Registro públicoModerado
Informe de salud del softwareesquema 0.27.0 · métricas 1.13.0 · 2026-07-23 00:03 UTC
rawilk / filament-password-input
Enhanced password input component for filament.
rawilk/filament-password-input tiene un índice de salud de 61 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (69/100) y la más baja, AI Readiness (28/100). Se actualizó por última vez hace 30 días. Una sola persona concentra la mayor parte del trabajo reciente.
61
global / 100Índice de salud del software
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
61
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
Perfil de puntuación
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Titularidad
Randall WilkCuenta personal
108 seguidores32 repositorios públicosdesde oct 2016Randall Wilk
Este repositorio pertenece a una cuenta personal. Un proyecto con un único propietario conlleva más riesgo de continuidad que uno respaldado por una organización.
Ecosistemas de paquetes
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| Packagist | rawilk/filament-password-input | v3.2.0 | 12.675 | 15 | hace 84 días | uipasswordformslaravelfilamentrawilkfilament-password-input |
Métricas por categoría
Vitalidad
¿Está vivo el proyecto: se escribe código y se publican versiones?
69
Actividad de desarrollo
54Moderado
Cómo se puntúa
| 28.8/36 | Recencia de push — último push hace 30 días |
| 4.8/36 | Cadencia de commits — 7/52 semanas con commits |
| 15.3/18 | Volumen de commits — 49 commits en el último año |
| 5/10 | OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
Datos de entrada utilizados
| commits_last_year | 49 |
| human_commit_share | 0,75 |
| days_since_last_push | 30 |
| active_weeks_last_year | 7 |
Disciplina de publicación
92Excelente
Cómo se puntúa
| 27/27 | Publica versiones — 15 versiones publicadas |
| 36/36 | Recencia de las versiones — última versión hace 84 días |
| 19.8/27 | Cadencia de publicación — una versión cada ~94,8 días |
| 0/10 | OpenSSF Scorecard: Signed-Releases — sin datos |
Datos de entrada utilizados
| releases_count | 15 |
| latest_release_tag | v3.2.0 |
| releases_from_tags | no |
| days_since_latest_release | 84 |
| mean_days_between_releases | 94,8 |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.
Comunidad y Adopción
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
57
Popularidad y adopción
38En riesgo
Cómo se puntúa
| 27.7/60 | Estrellas — 52 estrellas |
| 10.3/25 | Forks — 18 forks |
| 0/15 | Observadores — 1 observadores |
Datos de entrada utilizados
| forks | 18 |
| stars | 52 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Salud de la comunidad
77Bueno
Cómo se puntúa
| 22.5/22.5 | README |
| 22.5/22.5 | Licencia — licencia reconocida (MIT) |
| 18/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 6.3/6.3 | Plantilla de PR |
Datos de entrada utilizados
| has_readme | sí |
| has_license | sí |
| has_contributing | sí |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | sí |
Adopción en el ecosistema (descargas)
60Moderado
Cómo se puntúa
| 54.7/80 | Descargas mensuales — 12.675 descargas/mes en packagist |
| 5.2/20 | Dependientes en el registro — 5 paquetes dependen de él |
Datos de entrada utilizados
| packages | rawilk/filament-password-input |
| dependents | 5 |
| ecosystems | packagist |
| total_downloads | 272.286 |
| monthly_downloads | 12.675 |
Sostenibilidad y Gobernanza
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
65
Resiliencia de mantenedores (factor bus)
34En riesgo
Cómo se puntúa
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 2.9/22.5 | Distribución de commits — el principal contribuyente firma el 87% de los commits |
| 12.2/13.5 | Amplitud de contribuyentes — 9 contribuyentes |
| 10/10 | OpenSSF Scorecard: Contributors — project has 4 contributing companies or organizations |
Datos de entrada utilizados
| bus_factor | 1 |
| contributors_sampled | 9 |
| top_contributor_share | 0,872 |
Cómo se puntúa
| 46.8/46.8 | Resolución de issues — 100% de issues cerradas |
| 32.2/38.3 | Aceptación de PR — 32/38 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 2/28 approved changesets -- score normalized to 0 |
Datos de entrada utilizados
| merged_prs | 32 |
| open_issues | 0 |
| closed_issues | 2 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 6 |
Propiedad y custodia
60Moderado
Cómo se puntúa
| 10/30 | Respaldo de la propiedad — cuenta personal (usuario) |
| 0/20 | Dominio verificado — no aplicable a cuentas de usuario |
| 14.6/25 | Alcance del propietario — 108 seguidores de rawilk |
| 23.1/25 | Trayectoria — 32 repos públicos, cuenta de ~9 años |
Datos de entrada utilizados
| followers | 108 |
| owner_type | User |
| is_verified | — |
| owner_login | rawilk |
| public_repos | 32 |
| account_age_days | 3568 |
Excluidos de la puntuación (sin datos o no aplicable): Dominio verificado. Los pesos restantes se han renormalizado.
Mantenimiento de paquetes
100Excelente
Cómo se puntúa
| 25/25 | Publicado y resoluble — 1 paquete(s) en packagist |
| 35/35 | Recencia de publicación — última publicación hace 84 días |
| 20/20 | Historial de versiones — 15 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
Datos de entrada utilizados
| packages | rawilk/filament-password-input |
| ecosystems | packagist |
| any_deprecated | no |
| min_days_since_publish | 84 |
Calidad de Ingeniería
¿Existen unas prácticas mínimas de ingeniería y documentación?
62
Prácticas de ingeniería
54Moderado
Cómo se puntúa
| 24/24 | Flujos de trabajo de CI — 5 flujo(s) de trabajo |
| 24/24 | Pruebas presentes |
| 0/16 | Configuración de linter |
| 0/9.6 | Hooks de pre-commit |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
Datos de entrada utilizados
| has_ci | sí |
| has_tests | sí |
| has_editorconfig | sí |
| has_linter_config | no |
| has_precommit_config | no |
Documentación
75Bueno
Cómo se puntúa
| 30/30 | README |
| 25/25 | Directorio de documentación |
| 0/15 | Sitio de documentación / página del proyecto |
| 10/10 | Descripción del repositorio |
| 10/10 | Topics — 4 topics |
| 0/10 | Wiki |
Datos de entrada utilizados
| topics | filamentphp, forms, password-input, ui |
| has_wiki | no |
| homepage | — |
| has_readme | sí |
| has_docs_dir | sí |
| has_description | sí |
Seguridad
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
45
Postura de seguridad
45En riesgo
Cómo se puntúa
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 2/28 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 4 contributing companies or organizations |
| 0/10 | Dangerous-Workflow — sin datos |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Licencia — license file detected |
| 3.8/7.5 | Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| 0/5 | Packaging — sin datos |
| 0/5 | Pinned-Dependencies — sin datos |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — sin datos |
| 0/7.5 | Token-Permissions — sin datos |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Datos de entrada utilizados
| source | openssf_scorecard |
| checks_evaluated | 13 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 5 |
| scorecard_aggregate | 4,5 |
Excluidos de la puntuación (sin datos o no aplicable): dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Los pesos restantes se han renormalizado.
Preparación para IA
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
28
Contexto y guía para agentes
8Crítico
Cómo se puntúa
| 0/45 | Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 8.5/40 | Historial de commits legible — 12 de 75 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo) |
Datos de entrada utilizados
| has_llms_txt | no |
| legible_history_share | 0,16 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Cómo se puntúa
| 0/18 | Arranque con un solo comando |
| 22/22 | Pruebas automatizadas |
| 0/11 | Configuración de lint / formato |
| 0/11 | Verificación estática de tipos |
| 0/10 | Entorno reproducible |
| 0/10 | Práctica demostrada con agentes — ningún commit con autoría de agente entre los últimos 100 |
| 8/8 | Mantenimiento automatizado — 15 de los últimos 100 commits son actualizaciones automáticas de dependencias |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — sin datos |
Datos de entrada utilizados
| has_nix | no |
| has_tests | sí |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0,15 |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Pinned-Dependencies. Los pesos restantes se han renormalizado.
Legibilidad del código para modelos
55Moderado
Cómo se puntúa
| 0/45 | Código verificable por tipos — PHP sin configuración de verificación de tipos |
| 55/55 | Tamaños de archivo manejables — 0/16 archivos fuente de más de 60 KB |
Datos de entrada utilizados
| primary_language | PHP |
| largest_source_bytes | 2468 |
| source_files_sampled | 16 |
| oversized_source_files | 0 |
Datos clave
52estrellas de GitHub
9contribuidores
49commits en los últimos 12 meses
30días desde el último push
15versiones publicadas
1factor bus
0issues abiertas
Packagistecosistemas de paquetes
Advertencias de recopilación de datos
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
- No resolved dependencies carried a version and a supported ecosystem
Más detalle
Historial de estrellas y forks 0 ★ / 18 ⇿
0Estrellas
18Forks
12Versiones
Cuándo se añadió cada estrella y fork, recopilado de GitHub y agrupado por día. El crecimiento acumulado se sitúa justo encima de las adiciones diarias que lo componen, de modo que ambos se leen en conjunto: la acumulación orgánica sostenida no se parece en nada a un pico abrupto y efímero. Cuando esa diferencia es medible, se informa como autenticidad del crecimiento.
Mayor 2Menor 3Parche 7
Cada punto abarca 3 días.
OpenSSF Scorecard 4.5 / 10
4.5agregado
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 0 | CI-Tests | 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 2/28 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 4 contributing companies or organizations |
| n/d | Dangerous-Workflow | no workflows found |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 5 | Maintained | 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| n/d | Packaging | packaging workflow not detected |
| n/d | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/d | Signed-Releases | no releases found |
| n/d | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Dependencias directas 3
| Registro | Paquete | Restricción de versión | Manifiesto |
|---|---|---|---|
| Packagist | filament/forms | ^4.0|^5.0 | composer.json |
| Packagist | illuminate/contracts | ^11.28|^12.0|^13.0 | composer.json |
| Packagist | spatie/laravel-package-tools | ^1.14 | composer.json |
Todas las dependencias 11
Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 3 paquetes directos y 8 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.
| Registro | Paquete | Versión | Relación |
|---|---|---|---|
| Packagist | filament/forms | — | directa |
| Packagist | illuminate/contracts | — | directa |
| Packagist | spatie/laravel-package-tools | — | directa |
| Packagist | laravel/pint | — | indirecta |
| Packagist | nunomaduro/collision | — | indirecta |
| Packagist | orchestra/testbench | — | indirecta |
| Packagist | pestphp/pest | — | indirecta |
| Packagist | pestphp/pest-plugin-laravel | — | indirecta |
| Packagist | pestphp/pest-plugin-livewire | — | indirecta |
| Packagist | php | — | indirecta |
| Packagist | spatie/laravel-ray | — | indirecta |
Avisos de dependencias sin evaluar
El cotejo de avisos no pudo ejecutarse para este informe: No resolved dependencies carried a version and a supported ecosystem
Informe JSON sin procesar legible por máquina
{
"data": {
"repo": {
"topics": [
"filamentphp",
"forms",
"password-input",
"ui"
],
"is_fork": false,
"size_kb": 338,
"has_wiki": false,
"homepage": null,
"languages": {
"PHP": 13041,
"Shell": 28
},
"pushed_at": "2026-06-22T21:12:45Z",
"created_at": "2023-10-17T18:32:06Z",
"owner_type": "User",
"updated_at": "2026-04-29T21:29:11Z",
"description": "Enhanced password input component for filament.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "PHP",
"significant_languages": [
"PHP"
]
},
"owner": {
"blog": "https://randallwilk.dev",
"name": "Randall Wilk",
"type": "User",
"login": "rawilk",
"company": "Randall Wilk",
"location": "Wisconsin, United States",
"followers": 108,
"avatar_url": "https://avatars.githubusercontent.com/u/22842525?v=4",
"created_at": "2016-10-14T16:46:24Z",
"is_verified": null,
"public_repos": 32,
"account_age_days": 3568
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v3.2.0",
"kind": "minor",
"published_at": "2026-04-29T21:28:55Z"
},
{
"tag": "v3.1.0",
"kind": "minor",
"published_at": "2026-03-09T20:22:49Z"
},
{
"tag": "v2.1.1",
"kind": "patch",
"published_at": "2026-03-09T19:40:43Z"
},
{
"tag": "v3.0.0",
"kind": "major",
"published_at": "2026-03-09T19:27:58Z"
},
{
"tag": "v2.1.0",
"kind": "minor",
"published_at": "2025-05-18T20:19:35Z"
},
{
"tag": "v2.0.3",
"kind": "patch",
"published_at": "2025-02-25T14:10:46Z"
},
{
"tag": "v2.0.2",
"kind": "patch",
"published_at": "2024-10-01T14:28:57Z"
},
{
"tag": "v2.0.1",
"kind": "patch",
"published_at": "2024-03-05T15:03:16Z"
},
{
"tag": "v2.0.0",
"kind": "major",
"published_at": "2024-01-23T01:01:25Z"
},
{
"tag": "v1.1.3",
"kind": "patch",
"published_at": "2023-12-28T19:10:10Z"
},
{
"tag": "v1.1.2",
"kind": "patch",
"published_at": "2023-12-26T13:31:59Z"
},
{
"tag": "v1.1.1",
"kind": "patch",
"published_at": "2023-12-04T13:51:58Z"
},
{
"tag": "v1.1.0",
"kind": "minor",
"published_at": "2023-10-29T22:23:51Z"
},
{
"tag": "v1.0.1",
"kind": "patch",
"published_at": "2023-10-19T14:32:56Z"
},
{
"tag": "v1.0.0",
"kind": "major",
"published_at": "2023-10-19T00:51:32Z"
}
],
"recent_commits": [
{
"oid": "7e93fb2523bf16b57a4b24fbd401f1e1284b9bae",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:29:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7cd33992591cd09d77c9b25cdf6fcfddea8ad0ea",
"body": null,
"is_bot": false,
"headline": "Clean up commented-out matrix entries in Pest workflow configuration",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:26:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f49172d1afd425573506000f2c4c5d835aa4e887",
"body": null,
"is_bot": false,
"headline": "Update test config",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:24:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "734906d7788acf3e45069dd809d3a47f41fc2ad8",
"body": "* Bump dependabot/fetch-metadata from 2.5.0 to 3.0.0\n\nBumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.5.0 to 3.0.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.5.0.\n[…]\nabot[bot] <support@github.com>\n\n* PHP Linting (Pint)\n\n---------\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.5.0 to 3.0.0 (#43)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-04-29T21:19:42Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "990b8b6fe6b46759633a1c045bdde2f6c8367d76",
"body": null,
"is_bot": false,
"headline": "PHP Linting (Pint)",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:19:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0bfce69b08875933d15b4cf5ff61ea7a8de8f7e9",
"body": "Add support for Laravel 13",
"is_bot": false,
"headline": "Merge pull request #44 from hamrak/main",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:18:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "851c42514fe7e3678602cf638d2f8a0544459087",
"body": null,
"is_bot": false,
"headline": "Add support for Laravel 13",
"author_name": "Ján Hamrák",
"author_login": "hamrak",
"committed_at": "2026-04-06T20:28:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c0e159f3d34d303eb0990092969c8dcabf13333",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:23:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "edd9dd5fca0ee0e5de6c726abc5a9910d14834f1",
"body": null,
"is_bot": false,
"headline": "Rollback Laravel 13.x for n ow",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:18:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0afe48d91e9697142833fefbd6458c5ed1570a06",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:17:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0ca721231ba6dc50d719d949e1ce38a4fbfaf3a2",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:12:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a1b7f3209896a67b265aeeac9770eed7e2b5b1c2",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:11:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "77f4c6e2c3e1cd3bf1aefb78fa8750fdc5d8c4af",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:10:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b08a7d0efe974f3fcbe270f076d1018f6e576ae8",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:04:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "228d4f95343ce845737a43645801fba4fb4697cb",
"body": null,
"is_bot": false,
"headline": "Add PHP 8.5 to Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:00:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a305457947edf1aa058861abe4ec11f47203f4e",
"body": null,
"is_bot": false,
"headline": "Exclude Filament v5 from PHP 8.2 in Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:55:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f7e3f30ffa127a80f05d1c5f4dfb8dce3dc9d9b0",
"body": null,
"is_bot": false,
"headline": "Add Filament v4 and v5 to Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:53:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bada8bc8724119f0b212498612bc1e0def3bfbea",
"body": null,
"is_bot": false,
"headline": "Add Filament v4 and v5 compatibility to workflow matrices",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:48:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7fcf321b74320f0eb0db4850fbba3d0566d752d2",
"body": null,
"is_bot": false,
"headline": "Filament v5 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:45:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "eabd92858cac4b98ffe5f38ebffd4860001a920a",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:41:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "06123ad1d00a2c8ee355561b687f34bca7043271",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:28:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "14b3cab23177f3a658f33ff2df529905f0b71656",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:25:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ee618fdda49753920bea920f7c87d5de9e6f2238",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:24:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "198e0648e3d128dd9dc477582bf8ee18261b3218",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:22:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c62030030f000f11faa65fa8e7b2f4d618148bfd",
"body": null,
"is_bot": false,
"headline": "Exclude php 8.2 from laravel 13.x tests",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:18:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e561bfa57c820125a09554a0407bd12c30f7a23d",
"body": null,
"is_bot": false,
"headline": "Test for laravel 13.x compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:17:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c18f6405766dedff002462b81a49ec4596565328",
"body": null,
"is_bot": false,
"headline": "Test for php 8.5 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:15:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7417448caaeab59df32ec5171bc0979a40ab008a",
"body": null,
"is_bot": false,
"headline": "update yml formatting",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:13:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ea3563e9f964a0ef37f6e24c6badd5121f50fde3",
"body": "spanish translate",
"is_bot": false,
"headline": "Merge pull request #35 from gpibarra/lang_es",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:08:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8e78fa6630b4a6fbad6cf53208cdeae53dec8193",
"body": null,
"is_bot": false,
"headline": "Update UPGRADE.md with Laravel 11 and Filament v4 changes",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:06:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f45b750d44bc3ecc9b971702a29012416dbca50e",
"body": null,
"is_bot": false,
"headline": "Update README for Filament v4 compatibility adjustments",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:02:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e0ac95ad1f3b28aa27151aa362696932c90abde7",
"body": null,
"is_bot": false,
"headline": "Fix broken link to upgrade guide in README",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T18:53:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "de2412213aa9319e40f54410d10812a8b465499b",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:57:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c084f3d283be0530e731d21e34800b06c350223",
"body": null,
"is_bot": false,
"headline": "Filament v4 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:50:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "64d1c8a52ba75d5f5896bf9f34732c45ae694679",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:36:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6e6e0b06a3a093144a367ca4eb977b7d0a2ffa36",
"body": "Filament 4 update",
"is_bot": false,
"headline": "Merge pull request #38 from Jacobtims/filament-4-update",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:35:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5f62382272ad1b7d0882a2a0107a84a69eca996e",
"body": "Bumps [actions/checkout](https://github.com/actions/checkout) from 4 to 6.\n- [Release notes](https://github.com/actions/checkout/releases)\n- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)\n- [Commits](https://github.com/actions/checkout/compare/v4...v6)\n\n---\nupdated-dependenc\n[…]\nirect:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump actions/checkout from 4 to 6 (#40)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-09T14:32:26Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "f647d61382cd2100a54c5ea7057e038776eee88e",
"body": "Bumps [stefanzweifel/git-auto-commit-action](https://github.com/stefanzweifel/git-auto-commit-action) from 5 to 7.\n- [Release notes](https://github.com/stefanzweifel/git-auto-commit-action/releases)\n- [Changelog](https://github.com/stefanzweifel/git-auto-commit-action/blob/master/CHANGELOG.md)\n- [Co\n[…]\nirect:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump stefanzweifel/git-auto-commit-action from 5 to 7 (#39)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-09T14:31:52Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "927966abd81c4b838b233fbd7c1162ad6d1e0942",
"body": "…ot/fetch-metadata-2.5.0\n\nBump dependabot/fetch-metadata from 2.4.0 to 2.5.0",
"is_bot": true,
"headline": "Merge pull request #41 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2026-01-05T21:07:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d8a66343c425fa56badc7637810f58d2cbff3fe5",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.4.0 to 2.5.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.4.0...v2.5.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-version: 2.5.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.4.0 to 2.5.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-01-05T21:07:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "da6782d63dbc2b93cd458df54318e68e109fcd64",
"body": null,
"is_bot": false,
"headline": "Update README.md",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:11:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a3dc804c9d62b986525f9107b3081d4287f98480",
"body": null,
"is_bot": false,
"headline": "Update icons to use Heroicon class",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:08:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "92c7d764e416544995f9d6a8258af31592044493",
"body": null,
"is_bot": false,
"headline": "Fix action visibility",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:06:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "72d0c6971e6197392d1b209d6ee9359ef80ae101",
"body": null,
"is_bot": false,
"headline": "Fix isDisabled())",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:33:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "994c0f36eef62f53448a28eec6b1847c3646d4a0",
"body": null,
"is_bot": false,
"headline": "Align the copyable method with Filament's one",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:18:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c56ebafd9bfb1b97268f7f21c829bf3a9eda2d4a",
"body": null,
"is_bot": false,
"headline": "Update UPGRADE.md",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:05:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "291e4218b69727a435541be7f2fd9e81f208551a",
"body": null,
"is_bot": false,
"headline": "Update to Filament v4",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:03:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "52e7c0c7860b04a51f4a3618d200c464aa1c7ee0",
"body": "…i/laravel-pint-action-2.6\n\nBump aglipanci/laravel-pint-action from 2.5 to 2.6",
"is_bot": true,
"headline": "Merge pull request #36 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-07-28T23:25:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f941997245117d581ea6b6d4d467e5fde1e8e2c3",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.5 to 2.6.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.5...2.6)\n\n---\nupdated-dependencies:\n- dependenc\n[…]\nname: aglipanci/laravel-pint-action\n dependency-version: '2.6'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.5 to 2.6",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-07-28T23:25:20Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "74197afb52d1566a96a75285f8e2207c32cb68b3",
"body": null,
"is_bot": false,
"headline": "spanish translate",
"author_name": "Gerardo Ibarra",
"author_login": "gpibarra",
"committed_at": "2025-07-04T18:51:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "581f5e6c66e1c79e290fe345409af7c58d674308",
"body": "…ettier_action-4.6\n\nBump creyD/prettier_action from 4.5 to 4.6",
"is_bot": true,
"headline": "Merge pull request #33 from rawilk/dependabot/github_actions/creyD/pr…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-06-16T22:07:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1839f50ea8f87aca550f1c2f1dffa4ee27e9d58a",
"body": "Bumps [creyD/prettier_action](https://github.com/creyd/prettier_action) from 4.5 to 4.6.\n- [Release notes](https://github.com/creyd/prettier_action/releases)\n- [Commits](https://github.com/creyd/prettier_action/compare/v4.5...v4.6)\n\n---\nupdated-dependencies:\n- dependency-name: creyD/prettier_action\n dependency-version: '4.6'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump creyD/prettier_action from 4.5 to 4.6",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-06-16T22:06:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "87252824e736342406b53a29c32bce334846d97f",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:19:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "93436e072463838492addcd4f50eaef423a5b144",
"body": null,
"is_bot": false,
"headline": "Cleanup composer file",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:16:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "94064c4914114b7d75ec0e7849701e1d1caf8920",
"body": "added dutch translations",
"is_bot": false,
"headline": "Merge pull request #28 from klaare/lang/dutch",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:13:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d5ca4a628cf66edf4dbab60379a4515b92ce0746",
"body": "…ot/fetch-metadata-2.4.0\n\nBump dependabot/fetch-metadata from 2.3.0 to 2.4.0",
"is_bot": true,
"headline": "Merge pull request #30 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-05-12T22:00:47Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "691d05d11771bed60836e2e16b1f8d04deedfac3",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.3.0 to 2.4.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.3.0...v2.4.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-version: 2.4.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.3.0 to 2.4.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-12T22:00:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c65ba08ab0c0aff957e3442b11b200e712023052",
"body": "…ettier_action-4.5\n\nBump creyD/prettier_action from 4.3 to 4.5",
"is_bot": true,
"headline": "Merge pull request #29 from rawilk/dependabot/github_actions/creyD/pr…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-05-12T21:56:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bff3acde5651211a2800fcb52762f3adf4499dcc",
"body": "Bumps [creyD/prettier_action](https://github.com/creyd/prettier_action) from 4.3 to 4.5.\n- [Release notes](https://github.com/creyd/prettier_action/releases)\n- [Commits](https://github.com/creyd/prettier_action/compare/v4.3...v4.5)\n\n---\nupdated-dependencies:\n- dependency-name: creyD/prettier_action\n dependency-version: '4.5'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump creyD/prettier_action from 4.3 to 4.5",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-12T21:56:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a56fe0587596540622ae131d10370c03eeca26ab",
"body": null,
"is_bot": false,
"headline": "added dutch translations",
"author_name": "klaare",
"author_login": "klaare",
"committed_at": "2025-05-06T21:24:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c59680ef53b8f39e54133e95dad65fcc7f34564",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:11:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "92e7c098f6f7e04e68a88aabc0fcff7afbcc0dbd",
"body": null,
"is_bot": false,
"headline": "Merge pull request #27 from rawilk/php_8.4",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:07:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5c983362318212caa1b9043ca78373c8dc7ed2bf",
"body": null,
"is_bot": false,
"headline": "Test php 8.4 compatability",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:04:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c0c42f4d44ccec5218535ca604dc80e909e94be2",
"body": null,
"is_bot": false,
"headline": "Merge pull request #26 from rawilk/chore/remove-larastan",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:02:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a8e78076851495110b81c6036019979aba98bd5f",
"body": null,
"is_bot": false,
"headline": "Remove larastan workflow",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:58:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "234a80499e2f7f2a9a2b68ac3a8d9ed8471222a0",
"body": null,
"is_bot": false,
"headline": "Remove larastan dev requirement",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:58:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "25f71cf86e522dcc9fd900614dd33722c20c2e0a",
"body": null,
"is_bot": false,
"headline": "[Chore]: Cleanup Workflows (#25)",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:56:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "19d3840b3944482726b261f82f7af1e22b152c52",
"body": "Laravel 12.x Compatibility",
"is_bot": false,
"headline": "Merge pull request #23 from laravel-shift/l12-compatibility",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:40:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3169d7c6e0d7b6f78153be3e371e622b1d37462c",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "laravel-shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ff6243df0403b6c6a572b64e98bab6f4f42e4a47",
"body": null,
"is_bot": false,
"headline": "Update GitHub Actions for Laravel 12",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "392d9d3014e47c6d467f5381015e235d7dddecc8",
"body": null,
"is_bot": false,
"headline": "Bump dependencies for Laravel 12",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "32f7fd55672d1b19989fc6218cb45b27d683b3db",
"body": "…i/laravel-pint-action-2.5\n\nBump aglipanci/laravel-pint-action from 2.4 to 2.5",
"is_bot": true,
"headline": "Merge pull request #22 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-02-03T22:00:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ede867da0e2735fab8900d956186182a0798677a",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.4 to 2.5.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.4...2.5)\n\n---\nupdated-dependencies:\n- dependency-name: aglipanci/laravel-pint-action\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.4 to 2.5",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-02-03T21:59:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4e50eff8ed35a45c821e0d9909e7e12bb992cba2",
"body": "…ot/fetch-metadata-2.3.0\n\nBump dependabot/fetch-metadata from 2.2.0 to 2.3.0",
"is_bot": true,
"headline": "Merge pull request #21 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-01-27T21:07:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "05dffa61e55574a77ce4b853be4b0378094a4a40",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.2.0 to 2.3.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.2.0...v2.3.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.2.0 to 2.3.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-01-27T21:07:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f062541c757068e560bbf5169e766ff730b6854e",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-10-01T14:29:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bd898d5db4d4e66709094f2d1a78732a4ce9bb48",
"body": "Adds Brazilian Portuguese translation",
"is_bot": false,
"headline": "Merge pull request #18 from patriciomartinns/add-pt-br-translation",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-10-01T14:28:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "460a7574ff554fcf0549ea80b1a417d796d8079c",
"body": "…ot/fetch-metadata-2.2.0\n\nBump dependabot/fetch-metadata from 2.1.0 to 2.2.0",
"is_bot": true,
"headline": "Merge pull request #19 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-07-08T22:01:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3dc30656c11addc8e2525c6afb0177101e5da9fd",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.1.0 to 2.2.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.1.0...v2.2.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.1.0 to 2.2.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-07-08T22:01:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fba39344aaf1716b5fc15a7a349d0d30cd7b7e0a",
"body": null,
"is_bot": false,
"headline": "Adds Brazilian Portuguese translation",
"author_name": "Patrício Martins",
"author_login": "patriciomartinns",
"committed_at": "2024-06-07T20:51:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cc1225ce2a0b327721be9abfb76a63e4193ede27",
"body": "…ot/fetch-metadata-2.1.0\n\nBump dependabot/fetch-metadata from 2.0.0 to 2.1.0",
"is_bot": true,
"headline": "Merge pull request #17 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-04-29T21:49:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a04744addc229ccb2af7f8ac91febb1508ac8c8",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.0.0 to 2.1.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.0.0...v2.1.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.0.0 to 2.1.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-29T21:49:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d54e3370e6fa071fc656998f1e65f73b00d6dbad",
"body": "…i/laravel-pint-action-2.4\n\nBump aglipanci/laravel-pint-action from 2.3.1 to 2.4",
"is_bot": true,
"headline": "Merge pull request #16 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-04-15T21:18:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "028bca3d4516343cd485649b40bb61433a63dded",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.3.1 to 2.4.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.3.1...2.4)\n\n---\nupdated-dependencies:\n- dependency-name: aglipanci/laravel-pint-action\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.3.1 to 2.4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-15T21:18:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c1850cd671ece4523a25daff4c5965332e272864",
"body": "…ot/fetch-metadata-2.0.0\n\nBump dependabot/fetch-metadata from 1.6.0 to 2.0.0",
"is_bot": false,
"headline": "Merge pull request #15 from rawilk/dependabot/github_actions/dependab…",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-27T18:34:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a90ad6919e236dc01d0627f551f41a6a3ea1ca12",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 1.6.0 to 2.0.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v1.6.0...v2.0.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 1.6.0 to 2.0.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-25T21:45:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "34dbda594bae372caae695d377436485917f1266",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T15:03:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bda2631925027c4d6c0067fd71d3b3b6ea8ecc30",
"body": null,
"is_bot": false,
"headline": "Remove unused dep",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T15:00:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "970c7f8b86f4add5476cf08c989726425fbfb8af",
"body": null,
"is_bot": false,
"headline": "Remove --ignore-platform-reqs flag",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:57:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e2248f199a601d5bd6121562a71f4d3f81f365f6",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:49:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3be7e35e1284a36b1338c8542c831f101c062998",
"body": null,
"is_bot": false,
"headline": "Add constraints for laravel 11.x",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:39:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2c43128d33bea4832885b90bddd8fafaa850ddf7",
"body": null,
"is_bot": false,
"headline": "Fix pest runner",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:36:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f227e9c98f2d0deabfffeabaefb6d960b0edddb0",
"body": "…omposer-install-3\n\nBump ramsey/composer-install from 2 to 3",
"is_bot": false,
"headline": "Merge pull request #14 from rawilk/dependabot/github_actions/ramsey/c…",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:33:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a70cb4af294b8a42812a8014fcb0b06e07cfa9c0",
"body": "Laravel 11.x Compatibility",
"is_bot": false,
"headline": "Merge pull request #13 from laravel-shift/l11-compatibility",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:32:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "715a7e60146ad4e28e96e4eefd581d1ca52aa5e9",
"body": "Bumps [ramsey/composer-install](https://github.com/ramsey/composer-install) from 2 to 3.\n- [Release notes](https://github.com/ramsey/composer-install/releases)\n- [Commits](https://github.com/ramsey/composer-install/compare/v2...v3)\n\n---\nupdated-dependencies:\n- dependency-name: ramsey/composer-install\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump ramsey/composer-install from 2 to 3",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-04T21:07:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca74671fbb660fbf48cb992f8a4b4a786754dd7c",
"body": null,
"is_bot": false,
"headline": "Update GitHub Actions for Laravel 11",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2024-03-02T11:25:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b863a75b274f0a051aad98d80c9b62962c1f69a7",
"body": null,
"is_bot": false,
"headline": "Bump dependencies for Laravel 11",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2024-03-02T11:25:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "49194f2a64f50db5056e8e2445b6e483431ac018",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:06:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8e0080806fd83516ee2c5bf536099ca612852cf3",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:06:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e397cefb2ccbeea46aebdab057b50a6925d3f0e5",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:01:40Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 15,
"commits_last_year": 49,
"latest_release_at": "2026-04-29T21:28:55Z",
"latest_release_tag": "v3.2.0",
"releases_from_tags": false,
"days_since_last_push": 30,
"active_weeks_last_year": 7,
"days_since_latest_release": 84,
"mean_days_between_releases": 94.8
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 85,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "rawilk/filament-password-input",
"exists": true,
"license": "MIT",
"keywords": [
"ui",
"password",
"Forms",
"laravel",
"filament",
"rawilk",
"filament-password-input"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/rawilk/filament-password-input",
"is_deprecated": false,
"latest_version": "v3.2.0",
"repository_url": "https://github.com/rawilk/filament-password-input",
"versions_count": 15,
"total_downloads": 272286,
"dependents_count": 5,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 12675,
"first_published_at": null,
"latest_published_at": "2026-04-29T21:26:17Z",
"latest_version_yanked": null,
"days_since_latest_publish": 84
}
]
},
"popularity": {
"forks": 18,
"stars": 52,
"watchers": 1,
"fork_history": {
"days": [
{
"date": "2023-10-29",
"count": 1
},
{
"date": "2023-12-07",
"count": 1
},
{
"date": "2023-12-24",
"count": 1
},
{
"date": "2024-03-01",
"count": 1
},
{
"date": "2025-04-07",
"count": 1
},
{
"date": "2025-05-06",
"count": 1
},
{
"date": "2025-07-04",
"count": 1
},
{
"date": "2025-08-12",
"count": 1
},
{
"date": "2025-08-13",
"count": 1
},
{
"date": "2025-08-20",
"count": 1
},
{
"date": "2025-09-11",
"count": 1
},
{
"date": "2025-09-22",
"count": 1
},
{
"date": "2026-04-06",
"count": 1
}
],
"complete": true,
"collected": 13,
"total_forks": 18
},
"star_history": null,
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 2468,
"source_files_sampled": 16,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json"
],
"advisories": {
"error": "No resolved dependencies carried a version and a supported ecosystem",
"scope": "repository_graph",
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 11,
"direct_affected_count": 0
},
"ecosystems": [
"packagist"
],
"dependencies": [
{
"name": "filament/forms",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^4.0|^5.0"
},
{
"name": "illuminate/contracts",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^11.28|^12.0|^13.0"
},
{
"name": "spatie/laravel-package-tools",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^1.14"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "filament/forms",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "illuminate/contracts",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-package-tools",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "laravel/pint",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "nunomaduro/collision",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "orchestra/testbench",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest-plugin-laravel",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest-plugin-livewire",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "php",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-ray",
"direct": false,
"version": null,
"ecosystem": "packagist"
}
],
"collected": true,
"truncated": false,
"total_count": 11,
"direct_count": 3,
"indirect_count": 8
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 32,
"open_issues": 0,
"closed_ratio": 1,
"closed_issues": 2,
"closed_unmerged_prs": 6
},
"bus_factor": 1,
"bot_contributors": 2,
"top_contributors": [
{
"type": "User",
"login": "rawilk",
"commits": 129,
"avatar_url": "https://avatars.githubusercontent.com/u/22842525?v=4"
},
{
"type": "User",
"login": "Jacobtims",
"commits": 7,
"avatar_url": "https://avatars.githubusercontent.com/u/75219092?v=4"
},
{
"type": "User",
"login": "laravel-shift",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/15991828?v=4"
},
{
"type": "User",
"login": "Corvisier",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/202424?v=4"
},
{
"type": "User",
"login": "gpibarra",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/21188012?v=4"
},
{
"type": "User",
"login": "hamrak",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/5807028?v=4"
},
{
"type": "User",
"login": "EG-Mohamed",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/23424932?v=4"
},
{
"type": "User",
"login": "patriciomartinns",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/20000058?v=4"
},
{
"type": "User",
"login": "klaare",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/170330296?v=4"
}
],
"contributors_sampled": 9,
"top_contributor_share": 0.872
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"dependabot-auto-merge.yml",
"markdown-normalize.yml",
"pest.yml",
"pint.yml",
"update-changelog.yml"
],
"has_docs_dir": true,
"linter_configs": [],
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 0,
"reason": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 2/28 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 4 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 5,
"reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "7e93fb2523bf16b57a4b24fbd401f1e1284b9bae",
"ran_at": "2026-07-23T00:03:14Z",
"aggregate_score": 4.5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-20T21:12:53Z",
"oldest_open_prs": [
{
"number": 46,
"created_at": "2026-06-22T21:12:46Z",
"last_comment_at": null,
"last_comment_author": null
}
],
"last_merged_pr_at": "2026-04-29T21:19:42Z",
"ci_last_conclusion": "SUCCESS",
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/rawilk/filament-password-input",
"host": "github.com",
"name": "filament-password-input",
"owner": "rawilk"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"security": 45,
"vitality": 69,
"community": 57,
"governance": 65,
"engineering": 62
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "moderate",
"name": "Vitality",
"value": 69,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"commits_last_year": 49,
"human_commit_share": 0.75,
"days_since_last_push": 30,
"active_weeks_last_year": 7
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 30 days ago",
"points": 28.8,
"status": "partial",
"details": [
{
"code": "push_recency",
"params": {
"days": 30
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "7/52 weeks with commits",
"points": 4.8,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 7
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "49 commits in the last year",
"points": 15.3,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 49
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 5,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"releases_count": 15,
"latest_release_tag": "v3.2.0",
"releases_from_tags": false,
"days_since_latest_release": 84,
"mean_days_between_releases": 94.8
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "15 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 15
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 84 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 84
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~94.8 days",
"points": 19.8,
"status": "partial",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 94.8
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 84,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 84 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 84
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 38,
"inputs": {
"forks": 18,
"stars": 52,
"watchers": 1,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "52 stars",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 52
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "18 forks",
"points": 10.3,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 18
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "1 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 1
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 60,
"inputs": {
"packages": [
"rawilk/filament-password-input"
],
"dependents": 5,
"ecosystems": "packagist",
"total_downloads": 272286,
"monthly_downloads": 12675
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "12,675 downloads/month across packagist",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 12675,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "5 packages depend on it",
"points": 5.2,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 5
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 65,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 9,
"top_contributor_share": 0.872
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 87% of commits",
"points": 2.9,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 87
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "9 contributors",
"points": 12.2,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 9
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "good",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 79,
"inputs": {
"merged_prs": 32,
"open_issues": 0,
"closed_issues": 2,
"issue_closed_ratio": 1,
"closed_unmerged_prs": 6
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "100% of issues closed",
"points": 46.8,
"status": "met",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 100
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "32/38 decided PRs merged",
"points": 32.2,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 32,
"decided": 38
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 2/28 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"followers": 108,
"owner_type": "User",
"is_verified": null,
"owner_login": "rawilk",
"public_repos": 32,
"account_age_days": 3568
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "108 followers of rawilk",
"points": 14.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 108,
"login": "rawilk"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "32 public repos, account ~9 yr old",
"points": 23.1,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 32
}
},
{
"code": "account_age_years",
"params": {
"years": 9
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"rawilk/filament-password-input"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 84
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 84 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 84
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "15 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 15
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "moderate",
"name": "Engineering Quality",
"value": 62,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "5 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 5
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 6.4,
"status": "met",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [
"filamentphp",
"forms",
"password-input",
"ui"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "4 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 4
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 45,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 13,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 5,
"scorecard_aggregate": 4.5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 2/28 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 15
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 28,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 8,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.16,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "12 of 75 human commits state their intent (structured subject or explanatory body)",
"points": 8.5,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 12,
"sampled": 75
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "at_risk",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 33,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0.15
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no agent-authored commits among the last 100",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_authored_commits",
"params": {
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "15 of the last 100 commits are automated dependency updates",
"points": 8,
"status": "met",
"details": [
{
"code": "dependency_bot_commits",
"params": {
"count": 15,
"sampled": 100
}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "PHP",
"largest_source_bytes": 2468,
"source_files_sampled": 16,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "PHP without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "PHP"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/16 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 16,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token",
"No resolved dependencies carried a version and a supported ecosystem"
],
"report_type": "repository",
"generated_at": "2026-07-23T00:03:24.696646Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/rawilk/filament-password-input.svg",
"full_name": "rawilk/filament-password-input",
"license_state": "standard",
"license_spdx": "MIT"
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.27.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — Packagist.