Öffentliches RegisterGut
Software-GesundheitsberichtSchema 0.14.0 · Metriken 1.13.0 · 2026-07-18 17:25 UTC
SuperCowPowers / workbench
Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models
SuperCowPowers/workbench erreicht einen Gesundheitsindex von 72 von 100 und liegt damit im Bereich Gut. Am stärksten schneidet es bei Vitality (96/100) ab, am schwächsten bei AI Readiness (44/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
72
gesamt / 100Software-Gesundheitsindex
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
72
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
Bewertungsprofil
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Eigentümerschaft
SuperCowPowersOrganisation
29 Follower13 öffentliche Reposseit März 2014
Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.
Paket-Ökosysteme
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| PyPI | workbench | 0.8.409 | 10.144 | 330 | vor 0 Tagen | sagemakermachine-learningawspythonutilities |
Metriken nach Kategorie
Vitalität
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
96
Entwicklungsaktivität
100Exzellent
Wie die Bewertung erfolgt
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 36/36 | Commit-Rhythmus — 52/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 2.128 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
Verwendete Eingangsdaten
| commits_last_year | 2.128 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 52 |
Release-Disziplin
90Exzellent
Wie die Bewertung erfolgt
| 27/27 | Liefert Releases aus — 100 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 0 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 1,1 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
Verwendete Eingangsdaten
| releases_count | 100 |
| latest_release_tag | v0.8.409 |
| releases_from_tags | nein |
| days_since_latest_release | 0 |
| mean_days_between_releases | 1,1 |
Community & Verbreitung
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
57
Popularität & Verbreitung
34Gefährdet
Wie die Bewertung erfolgt
| 27.6/60 | Stars — 51 Stars |
| 6.5/25 | Forks — 7 Forks |
| 0/15 | Watcher — 2 Watcher |
Verwendete Eingangsdaten
| forks | 7 |
| stars | 51 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community-Gesundheit
77Gut
Wie die Bewertung erfolgt
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 18/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 6.3/6.3 | PR-Vorlage |
Verwendete Eingangsdaten
| has_readme | ja |
| has_license | ja |
| has_contributing | ja |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | ja |
Wie die Bewertung erfolgt
| 53.4/80 | Downloads pro Monat — 10.144 Downloads/Monat über pypi |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
Verwendete Eingangsdaten
| packages | workbench |
| dependents | — |
| ecosystems | pypi |
| total_downloads | — |
| monthly_downloads | 10.144 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.
Nachhaltigkeit & Governance
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
58
Maintainer-Resilienz (Bus-Faktor)
30Gefährdet
Wie die Bewertung erfolgt
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 0.3/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 99 % der Commits |
| 10.8/13.5 | Breite der Beitragenden — 8 Beitragende |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
Verwendete Eingangsdaten
| bus_factor | 1 |
| contributors_sampled | 8 |
| top_contributor_share | 0,986 |
Wie die Bewertung erfolgt
| 28.3/46.8 | Issue-Lösungsquote — 60 % der Issues geschlossen |
| 27.7/38.3 | PR-Annahme — 81/112 entschiedene PRs gemergt |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Verwendete Eingangsdaten
| merged_prs | 81 |
| open_issues | 192 |
| closed_issues | 294 |
| issue_closed_ratio | 0,605 |
| closed_unmerged_prs | 31 |
Eigentümerschaft & Trägerschaft
61Mittel
Wie die Bewertung erfolgt
| 30/30 | Organisatorische Trägerschaft — im Besitz einer Organisation |
| 0/20 | Verifizierte Domain |
| 10.6/25 | Reichweite des Inhabers — 29 Follower von SuperCowPowers |
| 20.3/25 | Kontohistorie — 13 öffentliche Repos, Kontoalter ca. 12 Jahre |
Verwendete Eingangsdaten
| followers | 29 |
| owner_type | Organization |
| is_verified | — |
| owner_login | SuperCowPowers |
| public_repos | 13 |
| account_age_days | 4.513 |
Paketpflege
100Exzellent
Wie die Bewertung erfolgt
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf pypi |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 0 Tagen |
| 20/20 | Versionshistorie — 330 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
Verwendete Eingangsdaten
| packages | workbench |
| ecosystems | pypi |
| any_deprecated | nein |
| min_days_since_publish | 0 |
Engineering-Qualität
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
95
Engineering-Praktiken
92Exzellent
Wie die Bewertung erfolgt
| 24/24 | CI-Workflows — 7 Workflow(s) |
| 24/24 | Tests vorhanden |
| 16/16 | Linter-Konfiguration — .flake8, tox.ini |
| 9.6/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — keine Daten |
Verwendete Eingangsdaten
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | ja |
| has_precommit_config | ja |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: CI-Tests. Die verbleibenden Gewichte wurden renormalisiert.
Dokumentation
100Exzellent
Wie die Bewertung erfolgt
| 30/30 | README |
| 25/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://www.supercowpowers.com |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 7 Topics |
| 10/10 | Wiki |
Verwendete Eingangsdaten
| topics | aws, big-data, machine-learning, python, spark, data-engineering, pandas |
| has_wiki | ja |
| homepage | https://www.supercowpowers.com |
| has_readme | ja |
| has_docs_dir | ja |
| has_description | ja |
Sicherheit
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
50
Sicherheitslage
50Mittel
Wie die Bewertung erfolgt
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — keine Daten |
| 0/2.5 | CI-Tests — keine Daten |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 10 existing vulnerabilities detected |
Verwendete Eingangsdaten
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): branch_protection, ci_tests. Die verbleibenden Gewichte wurden renormalisiert.
AI Readiness
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
44
AI-Agentenkontext & Leitlinien
1Kritisch
Wie die Bewertung erfolgt
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
Verwendete Eingangsdaten
| has_llms_txt | nein |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Lesbare Commit-Historie. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
| 18/18 | Bootstrap mit einem Befehl — Makefile |
| 22/22 | Automatisierte Tests |
| 11/11 | Lint-/Format-Konfiguration — .flake8, tox.ini |
| 0/11 | Statische Typprüfung |
| 10/10 | Reproduzierbare Umgebung — Dockerfile, lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 5/8 | Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Verwendete Eingangsdaten
| has_nix | nein |
| has_tests | ja |
| lockfiles | uv.lock |
| has_dockerfile | ja |
| typed_language | nein |
| bootstrap_files | Makefile |
| has_devcontainer | nein |
| has_linter_config | ja |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Belegte Agentenpraxis. Die verbleibenden Gewichte wurden renormalisiert.
AI-Code-Lesbarkeit für Modelle
55Mittel
Wie die Bewertung erfolgt
| 0/45 | Typprüfbarer Code — Python ohne Typprüfungs-Konfiguration |
| 54.7/55 | Handhabbare Dateigrößen — 4/637 Quelldateien über 60 KB |
Verwendete Eingangsdaten
| primary_language | Python |
| largest_source_bytes | 70.242 |
| source_files_sampled | 637 |
| oversized_source_files | 4 |
Maschinenlesbare AI-Schnittstellen
40Gefährdet
Wie die Bewertung erfolgt
| 0/40 | API-Schema (OpenAPI/GraphQL/proto) |
| 0/20 | MCP-Server |
| 40/40 | Lauffähige Beispiele — examples, notebooks |
Verwendete Eingangsdaten
| example_dirs | examples, notebooks |
| has_mcp_signal | nein |
| api_schema_files | — |
Eckdaten
51GitHub-Sterne
8Mitwirkende
2.128Commits, letzte 12 Monate
0Tage seit letztem Push
100Releases
1Bus-Faktor
192offene Issues
PyPIPaket-Ökosysteme
Weitere Details
OpenSSF Scorecard 5.0 / 10
5.0Gesamtwert
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| k. A. | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| k. A. | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 10 existing vulnerabilities detected |
Direkte Abhängigkeiten 22
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| PyPI | boto3 | >= 1.42.2 | pyproject.toml |
| PyPI | botocore | >= 1.42.2 | pyproject.toml |
| PyPI | awswrangler | >= 3.4.0 | pyproject.toml |
| PyPI | sagemaker | >= 3.6.0, < 3.13 | pyproject.toml |
| PyPI | sagemaker-core | >= 2.12.0, < 2.13 | pyproject.toml |
| PyPI | sagemaker-mlops | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-serve | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-train | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | redis | >= 5.0.1 | pyproject.toml |
| PyPI | cryptography | >= 46.0.0 | pyproject.toml |
| PyPI | requests | >= 2.26.0 | pyproject.toml |
| PyPI | aiobotocore | >= 3.7.0 | pyproject.toml |
| PyPI | pandas | >= 2.2.1, < 3.0 | pyproject.toml |
| PyPI | scikit-learn | >= 1.5.2 | pyproject.toml |
| PyPI | xgboost | >= 3.0.3 | pyproject.toml |
| PyPI | joblib | >= 1.3.2 | pyproject.toml |
| PyPI | rdkit | >= 2026.3.1 | pyproject.toml |
| PyPI | mordredcommunity | >= 2.0.6 | pyproject.toml |
| PyPI | ipython | >= 8.37.0 | pyproject.toml |
| PyPI | pyreadline3 | — | pyproject.toml |
| PyPI | matplotlib | >= 3.9.2 | pyproject.toml |
| PyPI | networkx | >= 3.2 | pyproject.toml |
Alle Abhängigkeiten 295
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 35 direkte und 260 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| PyPI | aiobotocore | 3.7.0 | direkt |
| PyPI | awswrangler | — | direkt |
| PyPI | awswrangler | 3.16.1 | direkt |
| PyPI | boto3 | — | direkt |
| PyPI | boto3 | 1.43.0 | direkt |
| PyPI | botocore | — | direkt |
| PyPI | botocore | 1.43.0 | direkt |
| PyPI | cryptography | 48.0.1 | direkt |
| PyPI | ipython | 8.39.0 | direkt |
| PyPI | ipython | 9.14.1 | direkt |
| PyPI | joblib | — | direkt |
| PyPI | joblib | 1.5.3 | direkt |
| PyPI | matplotlib | 3.10.9 | direkt |
| PyPI | mordredcommunity | — | direkt |
| PyPI | mordredcommunity | 2.0.7 | direkt |
| PyPI | networkx | — | direkt |
| PyPI | networkx | 3.4.2 | direkt |
| PyPI | networkx | 3.6.1 | direkt |
| PyPI | pandas | — | direkt |
| PyPI | pandas | 2.3.3 | direkt |
| PyPI | pyreadline3 | 3.5.6 | direkt |
| PyPI | rdkit | — | direkt |
| PyPI | rdkit | 2026.3.3 | direkt |
| PyPI | redis | 8.0.0 | direkt |
| PyPI | requests | — | direkt |
| PyPI | requests | 2.34.2 | direkt |
| PyPI | sagemaker | 3.12.0 | direkt |
| PyPI | sagemaker-core | 2.12.0 | direkt |
| PyPI | sagemaker-mlops | 1.12.0 | direkt |
| PyPI | sagemaker-serve | 1.12.0 | direkt |
| PyPI | sagemaker-train | 1.12.0 | direkt |
| PyPI | scikit-learn | — | direkt |
| PyPI | scikit-learn | 1.7.2 | direkt |
| PyPI | scikit-learn | 1.9.0 | direkt |
| PyPI | xgboost | 3.2.0 | direkt |
| PyPI | aiohappyeyeballs | 2.6.2 | indirekt |
| PyPI | aiohttp | 3.14.1 | indirekt |
| PyPI | aioitertools | 0.13.0 | indirekt |
| PyPI | aiosignal | 1.4.0 | indirekt |
| PyPI | alembic | 1.18.4 | indirekt |
| PyPI | annotated-doc | 0.0.4 | indirekt |
| PyPI | annotated-types | 0.7.0 | indirekt |
| PyPI | antlr4-python3-runtime | 4.9.3 | indirekt |
| PyPI | anyio | 4.13.0 | indirekt |
| PyPI | asgiref | — | indirekt |
| PyPI | asttokens | 3.0.1 | indirekt |
| PyPI | async-timeout | 5.0.1 | indirekt |
| PyPI | attrs | 26.1.0 | indirekt |
| PyPI | aws-cdk-asset-awscli-v1 | 2.2.282 | indirekt |
| PyPI | aws-cdk-asset-node-proxy-agent-v6 | 2.1.2 | indirekt |
| PyPI | aws-cdk-cloud-assembly-schema | 54.8.0 | indirekt |
| PyPI | aws-cdk-lib | — | indirekt |
| PyPI | aws-cdk-lib | 2.211.0 | indirekt |
| PyPI | aws-cdk-lib | 2.261.0 | indirekt |
| PyPI | babel | 2.18.0 | indirekt |
| PyPI | backrefs | 7.0 | indirekt |
| PyPI | bcrypt | 5.0.0 | indirekt |
| PyPI | black | — | indirekt |
| PyPI | black | 26.5.1 | indirekt |
| PyPI | blinker | 1.9.0 | indirekt |
| PyPI | brotli | 1.2.0 | indirekt |
| PyPI | cachebox | 5.2.3 | indirekt |
| PyPI | cachetools | 6.2.6 | indirekt |
| PyPI | cattrs | 26.1.0 | indirekt |
| PyPI | certifi | 2026.5.20 | indirekt |
| PyPI | cffi | 2.0.0 | indirekt |
| PyPI | charset-normalizer | 3.4.7 | indirekt |
| PyPI | chemprop | — | indirekt |
| PyPI | click | 8.4.1 | indirekt |
| PyPI | cloudpickle | 3.1.2 | indirekt |
| PyPI | colorama | 0.4.6 | indirekt |
| PyPI | colorlog | 6.10.1 | indirekt |
| PyPI | constructs | — | indirekt |
| PyPI | constructs | 10.6.0 | indirekt |
| PyPI | contourpy | 1.3.2 | indirekt |
| PyPI | contourpy | 1.3.3 | indirekt |
| PyPI | coverage | — | indirekt |
| PyPI | coverage | 7.14.1 | indirekt |
| PyPI | cuda-bindings | 13.3.1 | indirekt |
| PyPI | cuda-pathfinder | 1.5.5 | indirekt |
| PyPI | cuda-toolkit | 13.0.2 | indirekt |
| PyPI | cycler | 0.12.1 | indirekt |
| PyPI | dash | 4.2.0 | indirekt |
| PyPI | dash-ag-grid | 35.2.0 | indirekt |
| PyPI | dash-bootstrap-components | 2.0.4 | indirekt |
| PyPI | databricks-sdk | 0.116.0 | indirekt |
| PyPI | decorator | 5.3.1 | indirekt |
| PyPI | deepdiff | 9.1.0 | indirekt |
| PyPI | docker | 7.1.0 | indirekt |
| PyPI | exceptiongroup | 1.3.1 | indirekt |
| PyPI | execnet | 2.1.2 | indirekt |
| PyPI | executing | 2.2.1 | indirekt |
| PyPI | fastapi | — | indirekt |
| PyPI | fastapi | 0.136.3 | indirekt |
| PyPI | filelock | 3.29.3 | indirekt |
| PyPI | flake8 | — | indirekt |
| PyPI | flake8 | 7.3.0 | indirekt |
| PyPI | flask | 3.1.3 | indirekt |
| PyPI | flask-cors | 6.0.5 | indirekt |
| PyPI | flatbuffers | 25.12.19 | indirekt |
| PyPI | fonttools | 4.63.0 | indirekt |
| PyPI | frozenlist | 1.8.0 | indirekt |
| PyPI | fsspec | 2026.4.0 | indirekt |
| PyPI | gevent | 26.5.0 | indirekt |
| PyPI | geventhttpclient | 2.3.9 | indirekt |
| PyPI | ghp-import | 2.1.0 | indirekt |
| PyPI | gitdb | 4.0.12 | indirekt |
| PyPI | gitpython | 3.1.50 | indirekt |
| PyPI | google-auth | 2.53.0 | indirekt |
| PyPI | graphene | 3.4.3 | indirekt |
| PyPI | graphql-core | 3.2.11 | indirekt |
| PyPI | graphql-relay | 3.2.0 | indirekt |
| PyPI | greenlet | 3.3.2 | indirekt |
| PyPI | griffelib | 2.1.0 | indirekt |
| PyPI | gunicorn | 26.0.0 | indirekt |
| PyPI | h11 | 0.16.0 | indirekt |
| PyPI | huey | 3.0.1 | indirekt |
| PyPI | idna | 3.18 | indirekt |
| PyPI | importlib-metadata | 6.11.0 | indirekt |
| PyPI | iniconfig | 2.3.0 | indirekt |
| PyPI | invoke | 3.0.3 | indirekt |
| PyPI | ipython-pygments-lexers | 1.1.1 | indirekt |
| PyPI | itsdangerous | 2.2.0 | indirekt |
| PyPI | janus | 2.0.0 | indirekt |
| PyPI | jedi | 0.20.0 | indirekt |
| PyPI | jinja2 | 3.1.6 | indirekt |
| PyPI | jmespath | 1.1.0 | indirekt |
| PyPI | jsii | 1.138.0 | indirekt |
| PyPI | json5 | 0.14.0 | indirekt |
| PyPI | jsonschema | 4.26.0 | indirekt |
| PyPI | jsonschema-specifications | 2025.9.1 | indirekt |
| PyPI | kiwisolver | 1.5.0 | indirekt |
| PyPI | llvmlite | 0.47.0 | indirekt |
| PyPI | mako | 1.3.12 | indirekt |
| PyPI | markdown | 3.10.2 | indirekt |
| PyPI | markdown-it-py | 4.2.0 | indirekt |
| PyPI | markupsafe | 3.0.3 | indirekt |
| PyPI | matplotlib-inline | 0.2.2 | indirekt |
| PyPI | mccabe | 0.7.0 | indirekt |
| PyPI | mdurl | 0.1.2 | indirekt |
| PyPI | mergedeep | 1.3.4 | indirekt |
| PyPI | mkdocs | 1.6.1 | indirekt |
| PyPI | mkdocs-autorefs | 1.4.4 | indirekt |
| PyPI | mkdocs-get-deps | 0.2.2 | indirekt |
| PyPI | mkdocs-material | 9.7.7 | indirekt |
| PyPI | mkdocs-material-extensions | 1.3.1 | indirekt |
| PyPI | mkdocstrings | 1.0.6 | indirekt |
| PyPI | mkdocstrings-python | 2.0.5 | indirekt |
| PyPI | ml-dtypes | 0.5.4 | indirekt |
| PyPI | mlflow | 3.13.0 | indirekt |
| PyPI | mlflow-skinny | 3.13.0 | indirekt |
| PyPI | mlflow-tracing | 3.13.0 | indirekt |
| PyPI | mmh3 | 5.2.1 | indirekt |
| PyPI | mock | 4.0.3 | indirekt |
| PyPI | mpmath | 1.3.0 | indirekt |
| PyPI | msgpack | 1.2.1 | indirekt |
| PyPI | multidict | 6.7.1 | indirekt |
| PyPI | mypy-extensions | 1.1.0 | indirekt |
| PyPI | narwhals | 2.22.1 | indirekt |
| PyPI | nest-asyncio | 1.6.0 | indirekt |
| PyPI | numba | 0.65.1 | indirekt |
| PyPI | numpy | 2.2.6 | indirekt |
| PyPI | numpy | 2.4.6 | indirekt |
| PyPI | nvidia-cublas | 13.1.1.3 | indirekt |
| PyPI | nvidia-cuda-cupti | 13.0.85 | indirekt |
| PyPI | nvidia-cuda-nvrtc | 13.0.88 | indirekt |
| PyPI | nvidia-cuda-runtime | 13.0.96 | indirekt |
| PyPI | nvidia-cudnn-cu13 | 9.20.0.48 | indirekt |
| PyPI | nvidia-cufft | 12.0.0.61 | indirekt |
| PyPI | nvidia-cufile | 1.15.1.6 | indirekt |
| PyPI | nvidia-curand | 10.4.0.35 | indirekt |
| PyPI | nvidia-cusolver | 12.0.4.66 | indirekt |
| PyPI | nvidia-cusparse | 12.6.3.3 | indirekt |
| PyPI | nvidia-cusparselt-cu13 | 0.8.1 | indirekt |
| PyPI | nvidia-nccl-cu12 | 2.30.7 | indirekt |
| PyPI | nvidia-nccl-cu13 | 2.29.7 | indirekt |
| PyPI | nvidia-nvjitlink | 13.0.88 | indirekt |
| PyPI | nvidia-nvshmem-cu13 | 3.4.5 | indirekt |
| PyPI | nvidia-nvtx | 13.0.85 | indirekt |
| PyPI | omegaconf | 2.3.0 | indirekt |
| PyPI | onnx | 1.22.0 | indirekt |
| PyPI | onnxruntime | 1.24.3 | indirekt |
| PyPI | onnxruntime | 1.26.0 | indirekt |
| PyPI | opentelemetry-api | 1.42.1 | indirekt |
| PyPI | opentelemetry-proto | 1.42.1 | indirekt |
| PyPI | opentelemetry-sdk | 1.42.1 | indirekt |
| PyPI | opentelemetry-semantic-conventions | 0.63b1 | indirekt |
| PyPI | optuna | 4.9.0 | indirekt |
| PyPI | orderly-set | 5.5.0 | indirekt |
| PyPI | packaging | 26.2 | indirekt |
| PyPI | paginate | 0.5.7 | indirekt |
| PyPI | paramiko | 5.0.0 | indirekt |
| PyPI | parso | 0.8.7 | indirekt |
| PyPI | pathspec | 1.1.1 | indirekt |
| PyPI | pexpect | 4.9.0 | indirekt |
| PyPI | pillow | 12.2.0 | indirekt |
| PyPI | platformdirs | 4.10.0 | indirekt |
| PyPI | plotly | 6.8.0 | indirekt |
| PyPI | pluggy | 1.6.0 | indirekt |
| PyPI | prettytable | 3.17.0 | indirekt |
| PyPI | prompt-toolkit | 3.0.52 | indirekt |
| PyPI | propcache | 0.5.2 | indirekt |
| PyPI | protobuf | 6.33.6 | indirekt |
| PyPI | psutil | 7.2.2 | indirekt |
| PyPI | ptyprocess | 0.7.0 | indirekt |
| PyPI | publication | 0.0.3 | indirekt |
| PyPI | pure-eval | 0.2.3 | indirekt |
| PyPI | pyarrow | 24.0.0 | indirekt |
| PyPI | pyasn1 | 0.6.3 | indirekt |
| PyPI | pyasn1-modules | 0.4.2 | indirekt |
| PyPI | pycodestyle | 2.14.0 | indirekt |
| PyPI | pycparser | 3.0 | indirekt |
| PyPI | pydantic | 2.13.4 | indirekt |
| PyPI | pydantic-core | 2.46.4 | indirekt |
| PyPI | pyflakes | 3.4.0 | indirekt |
| PyPI | pygments | 2.20.0 | indirekt |
| PyPI | pyiceberg | 0.11.1 | indirekt |
| PyPI | pymdown-extensions | 11.0.1 | indirekt |
| PyPI | pynacl | 1.6.2 | indirekt |
| PyPI | pynndescent | 0.6.0 | indirekt |
| PyPI | pyparsing | 3.3.2 | indirekt |
| PyPI | pyroaring | 1.1.0 | indirekt |
| PyPI | pytest | — | indirekt |
| PyPI | pytest | 9.0.3 | indirekt |
| PyPI | pytest-cov | — | indirekt |
| PyPI | pytest-cov | 7.1.0 | indirekt |
| PyPI | pytest-sugar | — | indirekt |
| PyPI | pytest-sugar | 1.1.1 | indirekt |
| PyPI | pytest-xdist | 3.8.0 | indirekt |
| PyPI | python-dateutil | 2.9.0.post0 | indirekt |
| PyPI | python-dotenv | 1.2.2 | indirekt |
| PyPI | python-rapidjson | 1.23 | indirekt |
| PyPI | pytokens | 0.4.1 | indirekt |
| PyPI | pytz | 2026.2 | indirekt |
| PyPI | pywin32 | 312 | indirekt |
| PyPI | pyyaml | 6.0.3 | indirekt |
| PyPI | pyyaml-env-tag | 1.1 | indirekt |
| PyPI | ray | 2.56.0 | indirekt |
| PyPI | referencing | 0.37.0 | indirekt |
| PyPI | retrying | 1.4.2 | indirekt |
| PyPI | rich | 14.3.4 | indirekt |
| PyPI | rpds-py | 0.30.0 | indirekt |
| PyPI | rpds-py | 2026.5.1 | indirekt |
| PyPI | s3fs | 2026.4.0 | indirekt |
| PyPI | s3transfer | 0.17.1 | indirekt |
| PyPI | sagemaker-mlflow | 0.4.0 | indirekt |
| PyPI | sagemaker-schema-inference-artifacts | 0.0.5 | indirekt |
| PyPI | schema | 0.7.8 | indirekt |
| PyPI | scipy | 1.15.3 | indirekt |
| PyPI | scipy | 1.17.1 | indirekt |
| PyPI | setuptools | 81.0.0 | indirekt |
| PyPI | shap | — | indirekt |
| PyPI | six | 1.17.0 | indirekt |
| PyPI | skops | 0.14.0 | indirekt |
| PyPI | smdebug-rulesconfig | 1.0.1 | indirekt |
| PyPI | smmap | 5.0.3 | indirekt |
| PyPI | sqlalchemy | 2.0.50 | indirekt |
| PyPI | sqlparse | 0.5.5 | indirekt |
| PyPI | stack-data | 0.6.3 | indirekt |
| PyPI | starlette | 1.3.1 | indirekt |
| PyPI | strictyaml | 1.7.3 | indirekt |
| PyPI | sympy | 1.14.0 | indirekt |
| PyPI | tblib | 3.2.2 | indirekt |
| PyPI | tenacity | 9.1.4 | indirekt |
| PyPI | tensorboardx | 2.6.5 | indirekt |
| PyPI | termcolor | 3.3.0 | indirekt |
| PyPI | threadpoolctl | 3.6.0 | indirekt |
| PyPI | tomli | 2.4.1 | indirekt |
| PyPI | torch | — | indirekt |
| PyPI | torch | 2.12.0 | indirekt |
| PyPI | tqdm | — | indirekt |
| PyPI | tqdm | 4.68.2 | indirekt |
| PyPI | traitlets | 5.15.1 | indirekt |
| PyPI | triton | 3.7.0 | indirekt |
| PyPI | tritonclient | 2.69.0 | indirekt |
| PyPI | typeguard | 2.13.3 | indirekt |
| PyPI | typing-extensions | 4.15.0 | indirekt |
| PyPI | typing-inspection | 0.4.2 | indirekt |
| PyPI | tzdata | 2026.2 | indirekt |
| PyPI | umap-learn | — | indirekt |
| PyPI | umap-learn | 0.5.12 | indirekt |
| PyPI | urllib3 | 2.7.0 | indirekt |
| PyPI | uvicorn | — | indirekt |
| PyPI | uvicorn | 0.49.0 | indirekt |
| PyPI | waitress | 3.0.2 | indirekt |
| PyPI | watchdog | 6.0.0 | indirekt |
| PyPI | wcwidth | 0.8.1 | indirekt |
| PyPI | werkzeug | 3.1.8 | indirekt |
| PyPI | wrapt | 2.2.1 | indirekt |
| PyPI | xgboost-cpu | — | indirekt |
| PyPI | yarl | 1.24.2 | indirekt |
| PyPI | zipp | 4.1.0 | indirekt |
| PyPI | zope-event | 6.2 | indirekt |
| PyPI | zope-interface | 8.5 | indirekt |
| PyPI | zstandard | 0.25.0 | indirekt |
JSON-Rohbericht maschinenlesbar
{
"data": {
"repo": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"is_fork": false,
"size_kb": 91631,
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"languages": {
"CSS": 62868,
"Shell": 29010,
"Python": 3687778,
"Makefile": 971,
"Batchfile": 874,
"Dockerfile": 12108,
"JavaScript": 46472,
"Jupyter Notebook": 81119
},
"pushed_at": "2026-07-18T17:24:31Z",
"created_at": "2022-12-06T17:41:31Z",
"owner_type": "Organization",
"updated_at": "2026-07-18T17:24:34Z",
"description": "Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://www.supercowpowers.com",
"name": "SuperCowPowers",
"type": "Organization",
"login": "SuperCowPowers",
"company": null,
"location": "United States of America",
"followers": 29,
"avatar_url": "https://avatars.githubusercontent.com/u/6900187?v=4",
"created_at": "2014-03-09T18:36:12Z",
"is_verified": null,
"public_repos": 13,
"account_age_days": 4513
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 100,
"commits_last_year": 2128,
"latest_release_at": "2026-07-18T17:24:11Z",
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 52,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 75,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "workbench",
"exists": true,
"license": null,
"keywords": [
"SageMaker",
"Machine Learning",
"AWS",
"Python",
"Utilities",
"Development Status :: 4 - Beta",
"Programming Language :: Python :: 3.10",
"Programming Language :: Python :: 3.11",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Topic :: Scientific/Engineering"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/workbench/",
"is_deprecated": false,
"latest_version": "0.8.409",
"repository_url": "https://github.com/SuperCowPowers/workbench",
"versions_count": 330,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 10144,
"first_published_at": "2014-07-08T00:59:42.285343Z",
"latest_published_at": "2026-07-18T17:24:07.930211Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 7,
"stars": 51,
"watchers": 2,
"open_issues_and_prs": 192
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples",
"notebooks"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"lambda_layers/requirements.txt",
"pyproject.toml",
"tests/requirements-dev.txt"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "boto3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "botocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "awswrangler",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.4.0"
},
{
"name": "sagemaker",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.6.0, < 3.13"
},
{
"name": "sagemaker-core",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.12.0, < 2.13"
},
{
"name": "sagemaker-mlops",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-serve",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-train",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "redis",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 5.0.1"
},
{
"name": "cryptography",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 46.0.0"
},
{
"name": "requests",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.26.0"
},
{
"name": "aiobotocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.7.0"
},
{
"name": "pandas",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.2.1, < 3.0"
},
{
"name": "scikit-learn",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.5.2"
},
{
"name": "xgboost",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.0.3"
},
{
"name": "joblib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.3.2"
},
{
"name": "rdkit",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2026.3.1"
},
{
"name": "mordredcommunity",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.0.6"
},
{
"name": "ipython",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 8.37.0"
},
{
"name": "pyreadline3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": null
},
{
"name": "matplotlib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.9.2"
},
{
"name": "networkx",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.2"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "aiobotocore",
"direct": true,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": "3.16.1",
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "cryptography",
"direct": true,
"version": "48.0.1",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "8.39.0",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "9.14.1",
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": "1.5.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib",
"direct": true,
"version": "3.10.9",
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": "2.0.7",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.4.2",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.6.1",
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": "2.3.3",
"ecosystem": "pypi"
},
{
"name": "pyreadline3",
"direct": true,
"version": "3.5.6",
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": "2026.3.3",
"ecosystem": "pypi"
},
{
"name": "redis",
"direct": true,
"version": "8.0.0",
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": "2.34.2",
"ecosystem": "pypi"
},
{
"name": "sagemaker",
"direct": true,
"version": "3.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-core",
"direct": true,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlops",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-serve",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-train",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.7.2",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "xgboost",
"direct": true,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "aiohappyeyeballs",
"direct": false,
"version": "2.6.2",
"ecosystem": "pypi"
},
{
"name": "aiohttp",
"direct": false,
"version": "3.14.1",
"ecosystem": "pypi"
},
{
"name": "aioitertools",
"direct": false,
"version": "0.13.0",
"ecosystem": "pypi"
},
{
"name": "aiosignal",
"direct": false,
"version": "1.4.0",
"ecosystem": "pypi"
},
{
"name": "alembic",
"direct": false,
"version": "1.18.4",
"ecosystem": "pypi"
},
{
"name": "annotated-doc",
"direct": false,
"version": "0.0.4",
"ecosystem": "pypi"
},
{
"name": "annotated-types",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "antlr4-python3-runtime",
"direct": false,
"version": "4.9.3",
"ecosystem": "pypi"
},
{
"name": "anyio",
"direct": false,
"version": "4.13.0",
"ecosystem": "pypi"
},
{
"name": "asgiref",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "asttokens",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "async-timeout",
"direct": false,
"version": "5.0.1",
"ecosystem": "pypi"
},
{
"name": "attrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-awscli-v1",
"direct": false,
"version": "2.2.282",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-node-proxy-agent-v6",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-cloud-assembly-schema",
"direct": false,
"version": "54.8.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.211.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.261.0",
"ecosystem": "pypi"
},
{
"name": "babel",
"direct": false,
"version": "2.18.0",
"ecosystem": "pypi"
},
{
"name": "backrefs",
"direct": false,
"version": "7.0",
"ecosystem": "pypi"
},
{
"name": "bcrypt",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": "26.5.1",
"ecosystem": "pypi"
},
{
"name": "blinker",
"direct": false,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "brotli",
"direct": false,
"version": "1.2.0",
"ecosystem": "pypi"
},
{
"name": "cachebox",
"direct": false,
"version": "5.2.3",
"ecosystem": "pypi"
},
{
"name": "cachetools",
"direct": false,
"version": "6.2.6",
"ecosystem": "pypi"
},
{
"name": "cattrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "certifi",
"direct": false,
"version": "2026.5.20",
"ecosystem": "pypi"
},
{
"name": "cffi",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "charset-normalizer",
"direct": false,
"version": "3.4.7",
"ecosystem": "pypi"
},
{
"name": "chemprop",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "click",
"direct": false,
"version": "8.4.1",
"ecosystem": "pypi"
},
{
"name": "cloudpickle",
"direct": false,
"version": "3.1.2",
"ecosystem": "pypi"
},
{
"name": "colorama",
"direct": false,
"version": "0.4.6",
"ecosystem": "pypi"
},
{
"name": "colorlog",
"direct": false,
"version": "6.10.1",
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": "10.6.0",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.2",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.3",
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": "7.14.1",
"ecosystem": "pypi"
},
{
"name": "cuda-bindings",
"direct": false,
"version": "13.3.1",
"ecosystem": "pypi"
},
{
"name": "cuda-pathfinder",
"direct": false,
"version": "1.5.5",
"ecosystem": "pypi"
},
{
"name": "cuda-toolkit",
"direct": false,
"version": "13.0.2",
"ecosystem": "pypi"
},
{
"name": "cycler",
"direct": false,
"version": "0.12.1",
"ecosystem": "pypi"
},
{
"name": "dash",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-ag-grid",
"direct": false,
"version": "35.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-bootstrap-components",
"direct": false,
"version": "2.0.4",
"ecosystem": "pypi"
},
{
"name": "databricks-sdk",
"direct": false,
"version": "0.116.0",
"ecosystem": "pypi"
},
{
"name": "decorator",
"direct": false,
"version": "5.3.1",
"ecosystem": "pypi"
},
{
"name": "deepdiff",
"direct": false,
"version": "9.1.0",
"ecosystem": "pypi"
},
{
"name": "docker",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "exceptiongroup",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "execnet",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "executing",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": "0.136.3",
"ecosystem": "pypi"
},
{
"name": "filelock",
"direct": false,
"version": "3.29.3",
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": "7.3.0",
"ecosystem": "pypi"
},
{
"name": "flask",
"direct": false,
"version": "3.1.3",
"ecosystem": "pypi"
},
{
"name": "flask-cors",
"direct": false,
"version": "6.0.5",
"ecosystem": "pypi"
},
{
"name": "flatbuffers",
"direct": false,
"version": "25.12.19",
"ecosystem": "pypi"
},
{
"name": "fonttools",
"direct": false,
"version": "4.63.0",
"ecosystem": "pypi"
},
{
"name": "frozenlist",
"direct": false,
"version": "1.8.0",
"ecosystem": "pypi"
},
{
"name": "fsspec",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "gevent",
"direct": false,
"version": "26.5.0",
"ecosystem": "pypi"
},
{
"name": "geventhttpclient",
"direct": false,
"version": "2.3.9",
"ecosystem": "pypi"
},
{
"name": "ghp-import",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gitdb",
"direct": false,
"version": "4.0.12",
"ecosystem": "pypi"
},
{
"name": "gitpython",
"direct": false,
"version": "3.1.50",
"ecosystem": "pypi"
},
{
"name": "google-auth",
"direct": false,
"version": "2.53.0",
"ecosystem": "pypi"
},
{
"name": "graphene",
"direct": false,
"version": "3.4.3",
"ecosystem": "pypi"
},
{
"name": "graphql-core",
"direct": false,
"version": "3.2.11",
"ecosystem": "pypi"
},
{
"name": "graphql-relay",
"direct": false,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "greenlet",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "griffelib",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gunicorn",
"direct": false,
"version": "26.0.0",
"ecosystem": "pypi"
},
{
"name": "h11",
"direct": false,
"version": "0.16.0",
"ecosystem": "pypi"
},
{
"name": "huey",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "idna",
"direct": false,
"version": "3.18",
"ecosystem": "pypi"
},
{
"name": "importlib-metadata",
"direct": false,
"version": "6.11.0",
"ecosystem": "pypi"
},
{
"name": "iniconfig",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "invoke",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "ipython-pygments-lexers",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "itsdangerous",
"direct": false,
"version": "2.2.0",
"ecosystem": "pypi"
},
{
"name": "janus",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "jedi",
"direct": false,
"version": "0.20.0",
"ecosystem": "pypi"
},
{
"name": "jinja2",
"direct": false,
"version": "3.1.6",
"ecosystem": "pypi"
},
{
"name": "jmespath",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "jsii",
"direct": false,
"version": "1.138.0",
"ecosystem": "pypi"
},
{
"name": "json5",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema",
"direct": false,
"version": "4.26.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema-specifications",
"direct": false,
"version": "2025.9.1",
"ecosystem": "pypi"
},
{
"name": "kiwisolver",
"direct": false,
"version": "1.5.0",
"ecosystem": "pypi"
},
{
"name": "llvmlite",
"direct": false,
"version": "0.47.0",
"ecosystem": "pypi"
},
{
"name": "mako",
"direct": false,
"version": "1.3.12",
"ecosystem": "pypi"
},
{
"name": "markdown",
"direct": false,
"version": "3.10.2",
"ecosystem": "pypi"
},
{
"name": "markdown-it-py",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "markupsafe",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib-inline",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mccabe",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "mdurl",
"direct": false,
"version": "0.1.2",
"ecosystem": "pypi"
},
{
"name": "mergedeep",
"direct": false,
"version": "1.3.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs",
"direct": false,
"version": "1.6.1",
"ecosystem": "pypi"
},
{
"name": "mkdocs-autorefs",
"direct": false,
"version": "1.4.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs-get-deps",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material",
"direct": false,
"version": "9.7.7",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material-extensions",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings",
"direct": false,
"version": "1.0.6",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings-python",
"direct": false,
"version": "2.0.5",
"ecosystem": "pypi"
},
{
"name": "ml-dtypes",
"direct": false,
"version": "0.5.4",
"ecosystem": "pypi"
},
{
"name": "mlflow",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-skinny",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-tracing",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mmh3",
"direct": false,
"version": "5.2.1",
"ecosystem": "pypi"
},
{
"name": "mock",
"direct": false,
"version": "4.0.3",
"ecosystem": "pypi"
},
{
"name": "mpmath",
"direct": false,
"version": "1.3.0",
"ecosystem": "pypi"
},
{
"name": "msgpack",
"direct": false,
"version": "1.2.1",
"ecosystem": "pypi"
},
{
"name": "multidict",
"direct": false,
"version": "6.7.1",
"ecosystem": "pypi"
},
{
"name": "mypy-extensions",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "narwhals",
"direct": false,
"version": "2.22.1",
"ecosystem": "pypi"
},
{
"name": "nest-asyncio",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "numba",
"direct": false,
"version": "0.65.1",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.2.6",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.4.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-cublas",
"direct": false,
"version": "13.1.1.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-cupti",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-nvrtc",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-runtime",
"direct": false,
"version": "13.0.96",
"ecosystem": "pypi"
},
{
"name": "nvidia-cudnn-cu13",
"direct": false,
"version": "9.20.0.48",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufft",
"direct": false,
"version": "12.0.0.61",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufile",
"direct": false,
"version": "1.15.1.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-curand",
"direct": false,
"version": "10.4.0.35",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusolver",
"direct": false,
"version": "12.0.4.66",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparse",
"direct": false,
"version": "12.6.3.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparselt-cu13",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu12",
"direct": false,
"version": "2.30.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu13",
"direct": false,
"version": "2.29.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvjitlink",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvshmem-cu13",
"direct": false,
"version": "3.4.5",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvtx",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "omegaconf",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "onnx",
"direct": false,
"version": "1.22.0",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.24.3",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.26.0",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-api",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-proto",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-sdk",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-semantic-conventions",
"direct": false,
"version": "0.63b1",
"ecosystem": "pypi"
},
{
"name": "optuna",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "orderly-set",
"direct": false,
"version": "5.5.0",
"ecosystem": "pypi"
},
{
"name": "packaging",
"direct": false,
"version": "26.2",
"ecosystem": "pypi"
},
{
"name": "paginate",
"direct": false,
"version": "0.5.7",
"ecosystem": "pypi"
},
{
"name": "paramiko",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "parso",
"direct": false,
"version": "0.8.7",
"ecosystem": "pypi"
},
{
"name": "pathspec",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pexpect",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "pillow",
"direct": false,
"version": "12.2.0",
"ecosystem": "pypi"
},
{
"name": "platformdirs",
"direct": false,
"version": "4.10.0",
"ecosystem": "pypi"
},
{
"name": "plotly",
"direct": false,
"version": "6.8.0",
"ecosystem": "pypi"
},
{
"name": "pluggy",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "prettytable",
"direct": false,
"version": "3.17.0",
"ecosystem": "pypi"
},
{
"name": "prompt-toolkit",
"direct": false,
"version": "3.0.52",
"ecosystem": "pypi"
},
{
"name": "propcache",
"direct": false,
"version": "0.5.2",
"ecosystem": "pypi"
},
{
"name": "protobuf",
"direct": false,
"version": "6.33.6",
"ecosystem": "pypi"
},
{
"name": "psutil",
"direct": false,
"version": "7.2.2",
"ecosystem": "pypi"
},
{
"name": "ptyprocess",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "publication",
"direct": false,
"version": "0.0.3",
"ecosystem": "pypi"
},
{
"name": "pure-eval",
"direct": false,
"version": "0.2.3",
"ecosystem": "pypi"
},
{
"name": "pyarrow",
"direct": false,
"version": "24.0.0",
"ecosystem": "pypi"
},
{
"name": "pyasn1",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "pyasn1-modules",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "pycodestyle",
"direct": false,
"version": "2.14.0",
"ecosystem": "pypi"
},
{
"name": "pycparser",
"direct": false,
"version": "3.0",
"ecosystem": "pypi"
},
{
"name": "pydantic",
"direct": false,
"version": "2.13.4",
"ecosystem": "pypi"
},
{
"name": "pydantic-core",
"direct": false,
"version": "2.46.4",
"ecosystem": "pypi"
},
{
"name": "pyflakes",
"direct": false,
"version": "3.4.0",
"ecosystem": "pypi"
},
{
"name": "pygments",
"direct": false,
"version": "2.20.0",
"ecosystem": "pypi"
},
{
"name": "pyiceberg",
"direct": false,
"version": "0.11.1",
"ecosystem": "pypi"
},
{
"name": "pymdown-extensions",
"direct": false,
"version": "11.0.1",
"ecosystem": "pypi"
},
{
"name": "pynacl",
"direct": false,
"version": "1.6.2",
"ecosystem": "pypi"
},
{
"name": "pynndescent",
"direct": false,
"version": "0.6.0",
"ecosystem": "pypi"
},
{
"name": "pyparsing",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "pyroaring",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": "9.0.3",
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pytest-xdist",
"direct": false,
"version": "3.8.0",
"ecosystem": "pypi"
},
{
"name": "python-dateutil",
"direct": false,
"version": "2.9.0.post0",
"ecosystem": "pypi"
},
{
"name": "python-dotenv",
"direct": false,
"version": "1.2.2",
"ecosystem": "pypi"
},
{
"name": "python-rapidjson",
"direct": false,
"version": "1.23",
"ecosystem": "pypi"
},
{
"name": "pytokens",
"direct": false,
"version": "0.4.1",
"ecosystem": "pypi"
},
{
"name": "pytz",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "pywin32",
"direct": false,
"version": "312",
"ecosystem": "pypi"
},
{
"name": "pyyaml",
"direct": false,
"version": "6.0.3",
"ecosystem": "pypi"
},
{
"name": "pyyaml-env-tag",
"direct": false,
"version": "1.1",
"ecosystem": "pypi"
},
{
"name": "ray",
"direct": false,
"version": "2.56.0",
"ecosystem": "pypi"
},
{
"name": "referencing",
"direct": false,
"version": "0.37.0",
"ecosystem": "pypi"
},
{
"name": "retrying",
"direct": false,
"version": "1.4.2",
"ecosystem": "pypi"
},
{
"name": "rich",
"direct": false,
"version": "14.3.4",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "0.30.0",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "2026.5.1",
"ecosystem": "pypi"
},
{
"name": "s3fs",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "s3transfer",
"direct": false,
"version": "0.17.1",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlflow",
"direct": false,
"version": "0.4.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-schema-inference-artifacts",
"direct": false,
"version": "0.0.5",
"ecosystem": "pypi"
},
{
"name": "schema",
"direct": false,
"version": "0.7.8",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.15.3",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.17.1",
"ecosystem": "pypi"
},
{
"name": "setuptools",
"direct": false,
"version": "81.0.0",
"ecosystem": "pypi"
},
{
"name": "shap",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "six",
"direct": false,
"version": "1.17.0",
"ecosystem": "pypi"
},
{
"name": "skops",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "smdebug-rulesconfig",
"direct": false,
"version": "1.0.1",
"ecosystem": "pypi"
},
{
"name": "smmap",
"direct": false,
"version": "5.0.3",
"ecosystem": "pypi"
},
{
"name": "sqlalchemy",
"direct": false,
"version": "2.0.50",
"ecosystem": "pypi"
},
{
"name": "sqlparse",
"direct": false,
"version": "0.5.5",
"ecosystem": "pypi"
},
{
"name": "stack-data",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "starlette",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "strictyaml",
"direct": false,
"version": "1.7.3",
"ecosystem": "pypi"
},
{
"name": "sympy",
"direct": false,
"version": "1.14.0",
"ecosystem": "pypi"
},
{
"name": "tblib",
"direct": false,
"version": "3.2.2",
"ecosystem": "pypi"
},
{
"name": "tenacity",
"direct": false,
"version": "9.1.4",
"ecosystem": "pypi"
},
{
"name": "tensorboardx",
"direct": false,
"version": "2.6.5",
"ecosystem": "pypi"
},
{
"name": "termcolor",
"direct": false,
"version": "3.3.0",
"ecosystem": "pypi"
},
{
"name": "threadpoolctl",
"direct": false,
"version": "3.6.0",
"ecosystem": "pypi"
},
{
"name": "tomli",
"direct": false,
"version": "2.4.1",
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": "4.68.2",
"ecosystem": "pypi"
},
{
"name": "traitlets",
"direct": false,
"version": "5.15.1",
"ecosystem": "pypi"
},
{
"name": "triton",
"direct": false,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "tritonclient",
"direct": false,
"version": "2.69.0",
"ecosystem": "pypi"
},
{
"name": "typeguard",
"direct": false,
"version": "2.13.3",
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": false,
"version": "4.15.0",
"ecosystem": "pypi"
},
{
"name": "typing-inspection",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "tzdata",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": "0.5.12",
"ecosystem": "pypi"
},
{
"name": "urllib3",
"direct": false,
"version": "2.7.0",
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": "0.49.0",
"ecosystem": "pypi"
},
{
"name": "waitress",
"direct": false,
"version": "3.0.2",
"ecosystem": "pypi"
},
{
"name": "watchdog",
"direct": false,
"version": "6.0.0",
"ecosystem": "pypi"
},
{
"name": "wcwidth",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "werkzeug",
"direct": false,
"version": "3.1.8",
"ecosystem": "pypi"
},
{
"name": "wrapt",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "xgboost-cpu",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "yarl",
"direct": false,
"version": "1.24.2",
"ecosystem": "pypi"
},
{
"name": "zipp",
"direct": false,
"version": "4.1.0",
"ecosystem": "pypi"
},
{
"name": "zope-event",
"direct": false,
"version": "6.2",
"ecosystem": "pypi"
},
{
"name": "zope-interface",
"direct": false,
"version": "8.5",
"ecosystem": "pypi"
},
{
"name": "zstandard",
"direct": false,
"version": "0.25.0",
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 295,
"direct_count": 35,
"indirect_count": 260
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 81,
"open_issues": 192,
"closed_ratio": 0.605,
"closed_issues": 294,
"closed_unmerged_prs": 31
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "brifordwylie",
"commits": 7193,
"avatar_url": "https://avatars.githubusercontent.com/u/4806709?u=4621f8834a58a072c0487a11c1a464ba79001d85&v=4"
},
{
"type": "User",
"login": "ScottKolmarWFI",
"commits": 47,
"avatar_url": "https://avatars.githubusercontent.com/u/103940733?u=66d82044a9f6ec5a505b6b5dad879448881f2e78&v=4"
},
{
"type": "User",
"login": "giupb",
"commits": 32,
"avatar_url": "https://avatars.githubusercontent.com/u/52609794?u=7e31f70e3b071aecc0ca8da0971ed6e7e05a1fdf&v=4"
},
{
"type": "User",
"login": "luiztauffer",
"commits": 17,
"avatar_url": "https://avatars.githubusercontent.com/u/24541631?u=982d8cef4df0c59e59ce14dc54909c10dded7905&v=4"
},
{
"type": "User",
"login": "sdidier-dev",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/73602526?u=c6239ee652448f997bfd774484b5163faa2d691c&v=4"
},
{
"type": "User",
"login": "andrew-huynh",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/86267299?u=e6337b661122f0d3838a6ea2746649992a30e3a1&v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "User",
"login": "keilogic",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/189083319?v=4"
}
],
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"aws-tests.yml",
"deploy-docs.yml",
"endpoint-import-smoke.yml",
"gitleaks.yml",
"lockfile-drift.yml",
"publish.yml",
"python-lint.yml"
],
"has_docs_dir": true,
"linter_configs": [
".flake8",
"tox.ini"
],
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"security_signals": {
"lockfiles": [
"uv.lock"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 6 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 0,
"reason": "10 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "fc6c71b64a7b3506b6a1b4d5feac6fbc5eb225fb",
"ran_at": "2026-07-18T17:24:45Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/SuperCowPowers/workbench",
"host": "github.com",
"name": "workbench",
"owner": "SuperCowPowers"
},
"metrics": {
"overall": {
"key": "overall",
"band": "good",
"name": "Overall health",
"note": null,
"notes": [],
"value": 72,
"inputs": {
"security": 50,
"vitality": 96,
"community": 57,
"governance": 58,
"engineering": 95
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 96,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"commits_last_year": 2128,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 52
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "52/52 weeks with commits",
"points": 36,
"status": "met",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 52
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "2128 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 2128
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 100,
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~1.1 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 1.1
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"forks": 7,
"stars": 51,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "51 stars",
"points": 27.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 51
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "7 forks",
"points": 6.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 7
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 67,
"inputs": {
"packages": [
"workbench"
],
"dependents": null,
"ecosystems": "pypi",
"total_downloads": null,
"monthly_downloads": 10144
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "10,144 downloads/month across pypi",
"points": 53.4,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 10144,
"ecosystems": "pypi"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 58,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 30,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.3,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "8 contributors",
"points": 10.8,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 8
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"merged_prs": 81,
"open_issues": 192,
"closed_issues": 294,
"issue_closed_ratio": 0.605,
"closed_unmerged_prs": 31
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "60% of issues closed",
"points": 28.3,
"status": "partial",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 60
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "81/112 decided PRs merged",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 81,
"decided": 112
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"followers": 29,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "SuperCowPowers",
"public_repos": 13,
"account_age_days": 4513
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "29 followers of SuperCowPowers",
"points": 10.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 29,
"login": "SuperCowPowers"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "13 public repos, account ~12 yr old",
"points": 20.3,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 13
}
},
{
"code": "account_age_years",
"params": {
"years": 12
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"workbench"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "330 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 330
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "excellent",
"name": "Engineering Quality",
"value": 95,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "excellent",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "7 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 7
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": ".flake8, tox.ini",
"points": 16,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 9.6,
"status": "met",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "excellent",
"name": "Documentation",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://www.supercowpowers.com",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "7 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 7
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 50,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "10 existing vulnerabilities detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 3
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 44,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 73,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"uv.lock"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"Makefile"
],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": ".flake8, tox.ini",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "4/637 source files over 60KB",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 637,
"oversized": 4
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples",
"notebooks"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples, notebooks",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples, notebooks"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-18T17:25:10.029741Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/s/SuperCowPowers/workbench.svg",
"full_name": "SuperCowPowers/workbench",
"license_state": "standard",
"license_spdx": "MIT"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.14.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — PyPI.