dc30656c11addc8e2525c6afb0177101e5da9fd",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.1.0 to 2.2.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.1.0...v2.2.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.1.0 to 2.2.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-07-08T22:01:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fba39344aaf1716b5fc15a7a349d0d30cd7b7e0a",
"body": null,
"is_bot": false,
"headline": "Adds Brazilian Portuguese translation",
"author_name": "Patrício Martins",
"author_login": "patriciomartinns",
"committed_at": "2024-06-07T20:51:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cc1225ce2a0b327721be9abfb76a63e4193ede27",
"body": "…ot/fetch-metadata-2.1.0\n\nBump dependabot/fetch-metadata from 2.0.0 to 2.1.0",
"is_bot": true,
"headline": "Merge pull request #17 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-04-29T21:49:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a04744addc229ccb2af7f8ac91febb1508ac8c8",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.0.0 to 2.1.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.0.0...v2.1.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.0.0 to 2.1.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-29T21:49:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d54e3370e6fa071fc656998f1e65f73b00d6dbad",
"body": "…i/laravel-pint-action-2.4\n\nBump aglipanci/laravel-pint-action from 2.3.1 to 2.4",
"is_bot": true,
"headline": "Merge pull request #16 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-04-15T21:18:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "028bca3d4516343cd485649b40bb61433a63dded",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.3.1 to 2.4.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.3.1...2.4)\n\n---\nupdated-dependencies:\n- dependency-name: aglipanci/laravel-pint-action\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.3.1 to 2.4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-15T21:18:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c1850cd671ece4523a25daff4c5965332e272864",
"body": "…ot/fetch-metadata-2.0.0\n\nBump dependabot/fetch-metadata from 1.6.0 to 2.0.0",
"is_bot": false,
"headline": "Merge pull request #15 from rawilk/dependabot/github_actions/dependab…",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-27T18:34:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a90ad6919e236dc01d0627f551f41a6a3ea1ca12",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 1.6.0 to 2.0.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v1.6.0...v2.0.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 1.6.0 to 2.0.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-25T21:45:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "34dbda594bae372caae695d377436485917f1266",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T15:03:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bda2631925027c4d6c0067fd71d3b3b6ea8ecc30",
"body": null,
"is_bot": false,
"headline": "Remove unused dep",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T15:00:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "970c7f8b86f4add5476cf08c989726425fbfb8af",
"body": null,
"is_bot": false,
"headline": "Remove --ignore-platform-reqs flag",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:57:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e2248f199a601d5bd6121562a71f4d3f81f365f6",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:49:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3be7e35e1284a36b1338c8542c831f101c062998",
"body": null,
"is_bot": false,
"headline": "Add constraints for laravel 11.x",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:39:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2c43128d33bea4832885b90bddd8fafaa850ddf7",
"body": null,
"is_bot": false,
"headline": "Fix pest runner",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:36:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f227e9c98f2d0deabfffeabaefb6d960b0edddb0",
"body": "…omposer-install-3\n\nBump ramsey/composer-install from 2 to 3",
"is_bot": false,
"headline": "Merge pull request #14 from rawilk/dependabot/github_actions/ramsey/c…",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:33:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a70cb4af294b8a42812a8014fcb0b06e07cfa9c0",
"body": "Laravel 11.x Compatibility",
"is_bot": false,
"headline": "Merge pull request #13 from laravel-shift/l11-compatibility",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:32:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "715a7e60146ad4e28e96e4eefd581d1ca52aa5e9",
"body": "Bumps [ramsey/composer-install](https://github.com/ramsey/composer-install) from 2 to 3.\n- [Release notes](https://github.com/ramsey/composer-install/releases)\n- [Commits](https://github.com/ramsey/composer-install/compare/v2...v3)\n\n---\nupdated-dependencies:\n- dependency-name: ramsey/composer-install\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump ramsey/composer-install from 2 to 3",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-04T21:07:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca74671fbb660fbf48cb992f8a4b4a786754dd7c",
"body": null,
"is_bot": false,
"headline": "Update GitHub Actions for Laravel 11",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2024-03-02T11:25:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b863a75b274f0a051aad98d80c9b62962c1f69a7",
"body": null,
"is_bot": false,
"headline": "Bump dependencies for Laravel 11",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2024-03-02T11:25:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "49194f2a64f50db5056e8e2445b6e483431ac018",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:06:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8e0080806fd83516ee2c5bf536099ca612852cf3",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:06:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e397cefb2ccbeea46aebdab057b50a6925d3f0e5",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:01:40Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 15,
"commits_last_year": 49,
"latest_release_at": "2026-04-29T21:28:55Z",
"latest_release_tag": "v3.2.0",
"releases_from_tags": false,
"days_since_last_push": 30,
"active_weeks_last_year": 7,
"days_since_latest_release": 84,
"mean_days_between_releases": 94.8
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 85,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "rawilk/filament-password-input",
"exists": true,
"license": "MIT",
"keywords": [
"ui",
"password",
"Forms",
"laravel",
"filament",
"rawilk",
"filament-password-input"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/rawilk/filament-password-input",
"is_deprecated": false,
"latest_version": "v3.2.0",
"repository_url": "https://github.com/rawilk/filament-password-input",
"versions_count": 15,
"total_downloads": 272286,
"dependents_count": 5,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 12675,
"first_published_at": null,
"latest_published_at": "2026-04-29T21:26:17Z",
"latest_version_yanked": null,
"days_since_latest_publish": 84
}
]
},
"popularity": {
"forks": 18,
"stars": 52,
"watchers": 1,
"fork_history": {
"days": [
{
"date": "2023-10-29",
"count": 1
},
{
"date": "2023-12-07",
"count": 1
},
{
"date": "2023-12-24",
"count": 1
},
{
"date": "2024-03-01",
"count": 1
},
{
"date": "2025-04-07",
"count": 1
},
{
"date": "2025-05-06",
"count": 1
},
{
"date": "2025-07-04",
"count": 1
},
{
"date": "2025-08-12",
"count": 1
},
{
"date": "2025-08-13",
"count": 1
},
{
"date": "2025-08-20",
"count": 1
},
{
"date": "2025-09-11",
"count": 1
},
{
"date": "2025-09-22",
"count": 1
},
{
"date": "2026-04-06",
"count": 1
}
],
"complete": true,
"collected": 13,
"total_forks": 18
},
"star_history": null,
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 2468,
"source_files_sampled": 16,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json"
],
"advisories": {
"error": "No resolved dependencies carried a version and a supported ecosystem",
"scope": "repository_graph",
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 11,
"direct_affected_count": 0
},
"ecosystems": [
"packagist"
],
"dependencies": [
{
"name": "filament/forms",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^4.0|^5.0"
},
{
"name": "illuminate/contracts",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^11.28|^12.0|^13.0"
},
{
"name": "spatie/laravel-package-tools",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^1.14"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "filament/forms",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "illuminate/contracts",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-package-tools",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "laravel/pint",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "nunomaduro/collision",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "orchestra/testbench",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest-plugin-laravel",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest-plugin-livewire",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "php",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-ray",
"direct": false,
"version": null,
"ecosystem": "packagist"
}
],
"collected": true,
"truncated": false,
"total_count": 11,
"direct_count": 3,
"indirect_count": 8
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 32,
"open_issues": 0,
"closed_ratio": 1,
"closed_issues": 2,
"closed_unmerged_prs": 6
},
"bus_factor": 1,
"bot_contributors": 2,
"top_contributors": [
{
"type": "User",
"login": "rawilk",
"commits": 129,
"avatar_url": "https://avatars.githubusercontent.com/u/22842525?v=4"
},
{
"type": "User",
"login": "Jacobtims",
"commits": 7,
"avatar_url": "https://avatars.githubusercontent.com/u/75219092?v=4"
},
{
"type": "User",
"login": "laravel-shift",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/15991828?v=4"
},
{
"type": "User",
"login": "Corvisier",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/202424?v=4"
},
{
"type": "User",
"login": "gpibarra",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/21188012?v=4"
},
{
"type": "User",
"login": "hamrak",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/5807028?v=4"
},
{
"type": "User",
"login": "EG-Mohamed",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/23424932?v=4"
},
{
"type": "User",
"login": "patriciomartinns",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/20000058?v=4"
},
{
"type": "User",
"login": "klaare",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/170330296?v=4"
}
],
"contributors_sampled": 9,
"top_contributor_share": 0.872
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"dependabot-auto-merge.yml",
"markdown-normalize.yml",
"pest.yml",
"pint.yml",
"update-changelog.yml"
],
"has_docs_dir": true,
"linter_configs": [],
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 0,
"reason": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 2/28 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 4 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 5,
"reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "7e93fb2523bf16b57a4b24fbd401f1e1284b9bae",
"ran_at": "2026-07-23T00:03:14Z",
"aggregate_score": 4.5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-20T21:12:53Z",
"oldest_open_prs": [
{
"number": 46,
"created_at": "2026-06-22T21:12:46Z",
"last_comment_at": null,
"last_comment_author": null
}
],
"last_merged_pr_at": "2026-04-29T21:19:42Z",
"ci_last_conclusion": "SUCCESS",
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/rawilk/filament-password-input",
"host": "github.com",
"name": "filament-password-input",
"owner": "rawilk"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"security": 45,
"vitality": 69,
"community": 57,
"governance": 65,
"engineering": 62
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "moderate",
"name": "Vitality",
"value": 69,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"commits_last_year": 49,
"human_commit_share": 0.75,
"days_since_last_push": 30,
"active_weeks_last_year": 7
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 30 days ago",
"points": 28.8,
"status": "partial",
"details": [
{
"code": "push_recency",
"params": {
"days": 30
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "7/52 weeks with commits",
"points": 4.8,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 7
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "49 commits in the last year",
"points": 15.3,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 49
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 5,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"releases_count": 15,
"latest_release_tag": "v3.2.0",
"releases_from_tags": false,
"days_since_latest_release": 84,
"mean_days_between_releases": 94.8
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "15 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 15
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 84 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 84
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~94.8 days",
"points": 19.8,
"status": "partial",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 94.8
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 84,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 84 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 84
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 38,
"inputs": {
"forks": 18,
"stars": 52,
"watchers": 1,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "52 stars",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 52
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "18 forks",
"points": 10.3,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 18
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "1 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 1
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 60,
"inputs": {
"packages": [
"rawilk/filament-password-input"
],
"dependents": 5,
"ecosystems": "packagist",
"total_downloads": 272286,
"monthly_downloads": 12675
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "12,675 downloads/month across packagist",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 12675,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "5 packages depend on it",
"points": 5.2,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 5
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 65,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 9,
"top_contributor_share": 0.872
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 87% of commits",
"points": 2.9,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 87
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "9 contributors",
"points": 12.2,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 9
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "good",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 79,
"inputs": {
"merged_prs": 32,
"open_issues": 0,
"closed_issues": 2,
"issue_closed_ratio": 1,
"closed_unmerged_prs": 6
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "100% of issues closed",
"points": 46.8,
"status": "met",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 100
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "32/38 decided PRs merged",
"points": 32.2,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 32,
"decided": 38
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 2/28 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"followers": 108,
"owner_type": "User",
"is_verified": null,
"owner_login": "rawilk",
"public_repos": 32,
"account_age_days": 3568
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "108 followers of rawilk",
"points": 14.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 108,
"login": "rawilk"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "32 public repos, account ~9 yr old",
"points": 23.1,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 32
}
},
{
"code": "account_age_years",
"params": {
"years": 9
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"rawilk/filament-password-input"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 84
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 84 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 84
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "15 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 15
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "moderate",
"name": "Engineering Quality",
"value": 62,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "5 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 5
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 6.4,
"status": "met",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [
"filamentphp",
"forms",
"password-input",
"ui"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "4 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 4
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 45,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 13,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 5,
"scorecard_aggregate": 4.5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 2/28 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 15
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 28,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 8,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.16,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "12 of 75 human commits state their intent (structured subject or explanatory body)",
"points": 8.5,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 12,
"sampled": 75
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "at_risk",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 33,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0.15
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no agent-authored commits among the last 100",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_authored_commits",
"params": {
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "15 of the last 100 commits are automated dependency updates",
"points": 8,
"status": "met",
"details": [
{
"code": "dependency_bot_commits",
"params": {
"count": 15,
"sampled": 100
}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "PHP",
"largest_source_bytes": 2468,
"source_files_sampled": 16,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "PHP without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "PHP"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/16 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 16,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token",
"No resolved dependencies carried a version and a supported ecosystem"
],
"report_type": "repository",
"generated_at": "2026-07-23T00:03:24.696646Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/rawilk/filament-password-input.svg",
"full_name": "rawilk/filament-password-input",
"license_state": "standard",
"license_spdx": "MIT"
}Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.27.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — Packagist.