Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models
SuperCowPowers/workbench erreicht einen Gesundheitsindex von 72 von 100 und liegt damit im Bereich Gut. Am stärksten schneidet es bei Vitality (96/100) ab, am schwächsten bei AI Readiness (44/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| PyPI | workbench | 0.8.409 | 10.144 | 330 | vor 0 Tagen | sagemakermachine-learningawspythonutilities |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 36/36 | Commit-Rhythmus — 52/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 2.128 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 2.128 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 52 |
| 27/27 | Liefert Releases aus — 100 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 0 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 1,1 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 100 |
| latest_release_tag | v0.8.409 |
| releases_from_tags | nein |
| days_since_latest_release | 0 |
| mean_days_between_releases | 1,1 |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 27.6/60 | Stars — 51 Stars |
| 6.5/25 | Forks — 7 Forks |
| 0/15 | Watcher — 2 Watcher |
| forks | 7 |
| stars | 51 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 18/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 6.3/6.3 | PR-Vorlage |
| has_readme | ja |
| has_license | ja |
| has_contributing | ja |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | ja |
| 53.4/80 | Downloads pro Monat — 10.144 Downloads/Monat über pypi |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
| packages | workbench |
| dependents | — |
| ecosystems | pypi |
| total_downloads | — |
| monthly_downloads | 10.144 |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 0.3/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 99 % der Commits |
| 10.8/13.5 | Breite der Beitragenden — 8 Beitragende |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 8 |
| top_contributor_share | 0,986 |
| 28.3/46.8 | Issue-Lösungsquote — 60 % der Issues geschlossen |
| 27.7/38.3 | PR-Annahme — 81/112 entschiedene PRs gemergt |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 81 |
| open_issues | 192 |
| closed_issues | 294 |
| issue_closed_ratio | 0,605 |
| closed_unmerged_prs | 31 |
| 30/30 | Organisatorische Trägerschaft — im Besitz einer Organisation |
| 0/20 | Verifizierte Domain |
| 10.6/25 | Reichweite des Inhabers — 29 Follower von SuperCowPowers |
| 20.3/25 | Kontohistorie — 13 öffentliche Repos, Kontoalter ca. 12 Jahre |
| followers | 29 |
| owner_type | Organization |
| is_verified | — |
| owner_login | SuperCowPowers |
| public_repos | 13 |
| account_age_days | 4.513 |
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf pypi |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 0 Tagen |
| 20/20 | Versionshistorie — 330 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | workbench |
| ecosystems | pypi |
| any_deprecated | nein |
| min_days_since_publish | 0 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 24/24 | CI-Workflows — 7 Workflow(s) |
| 24/24 | Tests vorhanden |
| 16/16 | Linter-Konfiguration — .flake8, tox.ini |
| 9.6/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — keine Daten |
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | ja |
| has_precommit_config | ja |
| 30/30 | README |
| 25/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://www.supercowpowers.com |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 7 Topics |
| 10/10 | Wiki |
| topics | aws, big-data, machine-learning, python, spark, data-engineering, pandas |
| has_wiki | ja |
| homepage | https://www.supercowpowers.com |
| has_readme | ja |
| has_docs_dir | ja |
| has_description | ja |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — keine Daten |
| 0/2.5 | CI-Tests — keine Daten |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 10 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
| 0/45 | Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
| has_llms_txt | nein |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 18/18 | Bootstrap mit einem Befehl — Makefile |
| 22/22 | Automatisierte Tests |
| 11/11 | Lint-/Format-Konfiguration — .flake8, tox.ini |
| 0/11 | Statische Typprüfung |
| 10/10 | Reproduzierbare Umgebung — Dockerfile, lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 5/8 | Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | nein |
| has_tests | ja |
| lockfiles | uv.lock |
| has_dockerfile | ja |
| typed_language | nein |
| bootstrap_files | Makefile |
| has_devcontainer | nein |
| has_linter_config | ja |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 0/45 | Typprüfbarer Code — Python ohne Typprüfungs-Konfiguration |
| 54.7/55 | Handhabbare Dateigrößen — 4/637 Quelldateien über 60 KB |
| primary_language | Python |
| largest_source_bytes | 70.242 |
| source_files_sampled | 637 |
| oversized_source_files | 4 |
| 0/40 | API-Schema (OpenAPI/GraphQL/proto) |
| 0/20 | MCP-Server |
| 40/40 | Lauffähige Beispiele — examples, notebooks |
| example_dirs | examples, notebooks |
| has_mcp_signal | nein |
| api_schema_files | — |
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| k. A. | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| k. A. | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 10 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| PyPI | boto3 | >= 1.42.2 | pyproject.toml |
| PyPI | botocore | >= 1.42.2 | pyproject.toml |
| PyPI | awswrangler | >= 3.4.0 | pyproject.toml |
| PyPI | sagemaker | >= 3.6.0, < 3.13 | pyproject.toml |
| PyPI | sagemaker-core | >= 2.12.0, < 2.13 | pyproject.toml |
| PyPI | sagemaker-mlops | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-serve | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-train | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | redis | >= 5.0.1 | pyproject.toml |
| PyPI | cryptography | >= 46.0.0 | pyproject.toml |
| PyPI | requests | >= 2.26.0 | pyproject.toml |
| PyPI | aiobotocore | >= 3.7.0 | pyproject.toml |
| PyPI | pandas | >= 2.2.1, < 3.0 | pyproject.toml |
| PyPI | scikit-learn | >= 1.5.2 | pyproject.toml |
| PyPI | xgboost | >= 3.0.3 | pyproject.toml |
| PyPI | joblib | >= 1.3.2 | pyproject.toml |
| PyPI | rdkit | >= 2026.3.1 | pyproject.toml |
| PyPI | mordredcommunity | >= 2.0.6 | pyproject.toml |
| PyPI | ipython | >= 8.37.0 | pyproject.toml |
| PyPI | pyreadline3 | — | pyproject.toml |
| PyPI | matplotlib | >= 3.9.2 | pyproject.toml |
| PyPI | networkx | >= 3.2 | pyproject.toml |
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 35 direkte und 260 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| PyPI | aiobotocore | 3.7.0 | direkt |
| PyPI | awswrangler | — | direkt |
| PyPI | awswrangler | 3.16.1 | direkt |
| PyPI | boto3 | — | direkt |
| PyPI | boto3 | 1.43.0 | direkt |
| PyPI | botocore | — | direkt |
| PyPI | botocore | 1.43.0 | direkt |
| PyPI | cryptography | 48.0.1 | direkt |
| PyPI | ipython | 8.39.0 | direkt |
| PyPI | ipython | 9.14.1 | direkt |
| PyPI | joblib | — | direkt |
| PyPI | joblib | 1.5.3 | direkt |
| PyPI | matplotlib | 3.10.9 | direkt |
| PyPI | mordredcommunity | — | direkt |
| PyPI | mordredcommunity | 2.0.7 | direkt |
| PyPI | networkx | — | direkt |
| PyPI | networkx | 3.4.2 | direkt |
| PyPI | networkx | 3.6.1 | direkt |
| PyPI | pandas | — | direkt |
| PyPI | pandas | 2.3.3 | direkt |
| PyPI | pyreadline3 | 3.5.6 | direkt |
| PyPI | rdkit | — | direkt |
| PyPI | rdkit | 2026.3.3 | direkt |
| PyPI | redis | 8.0.0 | direkt |
| PyPI | requests | — | direkt |
| PyPI | requests | 2.34.2 | direkt |
| PyPI | sagemaker | 3.12.0 | direkt |
| PyPI | sagemaker-core | 2.12.0 | direkt |
| PyPI | sagemaker-mlops | 1.12.0 | direkt |
| PyPI | sagemaker-serve | 1.12.0 | direkt |
| PyPI | sagemaker-train | 1.12.0 | direkt |
| PyPI | scikit-learn | — | direkt |
| PyPI | scikit-learn | 1.7.2 | direkt |
| PyPI | scikit-learn | 1.9.0 | direkt |
| PyPI | xgboost | 3.2.0 | direkt |
| PyPI | aiohappyeyeballs | 2.6.2 | indirekt |
| PyPI | aiohttp | 3.14.1 | indirekt |
| PyPI | aioitertools | 0.13.0 | indirekt |
| PyPI | aiosignal | 1.4.0 | indirekt |
| PyPI | alembic | 1.18.4 | indirekt |
| PyPI | annotated-doc | 0.0.4 | indirekt |
| PyPI | annotated-types | 0.7.0 | indirekt |
| PyPI | antlr4-python3-runtime | 4.9.3 | indirekt |
| PyPI | anyio | 4.13.0 | indirekt |
| PyPI | asgiref | — | indirekt |
| PyPI | asttokens | 3.0.1 | indirekt |
| PyPI | async-timeout | 5.0.1 | indirekt |
| PyPI | attrs | 26.1.0 | indirekt |
| PyPI | aws-cdk-asset-awscli-v1 | 2.2.282 | indirekt |
| PyPI | aws-cdk-asset-node-proxy-agent-v6 | 2.1.2 | indirekt |
| PyPI | aws-cdk-cloud-assembly-schema | 54.8.0 | indirekt |
| PyPI | aws-cdk-lib | — | indirekt |
| PyPI | aws-cdk-lib | 2.211.0 | indirekt |
| PyPI | aws-cdk-lib | 2.261.0 | indirekt |
| PyPI | babel | 2.18.0 | indirekt |
| PyPI | backrefs | 7.0 | indirekt |
| PyPI | bcrypt | 5.0.0 | indirekt |
| PyPI | black | — | indirekt |
| PyPI | black | 26.5.1 | indirekt |
| PyPI | blinker | 1.9.0 | indirekt |
| PyPI | brotli | 1.2.0 | indirekt |
| PyPI | cachebox | 5.2.3 | indirekt |
| PyPI | cachetools | 6.2.6 | indirekt |
| PyPI | cattrs | 26.1.0 | indirekt |
| PyPI | certifi | 2026.5.20 | indirekt |
| PyPI | cffi | 2.0.0 | indirekt |
| PyPI | charset-normalizer | 3.4.7 | indirekt |
| PyPI | chemprop | — | indirekt |
| PyPI | click | 8.4.1 | indirekt |
| PyPI | cloudpickle | 3.1.2 | indirekt |
| PyPI | colorama | 0.4.6 | indirekt |
| PyPI | colorlog | 6.10.1 | indirekt |
| PyPI | constructs | — | indirekt |
| PyPI | constructs | 10.6.0 | indirekt |
| PyPI | contourpy | 1.3.2 | indirekt |
| PyPI | contourpy | 1.3.3 | indirekt |
| PyPI | coverage | — | indirekt |
| PyPI | coverage | 7.14.1 | indirekt |
| PyPI | cuda-bindings | 13.3.1 | indirekt |
| PyPI | cuda-pathfinder | 1.5.5 | indirekt |
| PyPI | cuda-toolkit | 13.0.2 | indirekt |
| PyPI | cycler | 0.12.1 | indirekt |
| PyPI | dash | 4.2.0 | indirekt |
| PyPI | dash-ag-grid | 35.2.0 | indirekt |
| PyPI | dash-bootstrap-components | 2.0.4 | indirekt |
| PyPI | databricks-sdk | 0.116.0 | indirekt |
| PyPI | decorator | 5.3.1 | indirekt |
| PyPI | deepdiff | 9.1.0 | indirekt |
| PyPI | docker | 7.1.0 | indirekt |
| PyPI | exceptiongroup | 1.3.1 | indirekt |
| PyPI | execnet | 2.1.2 | indirekt |
| PyPI | executing | 2.2.1 | indirekt |
| PyPI | fastapi | — | indirekt |
| PyPI | fastapi | 0.136.3 | indirekt |
| PyPI | filelock | 3.29.3 | indirekt |
| PyPI | flake8 | — | indirekt |
| PyPI | flake8 | 7.3.0 | indirekt |
| PyPI | flask | 3.1.3 | indirekt |
| PyPI | flask-cors | 6.0.5 | indirekt |
| PyPI | flatbuffers | 25.12.19 | indirekt |
| PyPI | fonttools | 4.63.0 | indirekt |
| PyPI | frozenlist | 1.8.0 | indirekt |
| PyPI | fsspec | 2026.4.0 | indirekt |
| PyPI | gevent | 26.5.0 | indirekt |
| PyPI | geventhttpclient | 2.3.9 | indirekt |
| PyPI | ghp-import | 2.1.0 | indirekt |
| PyPI | gitdb | 4.0.12 | indirekt |
| PyPI | gitpython | 3.1.50 | indirekt |
| PyPI | google-auth | 2.53.0 | indirekt |
| PyPI | graphene | 3.4.3 | indirekt |
| PyPI | graphql-core | 3.2.11 | indirekt |
| PyPI | graphql-relay | 3.2.0 | indirekt |
| PyPI | greenlet | 3.3.2 | indirekt |
| PyPI | griffelib | 2.1.0 | indirekt |
| PyPI | gunicorn | 26.0.0 | indirekt |
| PyPI | h11 | 0.16.0 | indirekt |
| PyPI | huey | 3.0.1 | indirekt |
| PyPI | idna | 3.18 | indirekt |
| PyPI | importlib-metadata | 6.11.0 | indirekt |
| PyPI | iniconfig | 2.3.0 | indirekt |
| PyPI | invoke | 3.0.3 | indirekt |
| PyPI | ipython-pygments-lexers | 1.1.1 | indirekt |
| PyPI | itsdangerous | 2.2.0 | indirekt |
| PyPI | janus | 2.0.0 | indirekt |
| PyPI | jedi | 0.20.0 | indirekt |
| PyPI | jinja2 | 3.1.6 | indirekt |
| PyPI | jmespath | 1.1.0 | indirekt |
| PyPI | jsii | 1.138.0 | indirekt |
| PyPI | json5 | 0.14.0 | indirekt |
| PyPI | jsonschema | 4.26.0 | indirekt |
| PyPI | jsonschema-specifications | 2025.9.1 | indirekt |
| PyPI | kiwisolver | 1.5.0 | indirekt |
| PyPI | llvmlite | 0.47.0 | indirekt |
| PyPI | mako | 1.3.12 | indirekt |
| PyPI | markdown | 3.10.2 | indirekt |
| PyPI | markdown-it-py | 4.2.0 | indirekt |
| PyPI | markupsafe | 3.0.3 | indirekt |
| PyPI | matplotlib-inline | 0.2.2 | indirekt |
| PyPI | mccabe | 0.7.0 | indirekt |
| PyPI | mdurl | 0.1.2 | indirekt |
| PyPI | mergedeep | 1.3.4 | indirekt |
| PyPI | mkdocs | 1.6.1 | indirekt |
| PyPI | mkdocs-autorefs | 1.4.4 | indirekt |
| PyPI | mkdocs-get-deps | 0.2.2 | indirekt |
| PyPI | mkdocs-material | 9.7.7 | indirekt |
| PyPI | mkdocs-material-extensions | 1.3.1 | indirekt |
| PyPI | mkdocstrings | 1.0.6 | indirekt |
| PyPI | mkdocstrings-python | 2.0.5 | indirekt |
| PyPI | ml-dtypes | 0.5.4 | indirekt |
| PyPI | mlflow | 3.13.0 | indirekt |
| PyPI | mlflow-skinny | 3.13.0 | indirekt |
| PyPI | mlflow-tracing | 3.13.0 | indirekt |
| PyPI | mmh3 | 5.2.1 | indirekt |
| PyPI | mock | 4.0.3 | indirekt |
| PyPI | mpmath | 1.3.0 | indirekt |
| PyPI | msgpack | 1.2.1 | indirekt |
| PyPI | multidict | 6.7.1 | indirekt |
| PyPI | mypy-extensions | 1.1.0 | indirekt |
| PyPI | narwhals | 2.22.1 | indirekt |
| PyPI | nest-asyncio | 1.6.0 | indirekt |
| PyPI | numba | 0.65.1 | indirekt |
| PyPI | numpy | 2.2.6 | indirekt |
| PyPI | numpy | 2.4.6 | indirekt |
| PyPI | nvidia-cublas | 13.1.1.3 | indirekt |
| PyPI | nvidia-cuda-cupti | 13.0.85 | indirekt |
| PyPI | nvidia-cuda-nvrtc | 13.0.88 | indirekt |
| PyPI | nvidia-cuda-runtime | 13.0.96 | indirekt |
| PyPI | nvidia-cudnn-cu13 | 9.20.0.48 | indirekt |
| PyPI | nvidia-cufft | 12.0.0.61 | indirekt |
| PyPI | nvidia-cufile | 1.15.1.6 | indirekt |
| PyPI | nvidia-curand | 10.4.0.35 | indirekt |
| PyPI | nvidia-cusolver | 12.0.4.66 | indirekt |
| PyPI | nvidia-cusparse | 12.6.3.3 | indirekt |
| PyPI | nvidia-cusparselt-cu13 | 0.8.1 | indirekt |
| PyPI | nvidia-nccl-cu12 | 2.30.7 | indirekt |
| PyPI | nvidia-nccl-cu13 | 2.29.7 | indirekt |
| PyPI | nvidia-nvjitlink | 13.0.88 | indirekt |
| PyPI | nvidia-nvshmem-cu13 | 3.4.5 | indirekt |
| PyPI | nvidia-nvtx | 13.0.85 | indirekt |
| PyPI | omegaconf | 2.3.0 | indirekt |
| PyPI | onnx | 1.22.0 | indirekt |
| PyPI | onnxruntime | 1.24.3 | indirekt |
| PyPI | onnxruntime | 1.26.0 | indirekt |
| PyPI | opentelemetry-api | 1.42.1 | indirekt |
| PyPI | opentelemetry-proto | 1.42.1 | indirekt |
| PyPI | opentelemetry-sdk | 1.42.1 | indirekt |
| PyPI | opentelemetry-semantic-conventions | 0.63b1 | indirekt |
| PyPI | optuna | 4.9.0 | indirekt |
| PyPI | orderly-set | 5.5.0 | indirekt |
| PyPI | packaging | 26.2 | indirekt |
| PyPI | paginate | 0.5.7 | indirekt |
| PyPI | paramiko | 5.0.0 | indirekt |
| PyPI | parso | 0.8.7 | indirekt |
| PyPI | pathspec | 1.1.1 | indirekt |
| PyPI | pexpect | 4.9.0 | indirekt |
| PyPI | pillow | 12.2.0 | indirekt |
| PyPI | platformdirs | 4.10.0 | indirekt |
| PyPI | plotly | 6.8.0 | indirekt |
| PyPI | pluggy | 1.6.0 | indirekt |
| PyPI | prettytable | 3.17.0 | indirekt |
| PyPI | prompt-toolkit | 3.0.52 | indirekt |
| PyPI | propcache | 0.5.2 | indirekt |
| PyPI | protobuf | 6.33.6 | indirekt |
| PyPI | psutil | 7.2.2 | indirekt |
| PyPI | ptyprocess | 0.7.0 | indirekt |
| PyPI | publication | 0.0.3 | indirekt |
| PyPI | pure-eval | 0.2.3 | indirekt |
| PyPI | pyarrow | 24.0.0 | indirekt |
| PyPI | pyasn1 | 0.6.3 | indirekt |
| PyPI | pyasn1-modules | 0.4.2 | indirekt |
| PyPI | pycodestyle | 2.14.0 | indirekt |
| PyPI | pycparser | 3.0 | indirekt |
| PyPI | pydantic | 2.13.4 | indirekt |
| PyPI | pydantic-core | 2.46.4 | indirekt |
| PyPI | pyflakes | 3.4.0 | indirekt |
| PyPI | pygments | 2.20.0 | indirekt |
| PyPI | pyiceberg | 0.11.1 | indirekt |
| PyPI | pymdown-extensions | 11.0.1 | indirekt |
| PyPI | pynacl | 1.6.2 | indirekt |
| PyPI | pynndescent | 0.6.0 | indirekt |
| PyPI | pyparsing | 3.3.2 | indirekt |
| PyPI | pyroaring | 1.1.0 | indirekt |
| PyPI | pytest | — | indirekt |
| PyPI | pytest | 9.0.3 | indirekt |
| PyPI | pytest-cov | — | indirekt |
| PyPI | pytest-cov | 7.1.0 | indirekt |
| PyPI | pytest-sugar | — | indirekt |
| PyPI | pytest-sugar | 1.1.1 | indirekt |
| PyPI | pytest-xdist | 3.8.0 | indirekt |
| PyPI | python-dateutil | 2.9.0.post0 | indirekt |
| PyPI | python-dotenv | 1.2.2 | indirekt |
| PyPI | python-rapidjson | 1.23 | indirekt |
| PyPI | pytokens | 0.4.1 | indirekt |
| PyPI | pytz | 2026.2 | indirekt |
| PyPI | pywin32 | 312 | indirekt |
| PyPI | pyyaml | 6.0.3 | indirekt |
| PyPI | pyyaml-env-tag | 1.1 | indirekt |
| PyPI | ray | 2.56.0 | indirekt |
| PyPI | referencing | 0.37.0 | indirekt |
| PyPI | retrying | 1.4.2 | indirekt |
| PyPI | rich | 14.3.4 | indirekt |
| PyPI | rpds-py | 0.30.0 | indirekt |
| PyPI | rpds-py | 2026.5.1 | indirekt |
| PyPI | s3fs | 2026.4.0 | indirekt |
| PyPI | s3transfer | 0.17.1 | indirekt |
| PyPI | sagemaker-mlflow | 0.4.0 | indirekt |
| PyPI | sagemaker-schema-inference-artifacts | 0.0.5 | indirekt |
| PyPI | schema | 0.7.8 | indirekt |
| PyPI | scipy | 1.15.3 | indirekt |
| PyPI | scipy | 1.17.1 | indirekt |
| PyPI | setuptools | 81.0.0 | indirekt |
| PyPI | shap | — | indirekt |
| PyPI | six | 1.17.0 | indirekt |
| PyPI | skops | 0.14.0 | indirekt |
| PyPI | smdebug-rulesconfig | 1.0.1 | indirekt |
| PyPI | smmap | 5.0.3 | indirekt |
| PyPI | sqlalchemy | 2.0.50 | indirekt |
| PyPI | sqlparse | 0.5.5 | indirekt |
| PyPI | stack-data | 0.6.3 | indirekt |
| PyPI | starlette | 1.3.1 | indirekt |
| PyPI | strictyaml | 1.7.3 | indirekt |
| PyPI | sympy | 1.14.0 | indirekt |
| PyPI | tblib | 3.2.2 | indirekt |
| PyPI | tenacity | 9.1.4 | indirekt |
| PyPI | tensorboardx | 2.6.5 | indirekt |
| PyPI | termcolor | 3.3.0 | indirekt |
| PyPI | threadpoolctl | 3.6.0 | indirekt |
| PyPI | tomli | 2.4.1 | indirekt |
| PyPI | torch | — | indirekt |
| PyPI | torch | 2.12.0 | indirekt |
| PyPI | tqdm | — | indirekt |
| PyPI | tqdm | 4.68.2 | indirekt |
| PyPI | traitlets | 5.15.1 | indirekt |
| PyPI | triton | 3.7.0 | indirekt |
| PyPI | tritonclient | 2.69.0 | indirekt |
| PyPI | typeguard | 2.13.3 | indirekt |
| PyPI | typing-extensions | 4.15.0 | indirekt |
| PyPI | typing-inspection | 0.4.2 | indirekt |
| PyPI | tzdata | 2026.2 | indirekt |
| PyPI | umap-learn | — | indirekt |
| PyPI | umap-learn | 0.5.12 | indirekt |
| PyPI | urllib3 | 2.7.0 | indirekt |
| PyPI | uvicorn | — | indirekt |
| PyPI | uvicorn | 0.49.0 | indirekt |
| PyPI | waitress | 3.0.2 | indirekt |
| PyPI | watchdog | 6.0.0 | indirekt |
| PyPI | wcwidth | 0.8.1 | indirekt |
| PyPI | werkzeug | 3.1.8 | indirekt |
| PyPI | wrapt | 2.2.1 | indirekt |
| PyPI | xgboost-cpu | — | indirekt |
| PyPI | yarl | 1.24.2 | indirekt |
| PyPI | zipp | 4.1.0 | indirekt |
| PyPI | zope-event | 6.2 | indirekt |
| PyPI | zope-interface | 8.5 | indirekt |
| PyPI | zstandard | 0.25.0 | indirekt |
{
"data": {
"repo": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"is_fork": false,
"size_kb": 91631,
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"languages": {
"CSS": 62868,
"Shell": 29010,
"Python": 3687778,
"Makefile": 971,
"Batchfile": 874,
"Dockerfile": 12108,
"JavaScript": 46472,
"Jupyter Notebook": 81119
},
"pushed_at": "2026-07-18T17:24:31Z",
"created_at": "2022-12-06T17:41:31Z",
"owner_type": "Organization",
"updated_at": "2026-07-18T17:24:34Z",
"description": "Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://www.supercowpowers.com",
"name": "SuperCowPowers",
"type": "Organization",
"login": "SuperCowPowers",
"company": null,
"location": "United States of America",
"followers": 29,
"avatar_url": "https://avatars.githubusercontent.com/u/6900187?v=4",
"created_at": "2014-03-09T18:36:12Z",
"is_verified": null,
"public_repos": 13,
"account_age_days": 4513
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 100,
"commits_last_year": 2128,
"latest_release_at": "2026-07-18T17:24:11Z",
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 52,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 75,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "workbench",
"exists": true,
"license": null,
"keywords": [
"SageMaker",
"Machine Learning",
"AWS",
"Python",
"Utilities",
"Development Status :: 4 - Beta",
"Programming Language :: Python :: 3.10",
"Programming Language :: Python :: 3.11",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Topic :: Scientific/Engineering"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/workbench/",
"is_deprecated": false,
"latest_version": "0.8.409",
"repository_url": "https://github.com/SuperCowPowers/workbench",
"versions_count": 330,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 10144,
"first_published_at": "2014-07-08T00:59:42.285343Z",
"latest_published_at": "2026-07-18T17:24:07.930211Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 7,
"stars": 51,
"watchers": 2,
"open_issues_and_prs": 192
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples",
"notebooks"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"lambda_layers/requirements.txt",
"pyproject.toml",
"tests/requirements-dev.txt"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "boto3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "botocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "awswrangler",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.4.0"
},
{
"name": "sagemaker",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.6.0, < 3.13"
},
{
"name": "sagemaker-core",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.12.0, < 2.13"
},
{
"name": "sagemaker-mlops",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-serve",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-train",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "redis",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 5.0.1"
},
{
"name": "cryptography",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 46.0.0"
},
{
"name": "requests",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.26.0"
},
{
"name": "aiobotocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.7.0"
},
{
"name": "pandas",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.2.1, < 3.0"
},
{
"name": "scikit-learn",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.5.2"
},
{
"name": "xgboost",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.0.3"
},
{
"name": "joblib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.3.2"
},
{
"name": "rdkit",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2026.3.1"
},
{
"name": "mordredcommunity",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.0.6"
},
{
"name": "ipython",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 8.37.0"
},
{
"name": "pyreadline3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": null
},
{
"name": "matplotlib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.9.2"
},
{
"name": "networkx",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.2"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "aiobotocore",
"direct": true,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": "3.16.1",
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "cryptography",
"direct": true,
"version": "48.0.1",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "8.39.0",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "9.14.1",
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": "1.5.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib",
"direct": true,
"version": "3.10.9",
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": "2.0.7",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.4.2",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.6.1",
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": "2.3.3",
"ecosystem": "pypi"
},
{
"name": "pyreadline3",
"direct": true,
"version": "3.5.6",
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": "2026.3.3",
"ecosystem": "pypi"
},
{
"name": "redis",
"direct": true,
"version": "8.0.0",
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": "2.34.2",
"ecosystem": "pypi"
},
{
"name": "sagemaker",
"direct": true,
"version": "3.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-core",
"direct": true,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlops",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-serve",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-train",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.7.2",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "xgboost",
"direct": true,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "aiohappyeyeballs",
"direct": false,
"version": "2.6.2",
"ecosystem": "pypi"
},
{
"name": "aiohttp",
"direct": false,
"version": "3.14.1",
"ecosystem": "pypi"
},
{
"name": "aioitertools",
"direct": false,
"version": "0.13.0",
"ecosystem": "pypi"
},
{
"name": "aiosignal",
"direct": false,
"version": "1.4.0",
"ecosystem": "pypi"
},
{
"name": "alembic",
"direct": false,
"version": "1.18.4",
"ecosystem": "pypi"
},
{
"name": "annotated-doc",
"direct": false,
"version": "0.0.4",
"ecosystem": "pypi"
},
{
"name": "annotated-types",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "antlr4-python3-runtime",
"direct": false,
"version": "4.9.3",
"ecosystem": "pypi"
},
{
"name": "anyio",
"direct": false,
"version": "4.13.0",
"ecosystem": "pypi"
},
{
"name": "asgiref",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "asttokens",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "async-timeout",
"direct": false,
"version": "5.0.1",
"ecosystem": "pypi"
},
{
"name": "attrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-awscli-v1",
"direct": false,
"version": "2.2.282",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-node-proxy-agent-v6",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-cloud-assembly-schema",
"direct": false,
"version": "54.8.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.211.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.261.0",
"ecosystem": "pypi"
},
{
"name": "babel",
"direct": false,
"version": "2.18.0",
"ecosystem": "pypi"
},
{
"name": "backrefs",
"direct": false,
"version": "7.0",
"ecosystem": "pypi"
},
{
"name": "bcrypt",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": "26.5.1",
"ecosystem": "pypi"
},
{
"name": "blinker",
"direct": false,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "brotli",
"direct": false,
"version": "1.2.0",
"ecosystem": "pypi"
},
{
"name": "cachebox",
"direct": false,
"version": "5.2.3",
"ecosystem": "pypi"
},
{
"name": "cachetools",
"direct": false,
"version": "6.2.6",
"ecosystem": "pypi"
},
{
"name": "cattrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "certifi",
"direct": false,
"version": "2026.5.20",
"ecosystem": "pypi"
},
{
"name": "cffi",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "charset-normalizer",
"direct": false,
"version": "3.4.7",
"ecosystem": "pypi"
},
{
"name": "chemprop",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "click",
"direct": false,
"version": "8.4.1",
"ecosystem": "pypi"
},
{
"name": "cloudpickle",
"direct": false,
"version": "3.1.2",
"ecosystem": "pypi"
},
{
"name": "colorama",
"direct": false,
"version": "0.4.6",
"ecosystem": "pypi"
},
{
"name": "colorlog",
"direct": false,
"version": "6.10.1",
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": "10.6.0",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.2",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.3",
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": "7.14.1",
"ecosystem": "pypi"
},
{
"name": "cuda-bindings",
"direct": false,
"version": "13.3.1",
"ecosystem": "pypi"
},
{
"name": "cuda-pathfinder",
"direct": false,
"version": "1.5.5",
"ecosystem": "pypi"
},
{
"name": "cuda-toolkit",
"direct": false,
"version": "13.0.2",
"ecosystem": "pypi"
},
{
"name": "cycler",
"direct": false,
"version": "0.12.1",
"ecosystem": "pypi"
},
{
"name": "dash",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-ag-grid",
"direct": false,
"version": "35.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-bootstrap-components",
"direct": false,
"version": "2.0.4",
"ecosystem": "pypi"
},
{
"name": "databricks-sdk",
"direct": false,
"version": "0.116.0",
"ecosystem": "pypi"
},
{
"name": "decorator",
"direct": false,
"version": "5.3.1",
"ecosystem": "pypi"
},
{
"name": "deepdiff",
"direct": false,
"version": "9.1.0",
"ecosystem": "pypi"
},
{
"name": "docker",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "exceptiongroup",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "execnet",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "executing",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": "0.136.3",
"ecosystem": "pypi"
},
{
"name": "filelock",
"direct": false,
"version": "3.29.3",
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": "7.3.0",
"ecosystem": "pypi"
},
{
"name": "flask",
"direct": false,
"version": "3.1.3",
"ecosystem": "pypi"
},
{
"name": "flask-cors",
"direct": false,
"version": "6.0.5",
"ecosystem": "pypi"
},
{
"name": "flatbuffers",
"direct": false,
"version": "25.12.19",
"ecosystem": "pypi"
},
{
"name": "fonttools",
"direct": false,
"version": "4.63.0",
"ecosystem": "pypi"
},
{
"name": "frozenlist",
"direct": false,
"version": "1.8.0",
"ecosystem": "pypi"
},
{
"name": "fsspec",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "gevent",
"direct": false,
"version": "26.5.0",
"ecosystem": "pypi"
},
{
"name": "geventhttpclient",
"direct": false,
"version": "2.3.9",
"ecosystem": "pypi"
},
{
"name": "ghp-import",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gitdb",
"direct": false,
"version": "4.0.12",
"ecosystem": "pypi"
},
{
"name": "gitpython",
"direct": false,
"version": "3.1.50",
"ecosystem": "pypi"
},
{
"name": "google-auth",
"direct": false,
"version": "2.53.0",
"ecosystem": "pypi"
},
{
"name": "graphene",
"direct": false,
"version": "3.4.3",
"ecosystem": "pypi"
},
{
"name": "graphql-core",
"direct": false,
"version": "3.2.11",
"ecosystem": "pypi"
},
{
"name": "graphql-relay",
"direct": false,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "greenlet",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "griffelib",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gunicorn",
"direct": false,
"version": "26.0.0",
"ecosystem": "pypi"
},
{
"name": "h11",
"direct": false,
"version": "0.16.0",
"ecosystem": "pypi"
},
{
"name": "huey",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "idna",
"direct": false,
"version": "3.18",
"ecosystem": "pypi"
},
{
"name": "importlib-metadata",
"direct": false,
"version": "6.11.0",
"ecosystem": "pypi"
},
{
"name": "iniconfig",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "invoke",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "ipython-pygments-lexers",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "itsdangerous",
"direct": false,
"version": "2.2.0",
"ecosystem": "pypi"
},
{
"name": "janus",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "jedi",
"direct": false,
"version": "0.20.0",
"ecosystem": "pypi"
},
{
"name": "jinja2",
"direct": false,
"version": "3.1.6",
"ecosystem": "pypi"
},
{
"name": "jmespath",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "jsii",
"direct": false,
"version": "1.138.0",
"ecosystem": "pypi"
},
{
"name": "json5",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema",
"direct": false,
"version": "4.26.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema-specifications",
"direct": false,
"version": "2025.9.1",
"ecosystem": "pypi"
},
{
"name": "kiwisolver",
"direct": false,
"version": "1.5.0",
"ecosystem": "pypi"
},
{
"name": "llvmlite",
"direct": false,
"version": "0.47.0",
"ecosystem": "pypi"
},
{
"name": "mako",
"direct": false,
"version": "1.3.12",
"ecosystem": "pypi"
},
{
"name": "markdown",
"direct": false,
"version": "3.10.2",
"ecosystem": "pypi"
},
{
"name": "markdown-it-py",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "markupsafe",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib-inline",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mccabe",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "mdurl",
"direct": false,
"version": "0.1.2",
"ecosystem": "pypi"
},
{
"name": "mergedeep",
"direct": false,
"version": "1.3.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs",
"direct": false,
"version": "1.6.1",
"ecosystem": "pypi"
},
{
"name": "mkdocs-autorefs",
"direct": false,
"version": "1.4.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs-get-deps",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material",
"direct": false,
"version": "9.7.7",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material-extensions",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings",
"direct": false,
"version": "1.0.6",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings-python",
"direct": false,
"version": "2.0.5",
"ecosystem": "pypi"
},
{
"name": "ml-dtypes",
"direct": false,
"version": "0.5.4",
"ecosystem": "pypi"
},
{
"name": "mlflow",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-skinny",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-tracing",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mmh3",
"direct": false,
"version": "5.2.1",
"ecosystem": "pypi"
},
{
"name": "mock",
"direct": false,
"version": "4.0.3",
"ecosystem": "pypi"
},
{
"name": "mpmath",
"direct": false,
"version": "1.3.0",
"ecosystem": "pypi"
},
{
"name": "msgpack",
"direct": false,
"version": "1.2.1",
"ecosystem": "pypi"
},
{
"name": "multidict",
"direct": false,
"version": "6.7.1",
"ecosystem": "pypi"
},
{
"name": "mypy-extensions",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "narwhals",
"direct": false,
"version": "2.22.1",
"ecosystem": "pypi"
},
{
"name": "nest-asyncio",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "numba",
"direct": false,
"version": "0.65.1",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.2.6",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.4.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-cublas",
"direct": false,
"version": "13.1.1.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-cupti",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-nvrtc",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-runtime",
"direct": false,
"version": "13.0.96",
"ecosystem": "pypi"
},
{
"name": "nvidia-cudnn-cu13",
"direct": false,
"version": "9.20.0.48",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufft",
"direct": false,
"version": "12.0.0.61",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufile",
"direct": false,
"version": "1.15.1.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-curand",
"direct": false,
"version": "10.4.0.35",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusolver",
"direct": false,
"version": "12.0.4.66",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparse",
"direct": false,
"version": "12.6.3.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparselt-cu13",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu12",
"direct": false,
"version": "2.30.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu13",
"direct": false,
"version": "2.29.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvjitlink",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvshmem-cu13",
"direct": false,
"version": "3.4.5",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvtx",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "omegaconf",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "onnx",
"direct": false,
"version": "1.22.0",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.24.3",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.26.0",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-api",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-proto",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-sdk",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-semantic-conventions",
"direct": false,
"version": "0.63b1",
"ecosystem": "pypi"
},
{
"name": "optuna",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "orderly-set",
"direct": false,
"version": "5.5.0",
"ecosystem": "pypi"
},
{
"name": "packaging",
"direct": false,
"version": "26.2",
"ecosystem": "pypi"
},
{
"name": "paginate",
"direct": false,
"version": "0.5.7",
"ecosystem": "pypi"
},
{
"name": "paramiko",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "parso",
"direct": false,
"version": "0.8.7",
"ecosystem": "pypi"
},
{
"name": "pathspec",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pexpect",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "pillow",
"direct": false,
"version": "12.2.0",
"ecosystem": "pypi"
},
{
"name": "platformdirs",
"direct": false,
"version": "4.10.0",
"ecosystem": "pypi"
},
{
"name": "plotly",
"direct": false,
"version": "6.8.0",
"ecosystem": "pypi"
},
{
"name": "pluggy",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "prettytable",
"direct": false,
"version": "3.17.0",
"ecosystem": "pypi"
},
{
"name": "prompt-toolkit",
"direct": false,
"version": "3.0.52",
"ecosystem": "pypi"
},
{
"name": "propcache",
"direct": false,
"version": "0.5.2",
"ecosystem": "pypi"
},
{
"name": "protobuf",
"direct": false,
"version": "6.33.6",
"ecosystem": "pypi"
},
{
"name": "psutil",
"direct": false,
"version": "7.2.2",
"ecosystem": "pypi"
},
{
"name": "ptyprocess",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "publication",
"direct": false,
"version": "0.0.3",
"ecosystem": "pypi"
},
{
"name": "pure-eval",
"direct": false,
"version": "0.2.3",
"ecosystem": "pypi"
},
{
"name": "pyarrow",
"direct": false,
"version": "24.0.0",
"ecosystem": "pypi"
},
{
"name": "pyasn1",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "pyasn1-modules",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "pycodestyle",
"direct": false,
"version": "2.14.0",
"ecosystem": "pypi"
},
{
"name": "pycparser",
"direct": false,
"version": "3.0",
"ecosystem": "pypi"
},
{
"name": "pydantic",
"direct": false,
"version": "2.13.4",
"ecosystem": "pypi"
},
{
"name": "pydantic-core",
"direct": false,
"version": "2.46.4",
"ecosystem": "pypi"
},
{
"name": "pyflakes",
"direct": false,
"version": "3.4.0",
"ecosystem": "pypi"
},
{
"name": "pygments",
"direct": false,
"version": "2.20.0",
"ecosystem": "pypi"
},
{
"name": "pyiceberg",
"direct": false,
"version": "0.11.1",
"ecosystem": "pypi"
},
{
"name": "pymdown-extensions",
"direct": false,
"version": "11.0.1",
"ecosystem": "pypi"
},
{
"name": "pynacl",
"direct": false,
"version": "1.6.2",
"ecosystem": "pypi"
},
{
"name": "pynndescent",
"direct": false,
"version": "0.6.0",
"ecosystem": "pypi"
},
{
"name": "pyparsing",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "pyroaring",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": "9.0.3",
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pytest-xdist",
"direct": false,
"version": "3.8.0",
"ecosystem": "pypi"
},
{
"name": "python-dateutil",
"direct": false,
"version": "2.9.0.post0",
"ecosystem": "pypi"
},
{
"name": "python-dotenv",
"direct": false,
"version": "1.2.2",
"ecosystem": "pypi"
},
{
"name": "python-rapidjson",
"direct": false,
"version": "1.23",
"ecosystem": "pypi"
},
{
"name": "pytokens",
"direct": false,
"version": "0.4.1",
"ecosystem": "pypi"
},
{
"name": "pytz",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "pywin32",
"direct": false,
"version": "312",
"ecosystem": "pypi"
},
{
"name": "pyyaml",
"direct": false,
"version": "6.0.3",
"ecosystem": "pypi"
},
{
"name": "pyyaml-env-tag",
"direct": false,
"version": "1.1",
"ecosystem": "pypi"
},
{
"name": "ray",
"direct": false,
"version": "2.56.0",
"ecosystem": "pypi"
},
{
"name": "referencing",
"direct": false,
"version": "0.37.0",
"ecosystem": "pypi"
},
{
"name": "retrying",
"direct": false,
"version": "1.4.2",
"ecosystem": "pypi"
},
{
"name": "rich",
"direct": false,
"version": "14.3.4",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "0.30.0",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "2026.5.1",
"ecosystem": "pypi"
},
{
"name": "s3fs",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "s3transfer",
"direct": false,
"version": "0.17.1",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlflow",
"direct": false,
"version": "0.4.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-schema-inference-artifacts",
"direct": false,
"version": "0.0.5",
"ecosystem": "pypi"
},
{
"name": "schema",
"direct": false,
"version": "0.7.8",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.15.3",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.17.1",
"ecosystem": "pypi"
},
{
"name": "setuptools",
"direct": false,
"version": "81.0.0",
"ecosystem": "pypi"
},
{
"name": "shap",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "six",
"direct": false,
"version": "1.17.0",
"ecosystem": "pypi"
},
{
"name": "skops",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "smdebug-rulesconfig",
"direct": false,
"version": "1.0.1",
"ecosystem": "pypi"
},
{
"name": "smmap",
"direct": false,
"version": "5.0.3",
"ecosystem": "pypi"
},
{
"name": "sqlalchemy",
"direct": false,
"version": "2.0.50",
"ecosystem": "pypi"
},
{
"name": "sqlparse",
"direct": false,
"version": "0.5.5",
"ecosystem": "pypi"
},
{
"name": "stack-data",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "starlette",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "strictyaml",
"direct": false,
"version": "1.7.3",
"ecosystem": "pypi"
},
{
"name": "sympy",
"direct": false,
"version": "1.14.0",
"ecosystem": "pypi"
},
{
"name": "tblib",
"direct": false,
"version": "3.2.2",
"ecosystem": "pypi"
},
{
"name": "tenacity",
"direct": false,
"version": "9.1.4",
"ecosystem": "pypi"
},
{
"name": "tensorboardx",
"direct": false,
"version": "2.6.5",
"ecosystem": "pypi"
},
{
"name": "termcolor",
"direct": false,
"version": "3.3.0",
"ecosystem": "pypi"
},
{
"name": "threadpoolctl",
"direct": false,
"version": "3.6.0",
"ecosystem": "pypi"
},
{
"name": "tomli",
"direct": false,
"version": "2.4.1",
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": "4.68.2",
"ecosystem": "pypi"
},
{
"name": "traitlets",
"direct": false,
"version": "5.15.1",
"ecosystem": "pypi"
},
{
"name": "triton",
"direct": false,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "tritonclient",
"direct": false,
"version": "2.69.0",
"ecosystem": "pypi"
},
{
"name": "typeguard",
"direct": false,
"version": "2.13.3",
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": false,
"version": "4.15.0",
"ecosystem": "pypi"
},
{
"name": "typing-inspection",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "tzdata",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": "0.5.12",
"ecosystem": "pypi"
},
{
"name": "urllib3",
"direct": false,
"version": "2.7.0",
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": "0.49.0",
"ecosystem": "pypi"
},
{
"name": "waitress",
"direct": false,
"version": "3.0.2",
"ecosystem": "pypi"
},
{
"name": "watchdog",
"direct": false,
"version": "6.0.0",
"ecosystem": "pypi"
},
{
"name": "wcwidth",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "werkzeug",
"direct": false,
"version": "3.1.8",
"ecosystem": "pypi"
},
{
"name": "wrapt",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "xgboost-cpu",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "yarl",
"direct": false,
"version": "1.24.2",
"ecosystem": "pypi"
},
{
"name": "zipp",
"direct": false,
"version": "4.1.0",
"ecosystem": "pypi"
},
{
"name": "zope-event",
"direct": false,
"version": "6.2",
"ecosystem": "pypi"
},
{
"name": "zope-interface",
"direct": false,
"version": "8.5",
"ecosystem": "pypi"
},
{
"name": "zstandard",
"direct": false,
"version": "0.25.0",
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 295,
"direct_count": 35,
"indirect_count": 260
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 81,
"open_issues": 192,
"closed_ratio": 0.605,
"closed_issues": 294,
"closed_unmerged_prs": 31
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "brifordwylie",
"commits": 7193,
"avatar_url": "https://avatars.githubusercontent.com/u/4806709?u=4621f8834a58a072c0487a11c1a464ba79001d85&v=4"
},
{
"type": "User",
"login": "ScottKolmarWFI",
"commits": 47,
"avatar_url": "https://avatars.githubusercontent.com/u/103940733?u=66d82044a9f6ec5a505b6b5dad879448881f2e78&v=4"
},
{
"type": "User",
"login": "giupb",
"commits": 32,
"avatar_url": "https://avatars.githubusercontent.com/u/52609794?u=7e31f70e3b071aecc0ca8da0971ed6e7e05a1fdf&v=4"
},
{
"type": "User",
"login": "luiztauffer",
"commits": 17,
"avatar_url": "https://avatars.githubusercontent.com/u/24541631?u=982d8cef4df0c59e59ce14dc54909c10dded7905&v=4"
},
{
"type": "User",
"login": "sdidier-dev",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/73602526?u=c6239ee652448f997bfd774484b5163faa2d691c&v=4"
},
{
"type": "User",
"login": "andrew-huynh",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/86267299?u=e6337b661122f0d3838a6ea2746649992a30e3a1&v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "User",
"login": "keilogic",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/189083319?v=4"
}
],
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"aws-tests.yml",
"deploy-docs.yml",
"endpoint-import-smoke.yml",
"gitleaks.yml",
"lockfile-drift.yml",
"publish.yml",
"python-lint.yml"
],
"has_docs_dir": true,
"linter_configs": [
".flake8",
"tox.ini"
],
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"security_signals": {
"lockfiles": [
"uv.lock"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 6 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 0,
"reason": "10 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "fc6c71b64a7b3506b6a1b4d5feac6fbc5eb225fb",
"ran_at": "2026-07-18T17:24:45Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/SuperCowPowers/workbench",
"host": "github.com",
"name": "workbench",
"owner": "SuperCowPowers"
},
"metrics": {
"overall": {
"key": "overall",
"band": "good",
"name": "Overall health",
"note": null,
"notes": [],
"value": 72,
"inputs": {
"security": 50,
"vitality": 96,
"community": 57,
"governance": 58,
"engineering": 95
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 96,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"commits_last_year": 2128,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 52
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "52/52 weeks with commits",
"points": 36,
"status": "met",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 52
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "2128 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 2128
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 100,
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~1.1 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 1.1
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"forks": 7,
"stars": 51,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "51 stars",
"points": 27.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 51
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "7 forks",
"points": 6.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 7
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 67,
"inputs": {
"packages": [
"workbench"
],
"dependents": null,
"ecosystems": "pypi",
"total_downloads": null,
"monthly_downloads": 10144
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "10,144 downloads/month across pypi",
"points": 53.4,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 10144,
"ecosystems": "pypi"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 58,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 30,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.3,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "8 contributors",
"points": 10.8,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 8
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"merged_prs": 81,
"open_issues": 192,
"closed_issues": 294,
"issue_closed_ratio": 0.605,
"closed_unmerged_prs": 31
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "60% of issues closed",
"points": 28.3,
"status": "partial",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 60
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "81/112 decided PRs merged",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 81,
"decided": 112
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"followers": 29,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "SuperCowPowers",
"public_repos": 13,
"account_age_days": 4513
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "29 followers of SuperCowPowers",
"points": 10.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 29,
"login": "SuperCowPowers"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "13 public repos, account ~12 yr old",
"points": 20.3,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 13
}
},
{
"code": "account_age_years",
"params": {
"years": 12
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"workbench"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "330 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 330
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "excellent",
"name": "Engineering Quality",
"value": 95,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "excellent",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "7 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 7
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": ".flake8, tox.ini",
"points": 16,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 9.6,
"status": "met",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "excellent",
"name": "Documentation",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://www.supercowpowers.com",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "7 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 7
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 50,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "10 existing vulnerabilities detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 3
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 44,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 73,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"uv.lock"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"Makefile"
],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": ".flake8, tox.ini",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "4/637 source files over 60KB",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 637,
"oversized": 4
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples",
"notebooks"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples, notebooks",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples, notebooks"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-18T17:25:10.029741Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/s/SuperCowPowers/workbench.svg",
"full_name": "SuperCowPowers/workbench",
"license_state": "standard",
"license_spdx": "MIT"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.14.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — PyPI.