Öffentliches RegisterMittel
Software-GesundheitsberichtSchema 0.27.0 · Metriken 1.13.0 · 2026-07-23 00:03 UTC
rawilk / filament-password-input
Enhanced password input component for filament.
rawilk/filament-password-input erreicht einen Gesundheitsindex von 61 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Vitality (69/100) ab, am schwächsten bei AI Readiness (28/100). Zuletzt vor 30 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
61
gesamt / 100Software-Gesundheitsindex
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
61
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
Bewertungsprofil
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Eigentümerschaft
Randall WilkPersönliches Konto
108 Follower32 öffentliche Reposseit Okt. 2016Randall Wilk
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
Paket-Ökosysteme
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| Packagist | rawilk/filament-password-input | v3.2.0 | 12.675 | 15 | vor 84 Tagen | uipasswordformslaravelfilamentrawilkfilament-password-input |
Metriken nach Kategorie
Vitalität
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
69
Entwicklungsaktivität
54Mittel
Wie die Bewertung erfolgt
| 28.8/36 | Push-Aktualität — letzter Push vor 30 Tagen |
| 4.8/36 | Commit-Rhythmus — 7/52 Wochen mit Commits |
| 15.3/18 | Commit-Volumen — 49 Commits im letzten Jahr |
| 5/10 | OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
Verwendete Eingangsdaten
| commits_last_year | 49 |
| human_commit_share | 0,75 |
| days_since_last_push | 30 |
| active_weeks_last_year | 7 |
Release-Disziplin
92Exzellent
Wie die Bewertung erfolgt
| 27/27 | Liefert Releases aus — 15 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 84 Tagen |
| 19.8/27 | Release-Rhythmus — ein Release etwa alle 94,8 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — keine Daten |
Verwendete Eingangsdaten
| releases_count | 15 |
| latest_release_tag | v3.2.0 |
| releases_from_tags | nein |
| days_since_latest_release | 84 |
| mean_days_between_releases | 94,8 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.
Community & Verbreitung
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
57
Popularität & Verbreitung
38Gefährdet
Wie die Bewertung erfolgt
| 27.7/60 | Stars — 52 Stars |
| 10.3/25 | Forks — 18 Forks |
| 0/15 | Watcher — 1 Watcher |
Verwendete Eingangsdaten
| forks | 18 |
| stars | 52 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community-Gesundheit
77Gut
Wie die Bewertung erfolgt
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 18/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 6.3/6.3 | PR-Vorlage |
Verwendete Eingangsdaten
| has_readme | ja |
| has_license | ja |
| has_contributing | ja |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | ja |
Wie die Bewertung erfolgt
| 54.7/80 | Downloads pro Monat — 12.675 Downloads/Monat über packagist |
| 5.2/20 | Abhängige in der Registry — 5 Pakete hängen davon ab |
Verwendete Eingangsdaten
| packages | rawilk/filament-password-input |
| dependents | 5 |
| ecosystems | packagist |
| total_downloads | 272.286 |
| monthly_downloads | 12.675 |
Nachhaltigkeit & Governance
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
65
Maintainer-Resilienz (Bus-Faktor)
34Gefährdet
Wie die Bewertung erfolgt
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 2.9/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 87 % der Commits |
| 12.2/13.5 | Breite der Beitragenden — 9 Beitragende |
| 10/10 | OpenSSF Scorecard: Contributors — project has 4 contributing companies or organizations |
Verwendete Eingangsdaten
| bus_factor | 1 |
| contributors_sampled | 9 |
| top_contributor_share | 0,872 |
Wie die Bewertung erfolgt
| 46.8/46.8 | Issue-Lösungsquote — 100 % der Issues geschlossen |
| 32.2/38.3 | PR-Annahme — 32/38 entschiedene PRs gemergt |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 2/28 approved changesets -- score normalized to 0 |
Verwendete Eingangsdaten
| merged_prs | 32 |
| open_issues | 0 |
| closed_issues | 2 |
| issue_closed_ratio | 1 |
| closed_unmerged_prs | 6 |
Eigentümerschaft & Trägerschaft
60Mittel
Wie die Bewertung erfolgt
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 14.6/25 | Reichweite des Inhabers — 108 Follower von rawilk |
| 23.1/25 | Kontohistorie — 32 öffentliche Repos, Kontoalter ca. 9 Jahre |
Verwendete Eingangsdaten
| followers | 108 |
| owner_type | User |
| is_verified | — |
| owner_login | rawilk |
| public_repos | 32 |
| account_age_days | 3.568 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Verifizierte Domain. Die verbleibenden Gewichte wurden renormalisiert.
Paketpflege
100Exzellent
Wie die Bewertung erfolgt
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf packagist |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 84 Tagen |
| 20/20 | Versionshistorie — 15 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
Verwendete Eingangsdaten
| packages | rawilk/filament-password-input |
| ecosystems | packagist |
| any_deprecated | nein |
| min_days_since_publish | 84 |
Engineering-Qualität
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
62
Engineering-Praktiken
54Mittel
Wie die Bewertung erfolgt
| 24/24 | CI-Workflows — 5 Workflow(s) |
| 24/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
Verwendete Eingangsdaten
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | ja |
| has_linter_config | nein |
| has_precommit_config | nein |
Dokumentation
75Gut
Wie die Bewertung erfolgt
| 30/30 | README |
| 25/25 | Dokumentationsverzeichnis |
| 0/15 | Dokumentations-/Homepage-Site |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 4 Topics |
| 0/10 | Wiki |
Verwendete Eingangsdaten
| topics | filamentphp, forms, password-input, ui |
| has_wiki | nein |
| homepage | — |
| has_readme | ja |
| has_docs_dir | ja |
| has_description | ja |
Sicherheit
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
45
Sicherheitslage
45Gefährdet
Wie die Bewertung erfolgt
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 2/28 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 4 contributing companies or organizations |
| 0/10 | Dangerous-Workflow — keine Daten |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 3.8/7.5 | Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| 0/5 | Packaging — keine Daten |
| 0/5 | Pinned-Dependencies — keine Daten |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — keine Daten |
| 0/7.5 | Token-Permissions — keine Daten |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Verwendete Eingangsdaten
| source | openssf_scorecard |
| checks_evaluated | 13 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 5 |
| scorecard_aggregate | 4,5 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Die verbleibenden Gewichte wurden renormalisiert.
AI Readiness
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
28
AI-Agentenkontext & Leitlinien
8Kritisch
Wie die Bewertung erfolgt
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 8.5/40 | Lesbare Commit-Historie — 12 von 75 menschlichen Commits benennen ihre Absicht (strukturierter Betreff oder erläuternder Text) |
Verwendete Eingangsdaten
| has_llms_txt | nein |
| legible_history_share | 0,16 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
AI-Verify-Loop (Build / Test / Typprüfung)
33Gefährdet
Wie die Bewertung erfolgt
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 0/11 | Statische Typprüfung |
| 0/10 | Reproduzierbare Umgebung |
| 0/10 | Belegte Agentenpraxis — keine von Agenten verfassten Commits unter den letzten 100 |
| 8/8 | Automatisierte Wartung — 15 der letzten 100 Commits sind automatisierte Abhängigkeits-Updates |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — keine Daten |
Verwendete Eingangsdaten
| has_nix | nein |
| has_tests | ja |
| lockfiles | — |
| has_dockerfile | nein |
| typed_language | nein |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0,15 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Pinned-Dependencies. Die verbleibenden Gewichte wurden renormalisiert.
AI-Code-Lesbarkeit für Modelle
55Mittel
Wie die Bewertung erfolgt
| 0/45 | Typprüfbarer Code — PHP ohne Typprüfungs-Konfiguration |
| 55/55 | Handhabbare Dateigrößen — 0/16 Quelldateien über 60 KB |
Verwendete Eingangsdaten
| primary_language | PHP |
| largest_source_bytes | 2.468 |
| source_files_sampled | 16 |
| oversized_source_files | 0 |
Eckdaten
52GitHub-Sterne
9Mitwirkende
49Commits, letzte 12 Monate
30Tage seit letztem Push
15Releases
1Bus-Faktor
0offene Issues
PackagistPaket-Ökosysteme
Warnungen zur Datenerhebung
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
- No resolved dependencies carried a version and a supported ecosystem
Weitere Details
Stern- und Fork-Verlauf 0 ★ / 18 ⇿
0Sterne
18Forks
12Releases
Wann jeder Stern und Fork hinzugefügt wurde, von GitHub erfasst und nach Tagen gruppiert. Das kumulierte Wachstum steht direkt über den täglichen Zugängen, aus denen es besteht, sodass beide gegeneinander lesbar sind: stetiger organischer Zuwachs sieht ganz anders aus als ein abrupter, kurzlebiger Ausschlag. Wo dieser Unterschied messbar ist, wird er als Wachstumsauthentizität ausgewiesen.
Major 2Minor 3Patch 7
Jeder Punkt umfasst 3 Tage.
OpenSSF Scorecard 4.5 / 10
4.5Gesamtwert
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 0 | CI-Tests | 0 out of 3 merged PRs checked by a CI test -- score normalized to 0 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 2/28 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 4 contributing companies or organizations |
| k. A. | Dangerous-Workflow | no workflows found |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 5 | Maintained | 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| k. A. | Packaging | packaging workflow not detected |
| k. A. | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| k. A. | Signed-Releases | no releases found |
| k. A. | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Direkte Abhängigkeiten 3
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| Packagist | filament/forms | ^4.0|^5.0 | composer.json |
| Packagist | illuminate/contracts | ^11.28|^12.0|^13.0 | composer.json |
| Packagist | spatie/laravel-package-tools | ^1.14 | composer.json |
Alle Abhängigkeiten 11
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 3 direkte und 8 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| Packagist | filament/forms | — | direkt |
| Packagist | illuminate/contracts | — | direkt |
| Packagist | spatie/laravel-package-tools | — | direkt |
| Packagist | laravel/pint | — | indirekt |
| Packagist | nunomaduro/collision | — | indirekt |
| Packagist | orchestra/testbench | — | indirekt |
| Packagist | pestphp/pest | — | indirekt |
| Packagist | pestphp/pest-plugin-laravel | — | indirekt |
| Packagist | pestphp/pest-plugin-livewire | — | indirekt |
| Packagist | php | — | indirekt |
| Packagist | spatie/laravel-ray | — | indirekt |
Abhängigkeits-Advisories nicht bewertet
Der Advisory-Abgleich konnte für diesen Bericht nicht ausgeführt werden: No resolved dependencies carried a version and a supported ecosystem
JSON-Rohbericht maschinenlesbar
{
"data": {
"repo": {
"topics": [
"filamentphp",
"forms",
"password-input",
"ui"
],
"is_fork": false,
"size_kb": 338,
"has_wiki": false,
"homepage": null,
"languages": {
"PHP": 13041,
"Shell": 28
},
"pushed_at": "2026-06-22T21:12:45Z",
"created_at": "2023-10-17T18:32:06Z",
"owner_type": "User",
"updated_at": "2026-04-29T21:29:11Z",
"description": "Enhanced password input component for filament.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "PHP",
"significant_languages": [
"PHP"
]
},
"owner": {
"blog": "https://randallwilk.dev",
"name": "Randall Wilk",
"type": "User",
"login": "rawilk",
"company": "Randall Wilk",
"location": "Wisconsin, United States",
"followers": 108,
"avatar_url": "https://avatars.githubusercontent.com/u/22842525?v=4",
"created_at": "2016-10-14T16:46:24Z",
"is_verified": null,
"public_repos": 32,
"account_age_days": 3568
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v3.2.0",
"kind": "minor",
"published_at": "2026-04-29T21:28:55Z"
},
{
"tag": "v3.1.0",
"kind": "minor",
"published_at": "2026-03-09T20:22:49Z"
},
{
"tag": "v2.1.1",
"kind": "patch",
"published_at": "2026-03-09T19:40:43Z"
},
{
"tag": "v3.0.0",
"kind": "major",
"published_at": "2026-03-09T19:27:58Z"
},
{
"tag": "v2.1.0",
"kind": "minor",
"published_at": "2025-05-18T20:19:35Z"
},
{
"tag": "v2.0.3",
"kind": "patch",
"published_at": "2025-02-25T14:10:46Z"
},
{
"tag": "v2.0.2",
"kind": "patch",
"published_at": "2024-10-01T14:28:57Z"
},
{
"tag": "v2.0.1",
"kind": "patch",
"published_at": "2024-03-05T15:03:16Z"
},
{
"tag": "v2.0.0",
"kind": "major",
"published_at": "2024-01-23T01:01:25Z"
},
{
"tag": "v1.1.3",
"kind": "patch",
"published_at": "2023-12-28T19:10:10Z"
},
{
"tag": "v1.1.2",
"kind": "patch",
"published_at": "2023-12-26T13:31:59Z"
},
{
"tag": "v1.1.1",
"kind": "patch",
"published_at": "2023-12-04T13:51:58Z"
},
{
"tag": "v1.1.0",
"kind": "minor",
"published_at": "2023-10-29T22:23:51Z"
},
{
"tag": "v1.0.1",
"kind": "patch",
"published_at": "2023-10-19T14:32:56Z"
},
{
"tag": "v1.0.0",
"kind": "major",
"published_at": "2023-10-19T00:51:32Z"
}
],
"recent_commits": [
{
"oid": "7e93fb2523bf16b57a4b24fbd401f1e1284b9bae",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:29:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7cd33992591cd09d77c9b25cdf6fcfddea8ad0ea",
"body": null,
"is_bot": false,
"headline": "Clean up commented-out matrix entries in Pest workflow configuration",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:26:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f49172d1afd425573506000f2c4c5d835aa4e887",
"body": null,
"is_bot": false,
"headline": "Update test config",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:24:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "734906d7788acf3e45069dd809d3a47f41fc2ad8",
"body": "* Bump dependabot/fetch-metadata from 2.5.0 to 3.0.0\n\nBumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.5.0 to 3.0.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.5.0.\n[…]\nabot[bot] <support@github.com>\n\n* PHP Linting (Pint)\n\n---------\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.5.0 to 3.0.0 (#43)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-04-29T21:19:42Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "990b8b6fe6b46759633a1c045bdde2f6c8367d76",
"body": null,
"is_bot": false,
"headline": "PHP Linting (Pint)",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:19:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0bfce69b08875933d15b4cf5ff61ea7a8de8f7e9",
"body": "Add support for Laravel 13",
"is_bot": false,
"headline": "Merge pull request #44 from hamrak/main",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-04-29T21:18:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "851c42514fe7e3678602cf638d2f8a0544459087",
"body": null,
"is_bot": false,
"headline": "Add support for Laravel 13",
"author_name": "Ján Hamrák",
"author_login": "hamrak",
"committed_at": "2026-04-06T20:28:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c0e159f3d34d303eb0990092969c8dcabf13333",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:23:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "edd9dd5fca0ee0e5de6c726abc5a9910d14834f1",
"body": null,
"is_bot": false,
"headline": "Rollback Laravel 13.x for n ow",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:18:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0afe48d91e9697142833fefbd6458c5ed1570a06",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:17:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0ca721231ba6dc50d719d949e1ce38a4fbfaf3a2",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:12:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a1b7f3209896a67b265aeeac9770eed7e2b5b1c2",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:11:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "77f4c6e2c3e1cd3bf1aefb78fa8750fdc5d8c4af",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:10:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b08a7d0efe974f3fcbe270f076d1018f6e576ae8",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:04:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "228d4f95343ce845737a43645801fba4fb4697cb",
"body": null,
"is_bot": false,
"headline": "Add PHP 8.5 to Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T20:00:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a305457947edf1aa058861abe4ec11f47203f4e",
"body": null,
"is_bot": false,
"headline": "Exclude Filament v5 from PHP 8.2 in Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:55:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f7e3f30ffa127a80f05d1c5f4dfb8dce3dc9d9b0",
"body": null,
"is_bot": false,
"headline": "Add Filament v4 and v5 to Pest workflow matrix",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:53:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bada8bc8724119f0b212498612bc1e0def3bfbea",
"body": null,
"is_bot": false,
"headline": "Add Filament v4 and v5 compatibility to workflow matrices",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:48:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7fcf321b74320f0eb0db4850fbba3d0566d752d2",
"body": null,
"is_bot": false,
"headline": "Filament v5 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:45:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "eabd92858cac4b98ffe5f38ebffd4860001a920a",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:41:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "06123ad1d00a2c8ee355561b687f34bca7043271",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:28:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "14b3cab23177f3a658f33ff2df529905f0b71656",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:25:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ee618fdda49753920bea920f7c87d5de9e6f2238",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:24:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "198e0648e3d128dd9dc477582bf8ee18261b3218",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:22:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c62030030f000f11faa65fa8e7b2f4d618148bfd",
"body": null,
"is_bot": false,
"headline": "Exclude php 8.2 from laravel 13.x tests",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:18:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e561bfa57c820125a09554a0407bd12c30f7a23d",
"body": null,
"is_bot": false,
"headline": "Test for laravel 13.x compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:17:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c18f6405766dedff002462b81a49ec4596565328",
"body": null,
"is_bot": false,
"headline": "Test for php 8.5 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:15:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7417448caaeab59df32ec5171bc0979a40ab008a",
"body": null,
"is_bot": false,
"headline": "update yml formatting",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:13:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ea3563e9f964a0ef37f6e24c6badd5121f50fde3",
"body": "spanish translate",
"is_bot": false,
"headline": "Merge pull request #35 from gpibarra/lang_es",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:08:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8e78fa6630b4a6fbad6cf53208cdeae53dec8193",
"body": null,
"is_bot": false,
"headline": "Update UPGRADE.md with Laravel 11 and Filament v4 changes",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:06:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f45b750d44bc3ecc9b971702a29012416dbca50e",
"body": null,
"is_bot": false,
"headline": "Update README for Filament v4 compatibility adjustments",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T19:02:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e0ac95ad1f3b28aa27151aa362696932c90abde7",
"body": null,
"is_bot": false,
"headline": "Fix broken link to upgrade guide in README",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T18:53:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "de2412213aa9319e40f54410d10812a8b465499b",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:57:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c084f3d283be0530e731d21e34800b06c350223",
"body": null,
"is_bot": false,
"headline": "Filament v4 compat",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:50:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "64d1c8a52ba75d5f5896bf9f34732c45ae694679",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:36:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6e6e0b06a3a093144a367ca4eb977b7d0a2ffa36",
"body": "Filament 4 update",
"is_bot": false,
"headline": "Merge pull request #38 from Jacobtims/filament-4-update",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2026-03-09T14:35:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5f62382272ad1b7d0882a2a0107a84a69eca996e",
"body": "Bumps [actions/checkout](https://github.com/actions/checkout) from 4 to 6.\n- [Release notes](https://github.com/actions/checkout/releases)\n- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)\n- [Commits](https://github.com/actions/checkout/compare/v4...v6)\n\n---\nupdated-dependenc\n[…]\nirect:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump actions/checkout from 4 to 6 (#40)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-09T14:32:26Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "f647d61382cd2100a54c5ea7057e038776eee88e",
"body": "Bumps [stefanzweifel/git-auto-commit-action](https://github.com/stefanzweifel/git-auto-commit-action) from 5 to 7.\n- [Release notes](https://github.com/stefanzweifel/git-auto-commit-action/releases)\n- [Changelog](https://github.com/stefanzweifel/git-auto-commit-action/blob/master/CHANGELOG.md)\n- [Co\n[…]\nirect:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>\nCo-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>",
"is_bot": true,
"headline": "Bump stefanzweifel/git-auto-commit-action from 5 to 7 (#39)",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-03-09T14:31:52Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "927966abd81c4b838b233fbd7c1162ad6d1e0942",
"body": "…ot/fetch-metadata-2.5.0\n\nBump dependabot/fetch-metadata from 2.4.0 to 2.5.0",
"is_bot": true,
"headline": "Merge pull request #41 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2026-01-05T21:07:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d8a66343c425fa56badc7637810f58d2cbff3fe5",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.4.0 to 2.5.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.4.0...v2.5.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-version: 2.5.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.4.0 to 2.5.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2026-01-05T21:07:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "da6782d63dbc2b93cd458df54318e68e109fcd64",
"body": null,
"is_bot": false,
"headline": "Update README.md",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:11:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a3dc804c9d62b986525f9107b3081d4287f98480",
"body": null,
"is_bot": false,
"headline": "Update icons to use Heroicon class",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:08:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "92c7d764e416544995f9d6a8258af31592044493",
"body": null,
"is_bot": false,
"headline": "Fix action visibility",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-26T09:06:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "72d0c6971e6197392d1b209d6ee9359ef80ae101",
"body": null,
"is_bot": false,
"headline": "Fix isDisabled())",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:33:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "994c0f36eef62f53448a28eec6b1847c3646d4a0",
"body": null,
"is_bot": false,
"headline": "Align the copyable method with Filament's one",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:18:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c56ebafd9bfb1b97268f7f21c829bf3a9eda2d4a",
"body": null,
"is_bot": false,
"headline": "Update UPGRADE.md",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:05:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "291e4218b69727a435541be7f2fd9e81f208551a",
"body": null,
"is_bot": false,
"headline": "Update to Filament v4",
"author_name": "Jacob",
"author_login": "Jacobtims",
"committed_at": "2025-08-20T13:03:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "52e7c0c7860b04a51f4a3618d200c464aa1c7ee0",
"body": "…i/laravel-pint-action-2.6\n\nBump aglipanci/laravel-pint-action from 2.5 to 2.6",
"is_bot": true,
"headline": "Merge pull request #36 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-07-28T23:25:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f941997245117d581ea6b6d4d467e5fde1e8e2c3",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.5 to 2.6.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.5...2.6)\n\n---\nupdated-dependencies:\n- dependenc\n[…]\nname: aglipanci/laravel-pint-action\n dependency-version: '2.6'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.5 to 2.6",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-07-28T23:25:20Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "74197afb52d1566a96a75285f8e2207c32cb68b3",
"body": null,
"is_bot": false,
"headline": "spanish translate",
"author_name": "Gerardo Ibarra",
"author_login": "gpibarra",
"committed_at": "2025-07-04T18:51:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "581f5e6c66e1c79e290fe345409af7c58d674308",
"body": "…ettier_action-4.6\n\nBump creyD/prettier_action from 4.5 to 4.6",
"is_bot": true,
"headline": "Merge pull request #33 from rawilk/dependabot/github_actions/creyD/pr…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-06-16T22:07:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1839f50ea8f87aca550f1c2f1dffa4ee27e9d58a",
"body": "Bumps [creyD/prettier_action](https://github.com/creyd/prettier_action) from 4.5 to 4.6.\n- [Release notes](https://github.com/creyd/prettier_action/releases)\n- [Commits](https://github.com/creyd/prettier_action/compare/v4.5...v4.6)\n\n---\nupdated-dependencies:\n- dependency-name: creyD/prettier_action\n dependency-version: '4.6'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump creyD/prettier_action from 4.5 to 4.6",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-06-16T22:06:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "87252824e736342406b53a29c32bce334846d97f",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:19:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "93436e072463838492addcd4f50eaef423a5b144",
"body": null,
"is_bot": false,
"headline": "Cleanup composer file",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:16:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "94064c4914114b7d75ec0e7849701e1d1caf8920",
"body": "added dutch translations",
"is_bot": false,
"headline": "Merge pull request #28 from klaare/lang/dutch",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-05-18T20:13:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d5ca4a628cf66edf4dbab60379a4515b92ce0746",
"body": "…ot/fetch-metadata-2.4.0\n\nBump dependabot/fetch-metadata from 2.3.0 to 2.4.0",
"is_bot": true,
"headline": "Merge pull request #30 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-05-12T22:00:47Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "691d05d11771bed60836e2e16b1f8d04deedfac3",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.3.0 to 2.4.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.3.0...v2.4.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-version: 2.4.0\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.3.0 to 2.4.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-12T22:00:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c65ba08ab0c0aff957e3442b11b200e712023052",
"body": "…ettier_action-4.5\n\nBump creyD/prettier_action from 4.3 to 4.5",
"is_bot": true,
"headline": "Merge pull request #29 from rawilk/dependabot/github_actions/creyD/pr…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-05-12T21:56:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bff3acde5651211a2800fcb52762f3adf4499dcc",
"body": "Bumps [creyD/prettier_action](https://github.com/creyd/prettier_action) from 4.3 to 4.5.\n- [Release notes](https://github.com/creyd/prettier_action/releases)\n- [Commits](https://github.com/creyd/prettier_action/compare/v4.3...v4.5)\n\n---\nupdated-dependencies:\n- dependency-name: creyD/prettier_action\n dependency-version: '4.5'\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump creyD/prettier_action from 4.3 to 4.5",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-05-12T21:56:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a56fe0587596540622ae131d10370c03eeca26ab",
"body": null,
"is_bot": false,
"headline": "added dutch translations",
"author_name": "klaare",
"author_login": "klaare",
"committed_at": "2025-05-06T21:24:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7c59680ef53b8f39e54133e95dad65fcc7f34564",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:11:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "92e7c098f6f7e04e68a88aabc0fcff7afbcc0dbd",
"body": null,
"is_bot": false,
"headline": "Merge pull request #27 from rawilk/php_8.4",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:07:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5c983362318212caa1b9043ca78373c8dc7ed2bf",
"body": null,
"is_bot": false,
"headline": "Test php 8.4 compatability",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:04:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c0c42f4d44ccec5218535ca604dc80e909e94be2",
"body": null,
"is_bot": false,
"headline": "Merge pull request #26 from rawilk/chore/remove-larastan",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T14:02:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a8e78076851495110b81c6036019979aba98bd5f",
"body": null,
"is_bot": false,
"headline": "Remove larastan workflow",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:58:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "234a80499e2f7f2a9a2b68ac3a8d9ed8471222a0",
"body": null,
"is_bot": false,
"headline": "Remove larastan dev requirement",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:58:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "25f71cf86e522dcc9fd900614dd33722c20c2e0a",
"body": null,
"is_bot": false,
"headline": "[Chore]: Cleanup Workflows (#25)",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:56:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "19d3840b3944482726b261f82f7af1e22b152c52",
"body": "Laravel 12.x Compatibility",
"is_bot": false,
"headline": "Merge pull request #23 from laravel-shift/l12-compatibility",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2025-02-25T13:40:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3169d7c6e0d7b6f78153be3e371e622b1d37462c",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "laravel-shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ff6243df0403b6c6a572b64e98bab6f4f42e4a47",
"body": null,
"is_bot": false,
"headline": "Update GitHub Actions for Laravel 12",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "392d9d3014e47c6d467f5381015e235d7dddecc8",
"body": null,
"is_bot": false,
"headline": "Bump dependencies for Laravel 12",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2025-02-16T21:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "32f7fd55672d1b19989fc6218cb45b27d683b3db",
"body": "…i/laravel-pint-action-2.5\n\nBump aglipanci/laravel-pint-action from 2.4 to 2.5",
"is_bot": true,
"headline": "Merge pull request #22 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-02-03T22:00:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ede867da0e2735fab8900d956186182a0798677a",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.4 to 2.5.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.4...2.5)\n\n---\nupdated-dependencies:\n- dependency-name: aglipanci/laravel-pint-action\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.4 to 2.5",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-02-03T21:59:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4e50eff8ed35a45c821e0d9909e7e12bb992cba2",
"body": "…ot/fetch-metadata-2.3.0\n\nBump dependabot/fetch-metadata from 2.2.0 to 2.3.0",
"is_bot": true,
"headline": "Merge pull request #21 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2025-01-27T21:07:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "05dffa61e55574a77ce4b853be4b0378094a4a40",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.2.0 to 2.3.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.2.0...v2.3.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.2.0 to 2.3.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2025-01-27T21:07:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f062541c757068e560bbf5169e766ff730b6854e",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-10-01T14:29:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bd898d5db4d4e66709094f2d1a78732a4ce9bb48",
"body": "Adds Brazilian Portuguese translation",
"is_bot": false,
"headline": "Merge pull request #18 from patriciomartinns/add-pt-br-translation",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-10-01T14:28:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "460a7574ff554fcf0549ea80b1a417d796d8079c",
"body": "…ot/fetch-metadata-2.2.0\n\nBump dependabot/fetch-metadata from 2.1.0 to 2.2.0",
"is_bot": true,
"headline": "Merge pull request #19 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-07-08T22:01:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3dc30656c11addc8e2525c6afb0177101e5da9fd",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.1.0 to 2.2.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.1.0...v2.2.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.1.0 to 2.2.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-07-08T22:01:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fba39344aaf1716b5fc15a7a349d0d30cd7b7e0a",
"body": null,
"is_bot": false,
"headline": "Adds Brazilian Portuguese translation",
"author_name": "Patrício Martins",
"author_login": "patriciomartinns",
"committed_at": "2024-06-07T20:51:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cc1225ce2a0b327721be9abfb76a63e4193ede27",
"body": "…ot/fetch-metadata-2.1.0\n\nBump dependabot/fetch-metadata from 2.0.0 to 2.1.0",
"is_bot": true,
"headline": "Merge pull request #17 from rawilk/dependabot/github_actions/dependab…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-04-29T21:49:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a04744addc229ccb2af7f8ac91febb1508ac8c8",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 2.0.0 to 2.1.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v2.0.0...v2.1.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 2.0.0 to 2.1.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-29T21:49:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d54e3370e6fa071fc656998f1e65f73b00d6dbad",
"body": "…i/laravel-pint-action-2.4\n\nBump aglipanci/laravel-pint-action from 2.3.1 to 2.4",
"is_bot": true,
"headline": "Merge pull request #16 from rawilk/dependabot/github_actions/aglipanc…",
"author_name": "github-actions[bot]",
"author_login": "github-actions[bot]",
"committed_at": "2024-04-15T21:18:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "028bca3d4516343cd485649b40bb61433a63dded",
"body": "Bumps [aglipanci/laravel-pint-action](https://github.com/aglipanci/laravel-pint-action) from 2.3.1 to 2.4.\n- [Release notes](https://github.com/aglipanci/laravel-pint-action/releases)\n- [Commits](https://github.com/aglipanci/laravel-pint-action/compare/2.3.1...2.4)\n\n---\nupdated-dependencies:\n- dependency-name: aglipanci/laravel-pint-action\n dependency-type: direct:production\n update-type: version-update:semver-minor\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump aglipanci/laravel-pint-action from 2.3.1 to 2.4",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-04-15T21:18:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c1850cd671ece4523a25daff4c5965332e272864",
"body": "…ot/fetch-metadata-2.0.0\n\nBump dependabot/fetch-metadata from 1.6.0 to 2.0.0",
"is_bot": false,
"headline": "Merge pull request #15 from rawilk/dependabot/github_actions/dependab…",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-27T18:34:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a90ad6919e236dc01d0627f551f41a6a3ea1ca12",
"body": "Bumps [dependabot/fetch-metadata](https://github.com/dependabot/fetch-metadata) from 1.6.0 to 2.0.0.\n- [Release notes](https://github.com/dependabot/fetch-metadata/releases)\n- [Commits](https://github.com/dependabot/fetch-metadata/compare/v1.6.0...v2.0.0)\n\n---\nupdated-dependencies:\n- dependency-name: dependabot/fetch-metadata\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump dependabot/fetch-metadata from 1.6.0 to 2.0.0",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-25T21:45:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "34dbda594bae372caae695d377436485917f1266",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T15:03:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bda2631925027c4d6c0067fd71d3b3b6ea8ecc30",
"body": null,
"is_bot": false,
"headline": "Remove unused dep",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T15:00:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "970c7f8b86f4add5476cf08c989726425fbfb8af",
"body": null,
"is_bot": false,
"headline": "Remove --ignore-platform-reqs flag",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:57:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e2248f199a601d5bd6121562a71f4d3f81f365f6",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:49:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3be7e35e1284a36b1338c8542c831f101c062998",
"body": null,
"is_bot": false,
"headline": "Add constraints for laravel 11.x",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:39:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2c43128d33bea4832885b90bddd8fafaa850ddf7",
"body": null,
"is_bot": false,
"headline": "Fix pest runner",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:36:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f227e9c98f2d0deabfffeabaefb6d960b0edddb0",
"body": "…omposer-install-3\n\nBump ramsey/composer-install from 2 to 3",
"is_bot": false,
"headline": "Merge pull request #14 from rawilk/dependabot/github_actions/ramsey/c…",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:33:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a70cb4af294b8a42812a8014fcb0b06e07cfa9c0",
"body": "Laravel 11.x Compatibility",
"is_bot": false,
"headline": "Merge pull request #13 from laravel-shift/l11-compatibility",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-03-05T14:32:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "715a7e60146ad4e28e96e4eefd581d1ca52aa5e9",
"body": "Bumps [ramsey/composer-install](https://github.com/ramsey/composer-install) from 2 to 3.\n- [Release notes](https://github.com/ramsey/composer-install/releases)\n- [Commits](https://github.com/ramsey/composer-install/compare/v2...v3)\n\n---\nupdated-dependencies:\n- dependency-name: ramsey/composer-install\n dependency-type: direct:production\n update-type: version-update:semver-major\n...\n\nSigned-off-by: dependabot[bot] <support@github.com>",
"is_bot": true,
"headline": "Bump ramsey/composer-install from 2 to 3",
"author_name": "dependabot[bot]",
"author_login": "dependabot[bot]",
"committed_at": "2024-03-04T21:07:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca74671fbb660fbf48cb992f8a4b4a786754dd7c",
"body": null,
"is_bot": false,
"headline": "Update GitHub Actions for Laravel 11",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2024-03-02T11:25:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b863a75b274f0a051aad98d80c9b62962c1f69a7",
"body": null,
"is_bot": false,
"headline": "Bump dependencies for Laravel 11",
"author_name": "Shift",
"author_login": "laravel-shift",
"committed_at": "2024-03-02T11:25:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "49194f2a64f50db5056e8e2445b6e483431ac018",
"body": null,
"is_bot": false,
"headline": "Prettified Code!",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:06:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8e0080806fd83516ee2c5bf536099ca612852cf3",
"body": null,
"is_bot": false,
"headline": "wip",
"author_name": "Randall Wilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:06:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e397cefb2ccbeea46aebdab057b50a6925d3f0e5",
"body": null,
"is_bot": false,
"headline": "Update CHANGELOG",
"author_name": "rawilk",
"author_login": "rawilk",
"committed_at": "2024-01-23T01:01:40Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 15,
"commits_last_year": 49,
"latest_release_at": "2026-04-29T21:28:55Z",
"latest_release_tag": "v3.2.0",
"releases_from_tags": false,
"days_since_last_push": 30,
"active_weeks_last_year": 7,
"days_since_latest_release": 84,
"mean_days_between_releases": 94.8
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 85,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "rawilk/filament-password-input",
"exists": true,
"license": "MIT",
"keywords": [
"ui",
"password",
"Forms",
"laravel",
"filament",
"rawilk",
"filament-password-input"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/rawilk/filament-password-input",
"is_deprecated": false,
"latest_version": "v3.2.0",
"repository_url": "https://github.com/rawilk/filament-password-input",
"versions_count": 15,
"total_downloads": 272286,
"dependents_count": 5,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 12675,
"first_published_at": null,
"latest_published_at": "2026-04-29T21:26:17Z",
"latest_version_yanked": null,
"days_since_latest_publish": 84
}
]
},
"popularity": {
"forks": 18,
"stars": 52,
"watchers": 1,
"fork_history": {
"days": [
{
"date": "2023-10-29",
"count": 1
},
{
"date": "2023-12-07",
"count": 1
},
{
"date": "2023-12-24",
"count": 1
},
{
"date": "2024-03-01",
"count": 1
},
{
"date": "2025-04-07",
"count": 1
},
{
"date": "2025-05-06",
"count": 1
},
{
"date": "2025-07-04",
"count": 1
},
{
"date": "2025-08-12",
"count": 1
},
{
"date": "2025-08-13",
"count": 1
},
{
"date": "2025-08-20",
"count": 1
},
{
"date": "2025-09-11",
"count": 1
},
{
"date": "2025-09-22",
"count": 1
},
{
"date": "2026-04-06",
"count": 1
}
],
"complete": true,
"collected": 13,
"total_forks": 18
},
"star_history": null,
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 2468,
"source_files_sampled": 16,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json"
],
"advisories": {
"error": "No resolved dependencies carried a version and a supported ecosystem",
"scope": "repository_graph",
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 11,
"direct_affected_count": 0
},
"ecosystems": [
"packagist"
],
"dependencies": [
{
"name": "filament/forms",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^4.0|^5.0"
},
{
"name": "illuminate/contracts",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^11.28|^12.0|^13.0"
},
{
"name": "spatie/laravel-package-tools",
"manifest": "composer.json",
"ecosystem": "packagist",
"version_constraint": "^1.14"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "filament/forms",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "illuminate/contracts",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-package-tools",
"direct": true,
"version": null,
"ecosystem": "packagist"
},
{
"name": "laravel/pint",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "nunomaduro/collision",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "orchestra/testbench",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest-plugin-laravel",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "pestphp/pest-plugin-livewire",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "php",
"direct": false,
"version": null,
"ecosystem": "packagist"
},
{
"name": "spatie/laravel-ray",
"direct": false,
"version": null,
"ecosystem": "packagist"
}
],
"collected": true,
"truncated": false,
"total_count": 11,
"direct_count": 3,
"indirect_count": 8
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 32,
"open_issues": 0,
"closed_ratio": 1,
"closed_issues": 2,
"closed_unmerged_prs": 6
},
"bus_factor": 1,
"bot_contributors": 2,
"top_contributors": [
{
"type": "User",
"login": "rawilk",
"commits": 129,
"avatar_url": "https://avatars.githubusercontent.com/u/22842525?v=4"
},
{
"type": "User",
"login": "Jacobtims",
"commits": 7,
"avatar_url": "https://avatars.githubusercontent.com/u/75219092?v=4"
},
{
"type": "User",
"login": "laravel-shift",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/u/15991828?v=4"
},
{
"type": "User",
"login": "Corvisier",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/202424?v=4"
},
{
"type": "User",
"login": "gpibarra",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/21188012?v=4"
},
{
"type": "User",
"login": "hamrak",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/5807028?v=4"
},
{
"type": "User",
"login": "EG-Mohamed",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/23424932?v=4"
},
{
"type": "User",
"login": "patriciomartinns",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/20000058?v=4"
},
{
"type": "User",
"login": "klaare",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/170330296?v=4"
}
],
"contributors_sampled": 9,
"top_contributor_share": 0.872
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"dependabot-auto-merge.yml",
"markdown-normalize.yml",
"pest.yml",
"pint.yml",
"update-changelog.yml"
],
"has_docs_dir": true,
"linter_configs": [],
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 0,
"reason": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 2/28 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 4 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 5,
"reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "7e93fb2523bf16b57a4b24fbd401f1e1284b9bae",
"ran_at": "2026-07-23T00:03:14Z",
"aggregate_score": 4.5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-20T21:12:53Z",
"oldest_open_prs": [
{
"number": 46,
"created_at": "2026-06-22T21:12:46Z",
"last_comment_at": null,
"last_comment_author": null
}
],
"last_merged_pr_at": "2026-04-29T21:19:42Z",
"ci_last_conclusion": "SUCCESS",
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/rawilk/filament-password-input",
"host": "github.com",
"name": "filament-password-input",
"owner": "rawilk"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"security": 45,
"vitality": 69,
"community": 57,
"governance": 65,
"engineering": 62
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "moderate",
"name": "Vitality",
"value": 69,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"commits_last_year": 49,
"human_commit_share": 0.75,
"days_since_last_push": 30,
"active_weeks_last_year": 7
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 30 days ago",
"points": 28.8,
"status": "partial",
"details": [
{
"code": "push_recency",
"params": {
"days": 30
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "7/52 weeks with commits",
"points": 4.8,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 7
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "49 commits in the last year",
"points": 15.3,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 49
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 5,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"releases_count": 15,
"latest_release_tag": "v3.2.0",
"releases_from_tags": false,
"days_since_latest_release": 84,
"mean_days_between_releases": 94.8
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "15 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 15
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 84 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 84
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~94.8 days",
"points": 19.8,
"status": "partial",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 94.8
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 84,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 84 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 84
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 38,
"inputs": {
"forks": 18,
"stars": 52,
"watchers": 1,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "52 stars",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 52
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "18 forks",
"points": 10.3,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 18
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "1 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 1
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 60,
"inputs": {
"packages": [
"rawilk/filament-password-input"
],
"dependents": 5,
"ecosystems": "packagist",
"total_downloads": 272286,
"monthly_downloads": 12675
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "12,675 downloads/month across packagist",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 12675,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "5 packages depend on it",
"points": 5.2,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 5
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 65,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 9,
"top_contributor_share": 0.872
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 87% of commits",
"points": 2.9,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 87
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "9 contributors",
"points": 12.2,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 9
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "good",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 79,
"inputs": {
"merged_prs": 32,
"open_issues": 0,
"closed_issues": 2,
"issue_closed_ratio": 1,
"closed_unmerged_prs": 6
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "100% of issues closed",
"points": 46.8,
"status": "met",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 100
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "32/38 decided PRs merged",
"points": 32.2,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 32,
"decided": 38
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 2/28 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"followers": 108,
"owner_type": "User",
"is_verified": null,
"owner_login": "rawilk",
"public_repos": 32,
"account_age_days": 3568
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "108 followers of rawilk",
"points": 14.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 108,
"login": "rawilk"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "32 public repos, account ~9 yr old",
"points": 23.1,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 32
}
},
{
"code": "account_age_years",
"params": {
"years": 9
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"rawilk/filament-password-input"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 84
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 84 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 84
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "15 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 15
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "moderate",
"name": "Engineering Quality",
"value": 62,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 54,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": true,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "5 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 5
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 6.4,
"status": "met",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [
"filamentphp",
"forms",
"password-input",
"ui"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "4 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 4
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 45,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 13,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 5,
"scorecard_aggregate": 4.5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "0 out of 3 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 2/28 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 4 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 15
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 28,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 8,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.16,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "12 of 75 human commits state their intent (structured subject or explanatory body)",
"points": 8.5,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 12,
"sampled": 75
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "at_risk",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 33,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0.15
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no agent-authored commits among the last 100",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_authored_commits",
"params": {
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "15 of the last 100 commits are automated dependency updates",
"points": 8,
"status": "met",
"details": [
{
"code": "dependency_bot_commits",
"params": {
"count": 15,
"sampled": 100
}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "PHP",
"largest_source_bytes": 2468,
"source_files_sampled": 16,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "PHP without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "PHP"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/16 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 16,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token",
"No resolved dependencies carried a version and a supported ecosystem"
],
"report_type": "repository",
"generated_at": "2026-07-23T00:03:24.696646Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/rawilk/filament-password-input.svg",
"full_name": "rawilk/filament-password-input",
"license_state": "standard",
"license_spdx": "MIT"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.27.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — Packagist.