Публічний реєстрПомірний
Звіт про здоров'я програмного забезпеченнясхема 0.26.0 · метрики 1.13.0 · 2026-07-22 03:42 UTC
microvn / specpipe
Spec-first development toolkit for agentic AI coding agents — skills + guardrails for Claude Code, Codex, Cursor, Antigravity, and more.
microvn/specpipe має індекс здоров’я 57 зі 100, що відповідає смузі «Помірний». Найвищий показник — Engineering Quality (89/100), найнижчий — Sustainability & Governance (38/100). Останнє оновлення було 4 дні тому. Більшість нещодавньої роботи виконує один учасник.
57
загалом / 100Індекс здоров'я програмного забезпечення
Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.
57
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
Профіль оцінок
Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.
Власність
microvnОсобистий обліковий запис
13 підписників117 публічних репозиторіївз трав. 2014 р.OkLabel
Цей репозиторій належить особистому обліковому запису. Проєкт з єдиним власником несе більший ризик безперервності, ніж підтримуваний організацією.
Пакетні екосистеми
| Реєстр | Пакет | Версія | Завантажень / міс | Версії | Остання публікація | Теги |
|---|---|---|---|---|---|---|
| npm | specpipe | 2.4.1 | 2 543 | 14 | 4 дні тому | aiai-agentscoding-agentclaude-codecodexcursorantigravityspec-firsttddskillsguardrailsdeveloper-tools |
Метрики за категоріями
Життєздатність
Чи живий проєкт — чи пишеться код і чи виходять релізи?
72
Активність розробки
62Помірний
Як обчислюється оцінка
| 36/36 | Свіжість push — останній push 4 дн. тому |
| 8.3/36 | Ритм комітів — 12/52 тижнів із комітами |
| 18/18 | Обсяг комітів — 192 комітів за останній рік |
| 0/10 | OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully |
Використані вхідні дані
| commits_last_year | 192 |
| human_commit_share | 1 |
| days_since_last_push | 4 |
| active_weeks_last_year | 12 |
Дисципліна релізів
88Відмінний
Як обчислюється оцінка
| 16.2/27 | Випускає релізи — 67 тегів версій (без релізів GitHub) |
| 36/36 | Свіжість релізів — останній реліз 4 дн. тому |
| 27/27 | Ритм релізів — реліз кожні ~3,1 дн. |
| 0/10 | OpenSSF Scorecard: Signed-Releases — немає даних |
Використані вхідні дані
| releases_count | 67 |
| latest_release_tag | v2.4.1 |
| releases_from_tags | так |
| days_since_latest_release | 4 |
| mean_days_between_releases | 3,1 |
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Signed-Releases. Залишкові ваги перенормовано.
Спільнота та впровадження
Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?
47
Популярність і впровадження
1Критичний
Як обчислюється оцінка
| 0/60 | Зірки — 2 зірок |
| 0/25 | Форки — 0 форків |
| 0/15 | Спостерігачі — 0 спостерігачів |
Використані вхідні дані
| forks | 0 |
| stars | 2 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | below_threshold |
Здоров'я спільноти
92Відмінний
Як обчислюється оцінка
| 22.5/22.5 | README |
| 22.5/22.5 | Ліцензія — визнана ліцензія (MIT) |
| 18/18 | Настанови CONTRIBUTING |
| 13.5/13.5 | Кодекс поведінки |
| 0/7.2 | Шаблон issue |
| 6.3/6.3 | Шаблон PR |
Використані вхідні дані
| has_readme | так |
| has_license | так |
| has_contributing | так |
| has_issue_template | ні |
| has_code_of_conduct | так |
| has_pull_request_template | так |
Впровадження в екосистемі (завантаження)
57Помірний
Як обчислюється оцінка
| 45.4/80 | Щомісячні завантаження — 2 543 завантажень/місяць у npm |
| 0/20 | Залежні пакети в реєстрі — ця екосистема цього не повідомляє |
Використані вхідні дані
| packages | specpipe |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 2 543 |
Виключено з оцінювання (немає даних або не застосовно): Залежні пакети в реєстрі. Залишкові ваги перенормовано.
Сталість та врядування
Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?
38
Стійкість мейнтейнерів (бас-фактор)
13Критичний
Як обчислюється оцінка
| 9/54 | Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів |
| 0/22.5 | Розподіл комітів — головний контриб’ютор — автор 100% комітів |
| 1.4/13.5 | Широта контриб’юторів — 1 контриб’юторів |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
Використані вхідні дані
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
Реактивність на issue та PR
1Критичний
Як обчислюється оцінка
| 0/46.8 | Вирішення issue — немає issue або даних |
| 0/38.3 | Прийняття PR — немає вирішених pull request-ів або даних |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Використані вхідні дані
| merged_prs | 0 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 0 |
Виключено з оцінювання (немає даних або не застосовно): Вирішення issue, Прийняття PR. Залишкові ваги перенормовано.
Власність та опіка
54Помірний
Як обчислюється оцінка
| 10/30 | Підтримка власника — особистий (користувацький) обліковий запис |
| 0/20 | Верифікований домен — не застосовно до користувацьких облікових записів |
| 8.2/25 | Охоплення власника — 13 підписників у microvn |
| 25/25 | Послужний список — 117 публічних репозиторіїв, вік облікового запису ~12 р. |
Використані вхідні дані
| followers | 13 |
| owner_type | User |
| is_verified | — |
| owner_login | microvn |
| public_repos | 117 |
| account_age_days | 4 442 |
Виключено з оцінювання (немає даних або не застосовно): Верифікований домен. Залишкові ваги перенормовано.
Супровід пакетів
100Відмінний
Як обчислюється оцінка
| 25/25 | Опубліковано й доступно — 1 пакет(ів) у npm |
| 35/35 | Свіжість публікацій — остання публікація 4 дн. тому |
| 20/20 | Історія версій — 14 опублікованих версій |
| 20/20 | Не застарілий — активний, не deprecated і не yanked |
Використані вхідні дані
| packages | specpipe |
| ecosystems | npm |
| any_deprecated | ні |
| min_days_since_publish | 4 |
Інженерна якість
Чи наявні базові інженерні практики та документація?
89
Інженерні практики
88Відмінний
Як обчислюється оцінка
| 24/24 | Процеси CI — 1 процес(ів) CI |
| 24/24 | Наявні тести |
| 16/16 | Конфігурація лінтера — eslint.config.js |
| 0/9.6 | Pre-commit-хуки |
| 6.4/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — немає даних |
Використані вхідні дані
| has_ci | так |
| has_tests | так |
| has_editorconfig | так |
| has_linter_config | так |
| has_precommit_config | ні |
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: CI-Tests. Залишкові ваги перенормовано.
Документація
90Відмінний
Як обчислюється оцінка
| 30/30 | README |
| 25/25 | Каталог документації |
| 15/15 | Сайт документації / домашня сторінка — https://specpipe.vercel.app |
| 10/10 | Опис репозиторію |
| 0/10 | Теми |
| 10/10 | Wiki |
Використані вхідні дані
| topics | — |
| has_wiki | так |
| homepage | https://specpipe.vercel.app |
| has_readme | так |
| has_docs_dir | так |
| has_description | так |
Безпека
Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?
39
Стан безпеки
39У зоні ризику
Як обчислюється оцінка
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — немає даних |
| 0/2.5 | CI-Tests — немає даних |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Ліцензія — license file detected |
| 0/7.5 | Maintained — project was created within the last 90 days. Please review its contents carefully |
| 0/5 | Packaging — немає даних |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — немає даних |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 6/7.5 | Vulnerabilities — 2 existing vulnerabilities detected |
Використані вхідні дані
| source | openssf_scorecard |
| checks_evaluated | 14 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 4 |
| scorecard_aggregate | 3,8 |
Виключено з оцінювання (немає даних або не застосовно): branch_protection, ci_tests, packaging, signed_releases. Залишкові ваги перенормовано.
Готовність до ШІ
Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.
45
Контекст і настанови для агентів
40У зоні ризику
Як обчислюється оцінка
| 0/45 | Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора |
| 0/15 | Машиночитана документація (llms.txt) |
| 40/40 | Читабельна історія комітів — намір зазначено у 99 з 100 людських комітів (структурований заголовок або пояснювальний текст) |
Використані вхідні дані
| has_llms_txt | ні |
| legible_history_share | 0,99 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Цикл верифікації (збірка / тести / перевірка типів)
47У зоні ризику
Як обчислюється оцінка
| 0/18 | Розгортання однією командою |
| 22/22 | Автоматизовані тести |
| 11/11 | Конфігурація лінтера / форматера — eslint.config.js |
| 0/11 | Статична перевірка типів |
| 10/10 | Відтворюване середовище — lockfile |
| 4/10 | Підтверджена практика роботи з агентами — 2 з останніх 100 комітів створено агентом або з його зазначенням |
| 0/8 | Автоматизоване супроводження — автоматичних оновлень залежностей не виявлено |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Використані вхідні дані
| has_nix | ні |
| has_tests | так |
| lockfiles | package-lock.json |
| has_dockerfile | ні |
| typed_language | ні |
| bootstrap_files | — |
| has_devcontainer | ні |
| has_linter_config | так |
| typecheck_configs | — |
| agent_commit_share | 0,02 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Читабельність коду для моделей
55Помірний
Як обчислюється оцінка
| 0/45 | Типізований код — JavaScript без конфігурації перевірки типів |
| 55/55 | Керовані розміри файлів — 0/31 файлів вихідного коду понад 60 КБ |
Використані вхідні дані
| primary_language | JavaScript |
| largest_source_bytes | 49 571 |
| source_files_sampled | 31 |
| oversized_source_files | 0 |
Машиночитні інтерфейси
40У зоні ризику
Як обчислюється оцінка
| 0/40 | Схема API (OpenAPI/GraphQL/proto) |
| 0/20 | Сервер MCP |
| 40/40 | Придатні до запуску приклади — examples |
Використані вхідні дані
| example_dirs | examples |
| has_mcp_signal | ні |
| api_schema_files | — |
Ключові факти
2зірок GitHub
1контриб'юторів
192комітів за останні 12 місяців
4днів від останнього пушу
67релізів
1бас-фактор
0відкритих issue
npmпакетних екосистем
Попередження щодо збору даних
- GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
- deps.dev does not index npm:specpipe@2.4.1; advisories assessed against the repository dependency graph instead
Докладніше
OpenSSF Scorecard 3.8 / 10
3.8сукупно
Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).
| 10 | Binary-Artifacts | no binaries found in the repo |
| н/д | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| н/д | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 0 | Maintained | project was created within the last 90 days. Please review its contents carefully |
| н/д | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| н/д | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 8 | Vulnerabilities | 2 existing vulnerabilities detected |
Прямі залежності 3
| Реєстр | Пакет | Обмеження версії | Маніфест |
|---|---|---|---|
| npm | @clack/prompts | ^1.6.0 | cli/package.json |
| npm | chalk | ^5.4.1 | cli/package.json |
| npm | commander | ^13.1.0 | cli/package.json |
Усі залежності не зібрано
Не вдалося зібрати розв'язаний набір залежностей для цього звіту: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Звіт у форматі JSON машиночитний
{
"data": {
"repo": {
"topics": [],
"is_fork": false,
"size_kb": 1065,
"has_wiki": true,
"homepage": "https://specpipe.vercel.app",
"languages": {
"CSS": 113,
"HTML": 69710,
"Shell": 121558,
"JavaScript": 231596,
"Go Template": 18177
},
"pushed_at": "2026-07-17T08:17:26Z",
"created_at": "2026-06-24T04:50:52Z",
"owner_type": "User",
"updated_at": "2026-07-17T08:17:48Z",
"description": "Spec-first development toolkit for agentic AI coding agents — skills + guardrails for Claude Code, Codex, Cursor, Antigravity, and more.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "JavaScript",
"significant_languages": [
"JavaScript",
"Shell",
"HTML"
]
},
"owner": {
"blog": "https://oklabel.vn/",
"name": null,
"type": "User",
"login": "microvn",
"company": "OkLabel",
"location": null,
"followers": 13,
"avatar_url": "https://avatars.githubusercontent.com/u/7679875?v=4",
"created_at": "2014-05-23T11:40:27Z",
"is_verified": null,
"public_repos": 117,
"account_age_days": 4442
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v2.4.1",
"kind": "patch",
"published_at": "2026-07-17T08:17:22Z"
},
{
"tag": "v2.4.0",
"kind": "minor",
"published_at": "2026-07-17T06:59:21Z"
},
{
"tag": "v2.3.1",
"kind": "patch",
"published_at": "2026-07-06T06:50:10Z"
},
{
"tag": "v2.3.0",
"kind": "minor",
"published_at": "2026-07-06T06:37:04Z"
},
{
"tag": "v2.2.0",
"kind": "minor",
"published_at": "2026-07-02T19:54:15Z"
},
{
"tag": "v2.1.2",
"kind": "patch",
"published_at": "2026-07-02T15:29:39Z"
},
{
"tag": "v2.1.1",
"kind": "patch",
"published_at": "2026-07-02T10:22:19Z"
},
{
"tag": "v2.1.0",
"kind": "minor",
"published_at": "2026-06-30T11:14:46Z"
},
{
"tag": "v2.0.0",
"kind": "major",
"published_at": "2026-06-30T06:44:18Z"
},
{
"tag": "v1.13.1",
"kind": "patch",
"published_at": "2026-06-19T10:05:41Z"
},
{
"tag": "v1.13.0",
"kind": "minor",
"published_at": "2026-06-19T07:09:30Z"
},
{
"tag": "v1.12.2",
"kind": "patch",
"published_at": "2026-06-02T03:10:22Z"
},
{
"tag": "v1.12.1",
"kind": "patch",
"published_at": "2026-05-29T03:11:21Z"
},
{
"tag": "v1.12.0",
"kind": "minor",
"published_at": "2026-05-29T02:43:23Z"
},
{
"tag": "v1.11.4",
"kind": "patch",
"published_at": "2026-05-28T20:20:49Z"
},
{
"tag": "v1.11.3",
"kind": "patch",
"published_at": "2026-05-28T20:05:33Z"
},
{
"tag": "v1.11.2",
"kind": "patch",
"published_at": "2026-05-28T19:43:48Z"
},
{
"tag": "v1.11.1",
"kind": "patch",
"published_at": "2026-05-28T18:56:01Z"
},
{
"tag": "v1.11.0",
"kind": "minor",
"published_at": "2026-05-27T20:01:04Z"
},
{
"tag": "v1.10.2",
"kind": "patch",
"published_at": "2026-05-26T19:19:33Z"
},
{
"tag": "v1.10.1",
"kind": "patch",
"published_at": "2026-05-26T19:07:02Z"
},
{
"tag": "v1.10.0",
"kind": "minor",
"published_at": "2026-05-26T18:52:06Z"
},
{
"tag": "v1.9.2",
"kind": "patch",
"published_at": "2026-05-16T07:45:25Z"
},
{
"tag": "v1.9.1",
"kind": "patch",
"published_at": "2026-05-15T11:12:05Z"
},
{
"tag": "v1.9.0",
"kind": "minor",
"published_at": "2026-05-15T05:12:55Z"
},
{
"tag": "v1.8.11",
"kind": "patch",
"published_at": "2026-05-03T17:22:36Z"
},
{
"tag": "v1.8.10",
"kind": "patch",
"published_at": "2026-05-01T18:55:29Z"
},
{
"tag": "v1.8.9",
"kind": "patch",
"published_at": "2026-05-01T18:49:45Z"
},
{
"tag": "v1.8.8",
"kind": "patch",
"published_at": "2026-04-28T09:28:30Z"
},
{
"tag": "v1.8.7",
"kind": "patch",
"published_at": "2026-04-27T17:04:59Z"
},
{
"tag": "v1.8.6",
"kind": "patch",
"published_at": "2026-04-27T16:40:55Z"
},
{
"tag": "v1.8.5",
"kind": "patch",
"published_at": "2026-04-25T18:50:45Z"
},
{
"tag": "v1.8.4",
"kind": "patch",
"published_at": "2026-04-25T03:11:56Z"
},
{
"tag": "v1.8.3",
"kind": "patch",
"published_at": "2026-04-25T03:03:23Z"
},
{
"tag": "v1.8.2",
"kind": "patch",
"published_at": "2026-04-24T20:09:40Z"
},
{
"tag": "v1.8.1",
"kind": "patch",
"published_at": "2026-04-24T19:45:04Z"
},
{
"tag": "v1.8.0",
"kind": "minor",
"published_at": "2026-04-22T01:52:27Z"
},
{
"tag": "v1.7.3",
"kind": "patch",
"published_at": "2026-04-20T18:25:35Z"
},
{
"tag": "v1.7.2",
"kind": "patch",
"published_at": "2026-04-20T18:19:40Z"
},
{
"tag": "v1.7.1",
"kind": "patch",
"published_at": "2026-04-20T18:17:19Z"
},
{
"tag": "v1.7.0",
"kind": "minor",
"published_at": "2026-04-20T18:11:12Z"
},
{
"tag": "v1.6.0",
"kind": "minor",
"published_at": "2026-04-20T08:11:02Z"
},
{
"tag": "v1.5.9",
"kind": "patch",
"published_at": "2026-04-08T17:26:40Z"
},
{
"tag": "v1.5.8",
"kind": "patch",
"published_at": "2026-04-08T16:47:06Z"
},
{
"tag": "v1.5.7",
"kind": "patch",
"published_at": "2026-04-08T08:27:34Z"
},
{
"tag": "v1.5.6",
"kind": "patch",
"published_at": "2026-04-07T20:03:52Z"
},
{
"tag": "v1.5.5",
"kind": "patch",
"published_at": "2026-04-07T08:13:48Z"
},
{
"tag": "v1.5.4",
"kind": "patch",
"published_at": "2026-04-07T05:04:52Z"
},
{
"tag": "v1.5.3",
"kind": "patch",
"published_at": "2026-04-06T20:08:18Z"
},
{
"tag": "v1.5.2",
"kind": "patch",
"published_at": "2026-04-06T19:44:14Z"
},
{
"tag": "v1.5.1",
"kind": "patch",
"published_at": "2026-04-05T01:15:48Z"
},
{
"tag": "v1.5.0",
"kind": "minor",
"published_at": "2026-04-04T20:48:51Z"
},
{
"tag": "v1.4.12",
"kind": "patch",
"published_at": "2026-04-04T16:44:59Z"
},
{
"tag": "v1.4.11",
"kind": "patch",
"published_at": "2026-04-04T16:30:15Z"
},
{
"tag": "v1.4.10",
"kind": "patch",
"published_at": "2026-04-04T10:45:13Z"
},
{
"tag": "v1.4.9",
"kind": "patch",
"published_at": "2026-04-04T10:37:36Z"
},
{
"tag": "v1.4.8",
"kind": "patch",
"published_at": "2026-04-04T09:50:46Z"
},
{
"tag": "v1.4.7",
"kind": "patch",
"published_at": "2026-04-04T06:40:55Z"
},
{
"tag": "v1.4.6",
"kind": "patch",
"published_at": "2026-04-04T06:35:24Z"
},
{
"tag": "v1.4.5",
"kind": "patch",
"published_at": "2026-04-04T04:14:21Z"
},
{
"tag": "v1.4.4",
"kind": "patch",
"published_at": "2026-04-03T21:10:11Z"
},
{
"tag": "v1.4.3",
"kind": "patch",
"published_at": "2026-04-03T20:49:07Z"
},
{
"tag": "v1.4.2",
"kind": "patch",
"published_at": "2026-04-03T19:05:41Z"
},
{
"tag": "v1.4.1",
"kind": "patch",
"published_at": "2026-04-03T18:53:46Z"
},
{
"tag": "v1.4.0",
"kind": "minor",
"published_at": "2026-04-03T17:52:19Z"
},
{
"tag": "v1.3.5",
"kind": "patch",
"published_at": "2026-04-03T10:01:39Z"
},
{
"tag": "v1.0.1",
"kind": "patch",
"published_at": "2026-06-24T07:39:42Z"
}
],
"recent_commits": [
{
"oid": "8021e4286533009b2b40b414c270807f928e42bf",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.4.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-17T08:17:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db32df9878c8a54b425a249d1bcfe457ed6a8762",
"body": "…loop for role-scoped loading\n\nController no longer reads core-loop.md; each role (controller/subagent/inline)\nloads only its files via the SKILL.md READ MAP.\n\nCo-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>",
"is_bot": false,
"headline": "refactor(sp-build): extract controller-prep + test-command from core-…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-17T08:17:22Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "4ed4d1b418dc8d3c02313dba2fb6313d49ccb729",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.4.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-17T06:59:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e59af428e9555bcfdda800bb600ee8b28ca1feef",
"body": "…es/orchestration/port); add token-discipline + story-size guard + typed signal markers; fix coverage-gate false-block & resume gap",
"is_bot": false,
"headline": "feat(sp-build): split into on-demand files (navigator + core-loop/gat…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-17T06:59:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1b46f71464dc4c39c24fad990177c7d10229d7eb",
"body": "…ility content)",
"is_bot": false,
"headline": "docs(changelog): add 2.3.1 entry (restored sp-build/sp-plan falsifiab…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-06T06:51:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "62e167572fbc8daa4363cc20814f70e89a8250fc",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.3.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-06T06:50:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5ab43f576f356f64012aaa630992565d1d3a68f8",
"body": "…uild/sp-plan\n\nPort the multi-clause constraint decomposition, per-clause falsifiability gate, and reject/accept boundary-pair rules from the installed skills back into the repo source. This content was authored directly against ~/.claude/skills on 2026-07-03 and never mirrored here, so 2.3.0 shipped an older sp-build/sp-plan. This restores it.",
"is_bot": false,
"headline": "fix(skills): restore Constraint-Clause Falsifiability content in sp-b…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-06T06:50:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0258d5472ad394cfcf1453671c2ea1daace21f70",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.3.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-06T06:37:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3196b5e44e5d61886340a7da913a3d0362da6a2d",
"body": "…cal skills\n\nOpenCode is now a supported --agents target (native .opencode/skills + ~/.config/opencode/skills). Canonical kit skills now carry an explicit name: field (Claude spec-compliant), so OpenCode/Cursor reading ~/.claude/skills stop silently skipping the sp-* skills.",
"is_bot": false,
"headline": "feat(agents): add OpenCode as install target + declare name in canoni…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-06T06:37:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "537043a6fe78b858dce0ee839127eb06fc821ad4",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.2.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-02T19:54:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a026b5fdeec662052fb1e991576e7af3c3503413",
"body": "- coverage axis caps the verdict; shallow / self-only maps now FAIL with insufficient coverage instead of reading PASS\n- gate painting extra nodes; never PASS on zero measured; divergence warning now gates the verdict\n- stop swallowing hover/focus failures (skip un-triggered states); wire --strict-s\n[…]\nl == 0\n- capture + diff accent-color, SVG fill/stroke, filter, box-sizing, outline-*\n- 7 new selftest cases + portable references/fidelity.demo\n\nCo-Authored-By: Claude Opus 4.8 <noreply@anthropic.com>",
"is_bot": false,
"headline": "feat(sp-port-webui): fidelity engine coverage-honesty + paint vocabulary",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-02T19:54:14Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "0a74ed1237dde1cf10a30b945cc0156e2bab7bd5",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.1.2",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-02T15:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "525779f71fdac0b39893e5a410d13c5ced674c68",
"body": "…rt-webui",
"is_bot": false,
"headline": "docs(skills): guide sp-build/sp-fix to hand visual-port work to sp-po…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-02T15:29:39Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3bd023d6f496e651e14b473019b89c2f5e86262c",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.1.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-02T10:22:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "101c4094c8b19fc467a3064ff9ab9d5fe92c7a60",
"body": null,
"is_bot": false,
"headline": "feat(skills): add sp-port-webui",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-07-02T10:22:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0a24d636c9fda978152a83d7fd2740b177c5d732",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 2.1.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-30T11:14:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "71cb4374c9a05165fab5bc6ff2df64842f0b5a38",
"body": "Model the operation (entry points, internal seams, external/provider\ncontracts, invariants, optional/absent inputs, unknown semantics) before\nacceptance scenarios so seams and provider contracts aren't lost.\n\n- sp-explore: Phase 0.5 now Core Function Discovery; emits Core Function Model handoff\n- sp\n[…]\nFunction Model Gate + trace step in test design\n- sp-fix / sp-investigate: Core Function Mapping before fix/sibling discovery\n- sp-review: core model trace, provider contract drift, reference accuracy",
"is_bot": false,
"headline": "feat(sp): add Core Function Model across the spec-first pipeline",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-30T11:14:46Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "1e302593f4c9926d3ee396cb45e5402697c0b604",
"body": "Specpipe authors a disciplined loop (spec → code + tests → build pass) once and emits\nit as native skills, guard hooks, and project rules into whichever agent you run:\nClaude Code, Codex, Cursor, Antigravity, OpenClaw, Hermes.\n\nHighlights:\n- Multi-agent install (`init --agents <list>|all`) + interac\n[…]\ntracked skills are never touched.\n\nBREAKING CHANGE: package is `specpipe` (bin specpipe/sp); the self-review hook is removed;\nguards are now \"rules\"; per-agent layout. Migrate with `specpipe upgrade`.",
"is_bot": false,
"headline": "feat!: specpipe 2.0.0 — one spec-first workflow, every AI coding agent",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-30T06:44:18Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "3d7547d38dadacfd15c416a2110a1a6c81636924",
"body": null,
"is_bot": false,
"headline": "chore(release): specpipe 1.0.1 — point npm homepage to landing site",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-24T07:39:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "eace3f076fc2cd85f67f41b7473c0dbe763f79a3",
"body": null,
"is_bot": false,
"headline": "chore: gitignore site/ (Vercel landing page, deployed separately)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-24T06:01:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db3822cf9f5ef0ca2219f7a354635b04ae2e9860",
"body": "…nto docs/\n\n- README 1319 → 411 lines: keep philosophy, quick start, setup, workflows;\n add compact command table + docs index\n- move per-skill reference, hooks, spec format, customization, troubleshooting,\n FAQ into docs/*.md (verbatim)\n- fix FILE_GUARD_THRESHOLD default (350, matches code), dedupe Option D\n- neutralize Claude-specific phrasing in the quick-start transcript",
"is_bot": false,
"headline": "docs: restructure README into a lean landing page + split reference i…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-24T06:01:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e986fe320da6acb93843ea94d3fb532be4bab2be",
"body": "Final public OSS name: specpipe (npm + github.com/microvn/specpipe).\n- skills ap-* → sp-*; CLI command/bin ap→sp, agentpipe→specpipe\n- manifest dir .agentpipe/ → .specpipe/\n- guard files + rules + markers, cover wordmark, docs, shim dependency\n- all tests (78 + cli + hooks + coverage-gate) and lint green",
"is_bot": false,
"headline": "Rebrand agentpipe → specpipe",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-24T04:50:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2c6c932df29ea795f3fb3a5489ef1741131d3cb7",
"body": "Preserve the existing claude-devkit-cli npm audience (~2.4k downloads/mo) across the\nrename to agentpipe instead of stranding them:\n\n- legacy/claude-devkit-cli/: a thin shim (v1.14.0) that depends on agentpipe@^1 and\n forwards the claude-devkit / claude-devkit-cli commands to it, printing a rename\n\n[…]\naunch runbook (publish agentpipe → publish shim → `npm deprecate`\n claude-devkit-cli) + ongoing release steps.\n\nShim verified locally: forwards --version/--help to agentpipe's CLI + shows the notice.",
"is_bot": false,
"headline": "build: legacy claude-devkit-cli redirect shim + release runbook",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-24T03:29:46Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "7beb82fea266148c4136d2a1571447cf770973cc",
"body": "Claude is no longer the only agent that enforces guards. Codex and Cursor get real\nblocking hooks (not just advisory rules):\n\n- Shared guard scripts kit/hooks/agentpipe-shell-guard.sh (blocks wasteful-dir\n exploration + secret access in shell commands; reads .tool_input.command OR .command)\n and a\n[…]\ngents/skills, Antigravity .agent/rules, enforcement tiers).\n\nGuard scripts unit-tested on both Codex- and Cursor-shaped payloads (block/allow).\nnpm test + lint green; all source files under 350 lines.",
"is_bot": false,
"headline": "feat: enforced (blocking) guard hooks for Codex and Cursor",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-23T03:14:12Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "6c9fd06f89b30f6ab3625ba4d066302329e7623a",
"body": "…aims\n\nResearch (cursor.com/docs, developers.openai.com/codex/hooks, agent repos) corrected\ntwo assumptions:\n\n- Cursor has NATIVE skills (.cursor/skills/<n>/SKILL.md, on-demand) — stop converting\n skills into always-on .cursor/rules/*.mdc. Guards stay a .cursor/rules/*.mdc rule.\n (Cursor also read\n[…]\ntill\n emit advisory rules for them today; native hook-enforcement is now a tracked plan.\n Docs/README/CHANGELOG updated to state this accurately (no more \"only agent\" claim).\n\nnpm test + lint green.",
"is_bot": false,
"headline": "fix(cursor): emit native .cursor/skills/ + correct the enforcement cl…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-23T02:30:23Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "6e798255562b2cb955d127b04f8ea94b5e283d9c",
"body": "…refresh)\n\n- [M-1] init now accumulates agents: reads the existing manifest, unions its agents\n with the requested ones, and records every installed agent's files — re-running\n `init --agents X` then `--agents Y` keeps both instead of orphaning X. (mergeAgents)\n- [M-2] upgrade re-merges the Codex \n[…]\ned .agents/skills/ family.\n- Extract adoptExisting → init-adopt.js so all source files stay under the 350 guard.\n\nTests: +M-1 (accumulate + clean remove) +M-2 (upgrade refresh). npm test + lint green.",
"is_bot": false,
"headline": "fix: address mf-review findings (incremental install + upgrade rules …",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-23T01:50:54Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "863406c43bfbd6988f17b06d5eafd649a01ee7c9",
"body": null,
"is_bot": false,
"headline": "chore: prune unused imports (eslint clean, 0 warnings)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T17:10:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "efa89c9a46df1dd84517dd3000b235c52699e979",
"body": "- installer.js (501→212): per-agent install → agent-install.js; Claude global\n install (~/.claude skills/hooks/settings) → claude-global.js. Both re-exported\n from installer.js so callers' imports are unchanged.\n- init.js (533→341): multi-agent install → init-agents.js; global install + manifest\n \n[…]\nw-unused imports.\n\nNo behavior change — every install/lifecycle path verified (default, --agents,\n--global, upgrade, remove). All source files now satisfy the kit's own 350-line guard.\nnpm test green.",
"is_bot": false,
"headline": "refactor: split installer.js and init.js under the 350-line guard",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T17:08:41Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "e4a77cc82b0a167d444247b79e9654957a42b0cd",
"body": "- Expand the shared rules source into full \"operating rules\" (spec-first cycle +\n guardrails + testing discipline + conventions), so non-Claude agents get the same\n project rules Claude gets via CLAUDE.md — not just the guard subset. Emitted as the\n agent's always-on rule (Cursor .mdc, Antigravit\n[…]\nlaw/Hermes doc).\n- docs/architecture.md (artifact taxonomy, registry, emission pipeline, reconcile lifecycle).\n- docs/adding-an-agent.md (the one-entry extension recipe).\n\nnpm test green (all suites).",
"is_bot": false,
"headline": "feat: project-rules parity for non-Claude agents + architecture docs",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T16:55:32Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "efafd61a8f7d5e1f1b87101697e97c36148503f8",
"body": "- LICENSE (MIT), CONTRIBUTING, CODE_OF_CONDUCT, SECURITY, CHANGELOG.\n- .editorconfig, ESLint flat config + Prettier; package.json scripts\n (test aggregator, lint, format) + devDeps + repo/author metadata; version → 1.0.0.\n- GitHub Actions CI: test matrix (Node 18/20/22) + lint; issue/PR templates.\n- Fix test/coverage-gate.sh path after the kit/skills move (was kit/.claude/skills).\n- docs/oss-migration-plan.md as the living roadmap.\n\nAll four suites green via `npm test`.",
"is_bot": false,
"headline": "chore(oss): add OSS hygiene, CI, lint/format, and migration roadmap",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T16:50:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "85b0bfc4ddd4a92557abfa2e3c7bc24681a3891c",
"body": "… formats\n\n- Move canonical skills to agent-neutral kit/skills/ (Claude is now one emit\n target, not the privileged source). Output paths unchanged for Claude.\n- AskUserQuestion: rewrite Claude tool references in non-Claude variants into an\n explicit \"plain-text multiple-choice question\" instructi\n[…]\n.agents/skills/ + AGENTS.md is a shared cross-tool standard (Codex + Antigravity).\n- README: multi-agent framing, Supported agents table, --agents install options.\n\nTests: 66 unit + cli + hooks green.",
"is_bot": false,
"headline": "feat: neutral skill template + capability adaptation + verified agent…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T16:39:09Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "5c02793a570624b9b0dd3b500d1714159a25aa2b",
"body": "…text H1 for SEO",
"is_bot": false,
"headline": "docs(cover): fix connector gradient (userSpaceOnUse), top-left glow, …",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T09:11:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5a4d3c902b8b35b5701832af542fb2f738236d3b",
"body": null,
"is_bot": false,
"headline": "docs(cover): move mint glow to bottom-right corner as ambient bloom",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T08:56:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "156a0f7c5d5f213cc469dbc4b854b21a823c9493",
"body": null,
"is_bot": false,
"headline": "docs(cover): continuous-track stepper + restore mint background glow",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T08:54:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a4af6dd0595eb174ec2fd335e0a3b76657b0258e",
"body": null,
"is_bot": false,
"headline": "docs(cover): drop misaligned chevrons, extend stepper connectors",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T08:40:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c2a8afd47b41b7de85be0d3fd26075e456520c74",
"body": null,
"is_bot": false,
"headline": "docs(readme): add Agentpipe cover banner (spec→pass stepper, SVG)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T08:39:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "087ca932ee3e10afdca7384c47360876cb8d4aae",
"body": null,
"is_bot": false,
"headline": "docs(readme): center title as Agentpipe + cover banner slot",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T08:16:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ddda31fff0240a5acbd454bb9b61247b90df9453",
"body": null,
"is_bot": false,
"headline": "docs: genericize residual \"Claude Code\" in WORKFLOW.md templates intro",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T08:08:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9c04620ed56643573d5ca4a7d5be346eb98f45c0",
"body": "P3: non-Claude skill variants keep the body verbatim but gain a \"Running\noutside Claude Code\" section when the skill declares Claude-specific tools\nin allowed-tools — AskUserQuestion (ask in plain text), Agent/Task (run\ndelegated steps sequentially), mcp__graphatlas (fall back to grep). Skills\nwitho\n[…]\ns P2/P3 done.\nSkill bodies that genuinely describe Claude capabilities are left as-is —\nthe adaptation section explains the gap rather than rewriting them.\n\nTests: 171 cli + 203 hooks + 62 unit green.",
"is_bot": false,
"headline": "feat: capability adaptation (P3) + agent-neutral docs (P4)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T07:20:59Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "7808973496fa61c1485617db7b172a44a1f8904a",
"body": "Claude keeps native hook enforcement; every other agent gets the same guard\nintent as an always-on rule, emitted from one canonical source\n(kit/rules/agentpipe-guards.md):\n\n- Cursor -> .cursor/rules/agentpipe-guards.mdc (alwaysApply: true)\n- Antigravity -> .agents/rules/agentpipe-guards.md (trigge\n[…]\n\n\nOwned rule files flow through computeDesired, so upgrade/remove handle them.\ninit/list now state these are advisory (not hook-enforced) — the honest gap.\n\nTests: 171 cli + 203 hooks + 55 unit green.",
"is_bot": false,
"headline": "feat: per-agent guardrails (P2) — guards as always-on rules",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T07:16:53Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "4afbd015eceed2d41e6e7e2abfe8a99202bb1515",
"body": "upgrade/remove/diff/list are now agent-aware via a reconcile model: each\ncommand computes the desired installed state (computeDesired re-emits every\nagent's files) and reconciles against the manifest, instead of assuming the\nClaude .claude/ layout.\n\n- lib/reconcile.js: computeDesired(agents) + templ\n[…]\ngent layouts; diff/list: desired-state based, list groups by agent\n- init multi-agent records all emitted files in the manifest with hashes\n\nTests: 161 cli (+10 lifecycle) + 203 hooks + 42 unit green.",
"is_bot": false,
"headline": "feat: per-agent lifecycle + neutral manifest location",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T07:10:46Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "e28350f90d0d25cab837126068b495f7b01f2a7c",
"body": "Author skills once in canonical Claude form; emit per-agent variants on\ninstall (path + filename + frontmatter rewritten, body unchanged). New\nagent registry covers Claude, Antigravity, OpenClaw, Hermes, Codex, Cursor\nwith formats verified against each tool's docs/repos (see docs/multi-agent.md).\n\n-\n[…]\nion (cli.sh)\n\nBackward compatible: no --agents behaves exactly as before (203+138 tests green).\nP2 (per-agent hooks) and P3 (capability parity for Task/AskUserQuestion) tracked\nin docs/multi-agent.md.",
"is_bot": false,
"headline": "feat: multi-agent skill emitters + init --agents (P1 foundation)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T06:35:27Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "22c48db87a57f2f749e41d5cb4768af4885f86ef",
"body": "Rename CLI package and binary to agentpipe (alias: ap), and reprefix all\n13 skills from mf-* to ap-*. Broaden positioning from \"Claude Code\" to\n\"agentic AI coding agents\". Pure rename — all 203 tests still pass.",
"is_bot": false,
"headline": "chore: rebrand to agentpipe (claude-devkit-cli → agentpipe, mf-* → ap-*)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-22T06:02:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "01633bd38c53a498c20f4b4e11be21b5761d4545",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.13.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-19T10:05:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "44af791e4dee11637bb3f7a3b1a55f12a65785c3",
"body": "…o ASCII",
"is_bot": false,
"headline": "feat(mf-humanize): ban antithesis and normalize typographic unicode t…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-19T10:05:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "daeae49064664407512a8b6fb01e94733dce258e",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.13.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-19T07:09:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e26668c56cc5041f89581e43dcf9ceabdf27a4c8",
"body": "…m test coverage",
"is_bot": false,
"headline": "feat: greenfield scaffold skill + cross-surface invariant & FE-BE sea…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-19T07:09:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "eab0a032a562aa57597134aabec67fa24d992f6c",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.12.2",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-02T03:10:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3d6accfe494f1f33e889e63b9bfd098922de559f",
"body": null,
"is_bot": false,
"headline": "feat(mf-plan): pin cross-spec linked fields + CC11 coverage check",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-06-02T03:10:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "74949c50dd89377738b11135135a901c292c7aa2",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.12.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-29T03:11:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "384d0b1454fa9ccb90968e6d4c414cf7a6d8c68a",
"body": "Patch refined after voice round 2 (Codex + Gemini consensus on 5 fixes).\n\nmf-explore (UI sketches field):\n- Replaced free-form sketch guidance with structured E/N/X legend + bounded scan protocol\n- 'read' budget defined: ga_* summary = 0 reads, file_summary preview = 0.5, full read = 1, cap 7\n- 3-bl\n[…]\n> Prototype > UI Notes\n\nRisk addressed (voice consensus): false [E] from prototype-as-evidence or skipped verify, which would crash build. Evidence rule + scan discipline + [X] cap close that surface.",
"is_bot": false,
"headline": "feat: G10 — E/N/X legend + bounded UI codebase scan (extends G9)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-29T03:11:20Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "52d6ba81b1dfc9a1d7a9744f52e6711cdbdc69c5",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.12.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-29T02:43:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e1631848a72169f4690d3c5781533d822a5be9a7",
"body": "Adds a structured UI-mockup pipeline through the 3-skill family. Solves the gap where ASCII UI sketches user produces during /mf-explore are lost by /mf-plan (mapping previously folded UI expectation into AS prose, which the no-impl-vocab ban rejects markup from). Result: /mf-build had to guess UI s\n[…]\nA (inline) after clarifying ASCII lives in explore (for human visualization), Component Tree lives in spec (for build consumption) — mf-plan owns the translation per 'consumer owns the map' principle.",
"is_bot": false,
"headline": "feat: G9 — UI Notes channel across mf-explore/mf-plan/mf-build",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-29T02:43:22Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "702264b8d0f8fbc1f87949988f46a703f958a525",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.11.4",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T20:20:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a0f925eed4e42ec4eca953417d0e87dd3021d9a1",
"body": "Skill v1.11.3 introduced G7 (G1-driven AS overage allowed up to 30/10 with justification trail) but the trail's destination was ambiguous — wording said 'in Phase 1 assessment' which has no slot in the Spec Template. Result: real /mf-plan runs put the trail in chat output only, leaving the spec file\n[…]\nen-to-include rule\n- Update G1-vs-T2/CC6 precedence wording: trail goes 'into the spec body's ## Spec Sizing Notes section'\n- Omit the section when stories ≤7 AND AS ≤20 (no overage = no trail needed)",
"is_bot": false,
"headline": "feat(mf-plan): G8 — G7 trail destination = Spec Sizing Notes section",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T20:20:48Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "d58fc909e81cb9704f6292496cfb1742f3013f3d",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.11.3",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T20:05:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8af94b6db5c4022b1bd209b3b89283116bd54d18",
"body": "G7: when G1 (no AS gộp) forces splitting and pushes count past 20, the new AS is NOT bloat — atom count unchanged. T2/CC6 reframed as soft targets: G1-driven overage up to 30 AS / 10 stories allowed when Phase 1 assessment carries justification trail. Hard cap at 30. Priority: G1 always wins > CC5 a\n[…]\nep 2 scope-by-layer\n- New subsection 'G1 vs T2/CC6 precedence' with justification trail format\n- Phase 2 CC6 row: soft target wording + G1-driven overage acceptance\n- Mode C CC6 row: sync with Phase 2",
"is_bot": false,
"headline": "feat(mf-plan): G7 G1-vs-T2/CC6 precedence + scope-by-layer split option",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T20:05:33Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "594cb11873c58854f240467088cc65c2b0167364",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.11.2",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T19:43:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "080457329df017e8ec1dee7c9748610e9a2273ba",
"body": "…s, clean example output",
"is_bot": false,
"headline": "fix(mf-humanize): enforce em-dash ban on every return incl. follow-up…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T19:43:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d4c63f17e9e416ad82d2fa1c5ae91822d0b6e9c1",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.11.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T18:56:01Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0aacc226435a76577f41b2fa39d37e725b844e57",
"body": "G1: forcing-function against AS gộp (no or/Case A-B/mix transition+invariant; no Gap-shell AS)\nG2: CC5 list-and-tick procedure; each C-xxx now ends with explicit (AS-###) or (GAP-###); verify-line does not count\nG3: split-rule precedence — phase before sub-spec split when T1/T2 conflict T5/T6\nG4: ba\n[…]\nCC5 wording\n\nPlus Windows compat:\n- cli/src/commands/init.js: use 'where' on Windows, 'command -v' elsewhere\n- .gitattributes: lock LF for shell scripts + JS hooks (Git Bash on Windows breaks on CRLF)",
"is_bot": false,
"headline": "feat(mf-plan): G1-G6 rule tightening + Windows compat",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-28T18:56:01Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "547ca8a4aca27aeb625377e993dd9ee948f63a6e",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.11.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-27T20:01:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d2a9e939ec2f80d79c9f81ff875da58b3859fed1",
"body": "Add test/coverage-gate.sh: deterministic checks of the gate's behaviour (block/partial/full/leading-zero/fail-safe) plus skill-text guards for the exact grep flags (-owE / -rowhE, no \\b) — two real bugs were caught here. Wire it into publish.sh so it runs before every publish.",
"is_bot": false,
"headline": "test(coverage-gate): regression test for the spec coverage gate",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-27T19:56:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "486e41bec4b267380351765e62da02d4ad72732d",
"body": "When a commit implements a spec story, add a 'Story: S-NNN' footer so /mf-build's coverage gate and resume can find it via git log --grep. Optional — ordinary commits are unchanged.",
"is_bot": false,
"headline": "feat(mf-commit): optional Story footer for spec-story commits",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-27T19:56:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "da024878b4da42107db8ee6146f4feee42eae289",
"body": "Add Auto-Mode: a controller dispatches one subagent per story (clean context, A1-A7), with worktree-isolated parallelism capped at 3 (scaling down by context tier), A4b branch integration + conflict fallback, building/done resume, and a dual gate (verification + spec-signal). Add Phase 3.5 Spec Cove\n[…]\nS/C IDs (tests embed the ID) — the actual coverage guarantee. Anchor the checklist on AS-NNN, not Then-nouns. Reframe the Edge Case Compliance Table as a depth forcing-function distinct from the gate.",
"is_bot": false,
"headline": "feat(mf-build): auto-mode orchestrator + deterministic coverage gate",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-27T19:56:11Z",
"body_truncated": true,
"is_coding_agent": false
},
{
"oid": "ba8b247777e13097c3c8638201091bdd07a123c4",
"body": "Add an Execution block per story (depends_on/parallel_safe/files/autonomous/verify) so /mf-build can order, parallelize and dispatch. Add Scenario Derivation (trigger-gated classes, provenance via Source, gaps for triggered-but-unspecified behaviour) and CC7/CC8/CC9 (execution-block, DAG, provenance). GAP-NNN gains a mandatory status.",
"is_bot": false,
"headline": "feat(mf-plan): per-story execution metadata + honest AS derivation",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-27T19:55:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bf1ea671a6b0695385a52e52a7bee0222bcfced1",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.10.2",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-26T19:19:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bfa02cd57803d41c9a35d07fc0338bc141060ff5",
"body": "…tive test command",
"is_bot": false,
"headline": "chore: remove redundant build-test.sh; mf-build/mf-fix auto-detect na…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-26T19:19:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ee8b53e961a8db7e1d59ca19a908e6fa6fa000cf",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.10.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-26T19:07:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2dbb890907ff47914cb3a02f5ff2c77eee5c2fb",
"body": "…nd README integration section",
"is_bot": false,
"headline": "feat(skills): add GraphAtlas connectivity probe, on-demand reindex, a…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-26T19:07:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "597150e2695753e3b91f4037ca0cbd0360e2347e",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.10.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-26T18:52:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4dc7f5551b59e2517243c35b70b3ec3acda944a2",
"body": null,
"is_bot": false,
"headline": "feat(skills): add mf-humanize for rephrasing AI output to human voice",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-26T18:52:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "236ab43bb2b06b15e1cd8e279e6d66ea63f785dc",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.9.2",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-16T07:45:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "916c960875c3b443295d1a2d010d6b6b0d489f8c",
"body": "- New /mf-md-render skill (SKILL.md + template.html + components.md)\n- Fix: mf-spec-render template.html/components.md were bundled into npm but never in installer manifest, so never installed on user machines\n- Wire docs: CLAUDE.md, WORKFLOW.md, README\n- test/cli.sh: assert aux skill files exist for both render skills",
"is_bot": false,
"headline": "feat(skills): add mf-md-render for generic markdown HTML view",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-16T07:45:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5962b06adb0d8eecffb8c6fcc04beeb84f25dadd",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.9.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-15T11:12:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c7540c867919505b6d2f311c04deca7a71f89108",
"body": null,
"is_bot": false,
"headline": "fix(installer): add mf-spec-render to global skills sync list",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-15T11:12:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "de6014da5c00e17c93c5accbba69d4edf0bd695d",
"body": null,
"is_bot": false,
"headline": "chore: ignore cli/README.md (npm publish artifact)",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-15T05:17:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "540a7ee048870673cf465bcdd6382bd2209170a1",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.9.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-15T05:12:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c64f0ae7265b3d2701101d193f50b621dc1e56a1",
"body": null,
"is_bot": false,
"headline": "feat(skills): add mf-spec-render for HTML spec view",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-15T05:12:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7eace6d138555f952285d649ad41bf3fc6ac3330",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.11",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-03T17:22:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8679889fd723f6681dfb538761415fbab57c0904",
"body": "…pawn",
"is_bot": false,
"headline": "fix(mf-voices): detect gemini CLI OAuth, stop forcing haiku in self-s…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-03T17:22:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c229cc3668d6b7c40828697b183c53b21c88e94d",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.10",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-01T18:55:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c0b16ad125ff9af2167c0c220695dd2c1a87aef4",
"body": null,
"is_bot": false,
"headline": "feat(mf-voices): add trust-folder bypass for codex and gemini CLI",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-01T18:55:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "42f4a1ab8e89c8e99ef41cf252f806a795f25796",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.9",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-05-01T18:49:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "01af85a7346a4fd52f6948b469a6bda0ba4ee46e",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.8",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-28T09:28:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cbd1fa02d69fe22121bc449f531b78285a29e6dd",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.7",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-27T17:04:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "46bf8ebdcfbd7d941ac63467e092fb51d6aeed9d",
"body": "…eprecation",
"is_bot": false,
"headline": "update mf-voices model references — GPT 5.5, Gemini 3.1 Pro pricing/d…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-27T17:04:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f2f8a29459f174b39d555d8fb2124025fd22df5c",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.6",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-27T16:40:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "514325535f85482371ef501df6fecc607bc378e4",
"body": "…eout shim",
"is_bot": false,
"headline": "fix(mf-voices): update model IDs, fix codex/JSON injection, macOS tim…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-27T16:40:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8719f7684ecf4429649a44f5d7911ee3675164c4",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.5",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-25T18:50:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6dce4ff65d3f628b094f4f7563f6410f7b8fa606",
"body": null,
"is_bot": false,
"headline": "docs(skills): rewrite mf-* descriptions with proactive triggers",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-25T18:50:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "927b0ca81a3aaeced2ce80fff802eb310ee2c8cd",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.4",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-25T03:11:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "817ba824bc4695ec2f1b696d3f56e83e02290796",
"body": "…ond-opinion handoff in /mf-review",
"is_bot": false,
"headline": "docs(mf-voices): introduce in WORKFLOW/README/CLAUDE.md and offer sec…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-25T03:11:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ae199fa3fd9b95a26e40ec0a8932ee8f2f61ed6c",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.3",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-25T03:03:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4420a0fe9cd7b5a7db5ccdfb904c37fe9e90ee25",
"body": null,
"is_bot": false,
"headline": "refactor(skills): update mf-voices skill content",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-25T03:03:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "006dc1aa13462da0d9492139450c7dfe8034976b",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.2",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-24T20:09:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c1ebeb811f87b91efd395ef7fc9a2d386e30baf5",
"body": null,
"is_bot": false,
"headline": "feat(skills): add mf-voices multi-LLM review skill",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-24T20:09:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2e6515fdfd820051e2ce6bacf6c8017b4900b7c",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.1",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-24T19:45:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a2dff6c7ea554dc2ab6c98cdd5d58a9587214e7a",
"body": "…ions",
"is_bot": false,
"headline": "feat(mf-review): add interactive triage with bulk + per-finding decis…",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-24T19:45:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "86808a3b23afd929310265c45e40f6cebf78abf5",
"body": null,
"is_bot": false,
"headline": "chore: bump version to 1.8.0",
"author_name": "Microvn",
"author_login": "microvn",
"committed_at": "2026-04-22T01:52:27Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 67,
"commits_last_year": 192,
"latest_release_at": "2026-07-17T08:17:22Z",
"latest_release_tag": "v2.4.1",
"releases_from_tags": true,
"days_since_last_push": 4,
"active_weeks_last_year": 12,
"days_since_latest_release": 4,
"mean_days_between_releases": 3.1
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 100,
"has_issue_template": false,
"has_code_of_conduct": true,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "specpipe",
"exists": true,
"license": "MIT",
"keywords": [
"ai",
"ai-agents",
"coding-agent",
"claude-code",
"codex",
"cursor",
"antigravity",
"spec-first",
"tdd",
"skills",
"guardrails",
"developer-tools"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/specpipe",
"is_deprecated": false,
"latest_version": "2.4.1",
"repository_url": "https://github.com/microvn/specpipe",
"versions_count": 14,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 2543,
"first_published_at": "2026-06-24T04:51:34.407000Z",
"latest_published_at": "2026-07-17T08:17:29.586000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 4
}
]
},
"popularity": {
"forks": 0,
"stars": 2,
"watchers": 0,
"fork_history": {
"days": [],
"complete": true,
"collected": 0,
"total_forks": 0
},
"star_history": {
"days": [
{
"date": "2026-06-30",
"count": 2
}
],
"complete": true,
"collected": 2,
"total_stars": 2
},
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples"
],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 49571,
"source_files_sampled": 31,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"cli/package.json"
],
"advisories": {
"error": null,
"scope": null,
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm"
],
"dependencies": [
{
"name": "@clack/prompts",
"manifest": "cli/package.json",
"ecosystem": "npm",
"version_constraint": "^1.6.0"
},
{
"name": "chalk",
"manifest": "cli/package.json",
"ecosystem": "npm",
"version_constraint": "^5.4.1"
},
{
"name": "commander",
"manifest": "cli/package.json",
"ecosystem": "npm",
"version_constraint": "^13.1.0"
}
],
"all_dependencies": {
"error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"source": null,
"packages": [],
"collected": false,
"truncated": false,
"total_count": null,
"direct_count": null,
"indirect_count": null
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 0,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 0
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "microvn",
"commits": 192,
"avatar_url": "https://avatars.githubusercontent.com/u/7679875?v=4"
}
],
"contributors_sampled": 1,
"top_contributor_share": 1
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"ci.yml"
],
"has_docs_dir": true,
"linter_configs": [
"eslint.config.js"
],
"has_editorconfig": true,
"has_linter_config": true,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 3,
"reason": "project has 1 contributing companies or organizations -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 0,
"reason": "project was created within the last 90 days. Please review its contents carefully",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 8,
"reason": "2 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "8021e4286533009b2b40b414c270807f928e42bf",
"ran_at": "2026-07-22T03:42:55Z",
"aggregate_score": 3.8,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": false
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-17T08:18:03Z",
"oldest_open_prs": [],
"last_merged_pr_at": null,
"ci_last_conclusion": "SUCCESS",
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/microvn/specpipe",
"host": "github.com",
"name": "specpipe",
"owner": "microvn"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 57,
"inputs": {
"security": 39,
"vitality": 72,
"community": 47,
"governance": 38,
"engineering": 89
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 72,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 62,
"inputs": {
"commits_last_year": 192,
"human_commit_share": 1,
"days_since_last_push": 4,
"active_weeks_last_year": 12
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "12/52 weeks with commits",
"points": 8.3,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 12
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "192 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 192
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "project was created within the last 90 days. Please review its contents carefully",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 88,
"inputs": {
"releases_count": 67,
"latest_release_tag": "v2.4.1",
"releases_from_tags": true,
"days_since_latest_release": 4,
"mean_days_between_releases": 3.1
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "67 version tags (no GitHub releases)",
"points": 16.2,
"status": "partial",
"details": [
{
"code": "version_tags_no_releases",
"params": {
"count": 67
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~3.1 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 3.1
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "repository_too_young",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 47,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 0,
"stars": 2,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "below_threshold"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "2 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 2
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "0 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 0
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "excellent",
"name": "Community health",
"note": null,
"notes": [],
"value": 92,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": true,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 13.5,
"status": "met",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 57,
"inputs": {
"packages": [
"specpipe"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 2543
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "2,543 downloads/month across npm",
"points": 45.4,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 2543,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "at_risk",
"name": "Sustainability & Governance",
"value": 38,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 13,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 1,
"top_contributor_share": 1
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 100% of commits",
"points": 0,
"status": "missed",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 100
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "1 contributors",
"points": 1.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 1
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution, PR acceptance. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution",
"pr_acceptance"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 0
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "no decided pull requests or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_decided_prs_or_data",
"params": {}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 54,
"inputs": {
"followers": 13,
"owner_type": "User",
"is_verified": null,
"owner_login": "microvn",
"public_repos": 117,
"account_age_days": 4442
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "13 followers of microvn",
"points": 8.2,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 13,
"login": "microvn"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "117 public repos, account ~12 yr old",
"points": 25,
"status": "met",
"details": [
{
"code": "public_repos",
"params": {
"count": 117
}
},
{
"code": "account_age_years",
"params": {
"years": 12
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"specpipe"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 4
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 4 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 4
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "14 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 14
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "excellent",
"name": "Engineering Quality",
"value": 89,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "excellent",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 88,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": true,
"has_linter_config": true,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "1 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 1
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": "eslint.config.js",
"points": 16,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "eslint.config.js"
}
}
],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 6.4,
"status": "met",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "excellent",
"name": "Documentation",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"topics": [],
"has_wiki": true,
"homepage": "https://specpipe.vercel.app",
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://specpipe.vercel.app",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 39,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"ci_tests",
"packaging",
"signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 39,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 14,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 4,
"scorecard_aggregate": 3.8
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "project was created within the last 90 days. Please review its contents carefully",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "2 existing vulnerabilities detected",
"points": 6,
"status": "partial",
"details": [],
"max_points": 7.5
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 45,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "at_risk",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.99,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "99 of 100 human commits state their intent (structured subject or explanatory body)",
"points": 40,
"status": "met",
"details": [
{
"code": "legible_history",
"params": {
"legible": 99,
"sampled": 100
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "at_risk",
"name": "Verify loop (build / test / typecheck)",
"note": null,
"notes": [],
"value": 47,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [],
"agent_commit_share": 0.02,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": "eslint.config.js",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "eslint.config.js"
}
}
],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "2 of the last 100 commits agent-authored or agent-credited",
"points": 4,
"status": "partial",
"details": [
{
"code": "agent_authored_commits",
"params": {
"count": 2,
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "JavaScript",
"largest_source_bytes": 49571,
"source_files_sampled": 31,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "JavaScript without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "JavaScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/31 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 31,
"oversized": 0
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"deps.dev does not index npm:specpipe@2.4.1; advisories assessed against the repository dependency graph instead"
],
"report_type": "repository",
"generated_at": "2026-07-22T03:42:59.692802Z",
"schema_version": "0.26.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/m/microvn/specpipe.svg",
"full_name": "microvn/specpipe",
"license_state": "standard",
"license_spdx": "MIT"
}Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.
Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.26.0 — повна методологія · вікі метрик.
Як окремий результат виглядає на тлі всього реєстру: сукупна статистика — npm.