Registro públicoBueno
Informe de salud del softwareesquema 0.14.0 · métricas 1.13.0 · 2026-07-18 17:25 UTC
SuperCowPowers / workbench
Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models
SuperCowPowers/workbench tiene un índice de salud de 72 sobre 100, lo que lo sitúa en la banda Bueno. Su puntuación más alta es Vitality (96/100) y la más baja, AI Readiness (44/100). Se actualizó por última vez hoy. Una sola persona concentra la mayor parte del trabajo reciente.
72
global / 100Índice de salud del software
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
72
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
Perfil de puntuación
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Titularidad
SuperCowPowersOrganización
29 seguidores13 repositorios públicosdesde mar 2014
Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.
Ecosistemas de paquetes
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| PyPI | workbench | 0.8.409 | 10.144 | 330 | hace 0 días | sagemakermachine-learningawspythonutilities |
Métricas por categoría
Vitalidad
¿Está vivo el proyecto: se escribe código y se publican versiones?
96
Actividad de desarrollo
100Excelente
Cómo se puntúa
| 36/36 | Recencia de push — último push hace 0 días |
| 36/36 | Cadencia de commits — 52/52 semanas con commits |
| 18/18 | Volumen de commits — 2128 commits en el último año |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
Datos de entrada utilizados
| commits_last_year | 2128 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 52 |
Disciplina de publicación
90Excelente
Cómo se puntúa
| 27/27 | Publica versiones — 100 versiones publicadas |
| 36/36 | Recencia de las versiones — última versión hace 0 días |
| 27/27 | Cadencia de publicación — una versión cada ~1,1 días |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
Datos de entrada utilizados
| releases_count | 100 |
| latest_release_tag | v0.8.409 |
| releases_from_tags | no |
| days_since_latest_release | 0 |
| mean_days_between_releases | 1,1 |
Comunidad y Adopción
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
57
Popularidad y adopción
34En riesgo
Cómo se puntúa
| 27.6/60 | Estrellas — 51 estrellas |
| 6.5/25 | Forks — 7 forks |
| 0/15 | Observadores — 2 observadores |
Datos de entrada utilizados
| forks | 7 |
| stars | 51 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Salud de la comunidad
77Bueno
Cómo se puntúa
| 22.5/22.5 | README |
| 22.5/22.5 | Licencia — licencia reconocida (MIT) |
| 18/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 6.3/6.3 | Plantilla de PR |
Datos de entrada utilizados
| has_readme | sí |
| has_license | sí |
| has_contributing | sí |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | sí |
Adopción en el ecosistema (descargas)
67Moderado
Cómo se puntúa
| 53.4/80 | Descargas mensuales — 10.144 descargas/mes en pypi |
| 0/20 | Dependientes en el registro — no lo informa este ecosistema |
Datos de entrada utilizados
| packages | workbench |
| dependents | — |
| ecosystems | pypi |
| total_downloads | — |
| monthly_downloads | 10.144 |
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.
Sostenibilidad y Gobernanza
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
58
Resiliencia de mantenedores (factor bus)
30En riesgo
Cómo se puntúa
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 0.3/22.5 | Distribución de commits — el principal contribuyente firma el 99% de los commits |
| 10.8/13.5 | Amplitud de contribuyentes — 8 contribuyentes |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
Datos de entrada utilizados
| bus_factor | 1 |
| contributors_sampled | 8 |
| top_contributor_share | 0,986 |
Capacidad de respuesta a issues y PR
56Moderado
Cómo se puntúa
| 28.3/46.8 | Resolución de issues — 60% de issues cerradas |
| 27.7/38.3 | Aceptación de PR — 81/112 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Datos de entrada utilizados
| merged_prs | 81 |
| open_issues | 192 |
| closed_issues | 294 |
| issue_closed_ratio | 0,605 |
| closed_unmerged_prs | 31 |
Propiedad y custodia
61Moderado
Cómo se puntúa
| 30/30 | Respaldo de la propiedad — propiedad de una organización |
| 0/20 | Dominio verificado |
| 10.6/25 | Alcance del propietario — 29 seguidores de SuperCowPowers |
| 20.3/25 | Trayectoria — 13 repos públicos, cuenta de ~12 años |
Datos de entrada utilizados
| followers | 29 |
| owner_type | Organization |
| is_verified | — |
| owner_login | SuperCowPowers |
| public_repos | 13 |
| account_age_days | 4513 |
Mantenimiento de paquetes
100Excelente
Cómo se puntúa
| 25/25 | Publicado y resoluble — 1 paquete(s) en pypi |
| 35/35 | Recencia de publicación — última publicación hace 0 días |
| 20/20 | Historial de versiones — 330 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
Datos de entrada utilizados
| packages | workbench |
| ecosystems | pypi |
| any_deprecated | no |
| min_days_since_publish | 0 |
Calidad de Ingeniería
¿Existen unas prácticas mínimas de ingeniería y documentación?
95
Prácticas de ingeniería
92Excelente
Cómo se puntúa
| 24/24 | Flujos de trabajo de CI — 7 flujo(s) de trabajo |
| 24/24 | Pruebas presentes |
| 16/16 | Configuración de linter — .flake8, tox.ini |
| 9.6/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — sin datos |
Datos de entrada utilizados
| has_ci | sí |
| has_tests | sí |
| has_editorconfig | no |
| has_linter_config | sí |
| has_precommit_config | sí |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: CI-Tests. Los pesos restantes se han renormalizado.
Documentación
100Excelente
Cómo se puntúa
| 30/30 | README |
| 25/25 | Directorio de documentación |
| 15/15 | Sitio de documentación / página del proyecto — https://www.supercowpowers.com |
| 10/10 | Descripción del repositorio |
| 10/10 | Topics — 7 topics |
| 10/10 | Wiki |
Datos de entrada utilizados
| topics | aws, big-data, machine-learning, python, spark, data-engineering, pandas |
| has_wiki | sí |
| homepage | https://www.supercowpowers.com |
| has_readme | sí |
| has_docs_dir | sí |
| has_description | sí |
Seguridad
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
50
Postura de seguridad
50Moderado
Cómo se puntúa
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — sin datos |
| 0/2.5 | CI-Tests — sin datos |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Licencia — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 10 existing vulnerabilities detected |
Datos de entrada utilizados
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
Excluidos de la puntuación (sin datos o no aplicable): branch_protection, ci_tests. Los pesos restantes se han renormalizado.
Preparación para IA
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
44
Contexto y guía para agentes
1Crítico
Cómo se puntúa
| 0/45 | Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 0/40 | Historial de commits legible — sin datos |
Datos de entrada utilizados
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Excluidos de la puntuación (sin datos o no aplicable): Historial de commits legible. Los pesos restantes se han renormalizado.
Cómo se puntúa
| 18/18 | Arranque con un solo comando — Makefile |
| 22/22 | Pruebas automatizadas |
| 11/11 | Configuración de lint / formato — .flake8, tox.ini |
| 0/11 | Verificación estática de tipos |
| 10/10 | Entorno reproducible — Dockerfile, lockfile |
| 0/10 | Práctica demostrada con agentes — sin datos |
| 5/8 | Mantenimiento automatizado — automatización de dependencias configurada, no observada en los commits muestreados |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Datos de entrada utilizados
| has_nix | no |
| has_tests | sí |
| lockfiles | uv.lock |
| has_dockerfile | sí |
| typed_language | no |
| bootstrap_files | Makefile |
| has_devcontainer | no |
| has_linter_config | sí |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Excluidos de la puntuación (sin datos o no aplicable): Práctica demostrada con agentes. Los pesos restantes se han renormalizado.
Legibilidad del código para modelos
55Moderado
Cómo se puntúa
| 0/45 | Código verificable por tipos — Python sin configuración de verificación de tipos |
| 54.7/55 | Tamaños de archivo manejables — 4/637 archivos fuente de más de 60 KB |
Datos de entrada utilizados
| primary_language | Python |
| largest_source_bytes | 70.242 |
| source_files_sampled | 637 |
| oversized_source_files | 4 |
Interfaces legibles por máquina
40En riesgo
Cómo se puntúa
| 0/40 | Esquema de API (OpenAPI/GraphQL/proto) |
| 0/20 | Servidor MCP |
| 40/40 | Ejemplos ejecutables — examples, notebooks |
Datos de entrada utilizados
| example_dirs | examples, notebooks |
| has_mcp_signal | no |
| api_schema_files | — |
Datos clave
51estrellas de GitHub
8contribuidores
2128commits en los últimos 12 meses
0días desde el último push
100versiones publicadas
1factor bus
192issues abiertas
PyPIecosistemas de paquetes
Más detalle
OpenSSF Scorecard 5.0 / 10
5.0agregado
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/d | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| n/d | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 10 existing vulnerabilities detected |
Dependencias directas 22
| Registro | Paquete | Restricción de versión | Manifiesto |
|---|---|---|---|
| PyPI | boto3 | >= 1.42.2 | pyproject.toml |
| PyPI | botocore | >= 1.42.2 | pyproject.toml |
| PyPI | awswrangler | >= 3.4.0 | pyproject.toml |
| PyPI | sagemaker | >= 3.6.0, < 3.13 | pyproject.toml |
| PyPI | sagemaker-core | >= 2.12.0, < 2.13 | pyproject.toml |
| PyPI | sagemaker-mlops | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-serve | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-train | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | redis | >= 5.0.1 | pyproject.toml |
| PyPI | cryptography | >= 46.0.0 | pyproject.toml |
| PyPI | requests | >= 2.26.0 | pyproject.toml |
| PyPI | aiobotocore | >= 3.7.0 | pyproject.toml |
| PyPI | pandas | >= 2.2.1, < 3.0 | pyproject.toml |
| PyPI | scikit-learn | >= 1.5.2 | pyproject.toml |
| PyPI | xgboost | >= 3.0.3 | pyproject.toml |
| PyPI | joblib | >= 1.3.2 | pyproject.toml |
| PyPI | rdkit | >= 2026.3.1 | pyproject.toml |
| PyPI | mordredcommunity | >= 2.0.6 | pyproject.toml |
| PyPI | ipython | >= 8.37.0 | pyproject.toml |
| PyPI | pyreadline3 | — | pyproject.toml |
| PyPI | matplotlib | >= 3.9.2 | pyproject.toml |
| PyPI | networkx | >= 3.2 | pyproject.toml |
Todas las dependencias 295
Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 35 paquetes directos y 260 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.
| Registro | Paquete | Versión | Relación |
|---|---|---|---|
| PyPI | aiobotocore | 3.7.0 | directa |
| PyPI | awswrangler | — | directa |
| PyPI | awswrangler | 3.16.1 | directa |
| PyPI | boto3 | — | directa |
| PyPI | boto3 | 1.43.0 | directa |
| PyPI | botocore | — | directa |
| PyPI | botocore | 1.43.0 | directa |
| PyPI | cryptography | 48.0.1 | directa |
| PyPI | ipython | 8.39.0 | directa |
| PyPI | ipython | 9.14.1 | directa |
| PyPI | joblib | — | directa |
| PyPI | joblib | 1.5.3 | directa |
| PyPI | matplotlib | 3.10.9 | directa |
| PyPI | mordredcommunity | — | directa |
| PyPI | mordredcommunity | 2.0.7 | directa |
| PyPI | networkx | — | directa |
| PyPI | networkx | 3.4.2 | directa |
| PyPI | networkx | 3.6.1 | directa |
| PyPI | pandas | — | directa |
| PyPI | pandas | 2.3.3 | directa |
| PyPI | pyreadline3 | 3.5.6 | directa |
| PyPI | rdkit | — | directa |
| PyPI | rdkit | 2026.3.3 | directa |
| PyPI | redis | 8.0.0 | directa |
| PyPI | requests | — | directa |
| PyPI | requests | 2.34.2 | directa |
| PyPI | sagemaker | 3.12.0 | directa |
| PyPI | sagemaker-core | 2.12.0 | directa |
| PyPI | sagemaker-mlops | 1.12.0 | directa |
| PyPI | sagemaker-serve | 1.12.0 | directa |
| PyPI | sagemaker-train | 1.12.0 | directa |
| PyPI | scikit-learn | — | directa |
| PyPI | scikit-learn | 1.7.2 | directa |
| PyPI | scikit-learn | 1.9.0 | directa |
| PyPI | xgboost | 3.2.0 | directa |
| PyPI | aiohappyeyeballs | 2.6.2 | indirecta |
| PyPI | aiohttp | 3.14.1 | indirecta |
| PyPI | aioitertools | 0.13.0 | indirecta |
| PyPI | aiosignal | 1.4.0 | indirecta |
| PyPI | alembic | 1.18.4 | indirecta |
| PyPI | annotated-doc | 0.0.4 | indirecta |
| PyPI | annotated-types | 0.7.0 | indirecta |
| PyPI | antlr4-python3-runtime | 4.9.3 | indirecta |
| PyPI | anyio | 4.13.0 | indirecta |
| PyPI | asgiref | — | indirecta |
| PyPI | asttokens | 3.0.1 | indirecta |
| PyPI | async-timeout | 5.0.1 | indirecta |
| PyPI | attrs | 26.1.0 | indirecta |
| PyPI | aws-cdk-asset-awscli-v1 | 2.2.282 | indirecta |
| PyPI | aws-cdk-asset-node-proxy-agent-v6 | 2.1.2 | indirecta |
| PyPI | aws-cdk-cloud-assembly-schema | 54.8.0 | indirecta |
| PyPI | aws-cdk-lib | — | indirecta |
| PyPI | aws-cdk-lib | 2.211.0 | indirecta |
| PyPI | aws-cdk-lib | 2.261.0 | indirecta |
| PyPI | babel | 2.18.0 | indirecta |
| PyPI | backrefs | 7.0 | indirecta |
| PyPI | bcrypt | 5.0.0 | indirecta |
| PyPI | black | — | indirecta |
| PyPI | black | 26.5.1 | indirecta |
| PyPI | blinker | 1.9.0 | indirecta |
| PyPI | brotli | 1.2.0 | indirecta |
| PyPI | cachebox | 5.2.3 | indirecta |
| PyPI | cachetools | 6.2.6 | indirecta |
| PyPI | cattrs | 26.1.0 | indirecta |
| PyPI | certifi | 2026.5.20 | indirecta |
| PyPI | cffi | 2.0.0 | indirecta |
| PyPI | charset-normalizer | 3.4.7 | indirecta |
| PyPI | chemprop | — | indirecta |
| PyPI | click | 8.4.1 | indirecta |
| PyPI | cloudpickle | 3.1.2 | indirecta |
| PyPI | colorama | 0.4.6 | indirecta |
| PyPI | colorlog | 6.10.1 | indirecta |
| PyPI | constructs | — | indirecta |
| PyPI | constructs | 10.6.0 | indirecta |
| PyPI | contourpy | 1.3.2 | indirecta |
| PyPI | contourpy | 1.3.3 | indirecta |
| PyPI | coverage | — | indirecta |
| PyPI | coverage | 7.14.1 | indirecta |
| PyPI | cuda-bindings | 13.3.1 | indirecta |
| PyPI | cuda-pathfinder | 1.5.5 | indirecta |
| PyPI | cuda-toolkit | 13.0.2 | indirecta |
| PyPI | cycler | 0.12.1 | indirecta |
| PyPI | dash | 4.2.0 | indirecta |
| PyPI | dash-ag-grid | 35.2.0 | indirecta |
| PyPI | dash-bootstrap-components | 2.0.4 | indirecta |
| PyPI | databricks-sdk | 0.116.0 | indirecta |
| PyPI | decorator | 5.3.1 | indirecta |
| PyPI | deepdiff | 9.1.0 | indirecta |
| PyPI | docker | 7.1.0 | indirecta |
| PyPI | exceptiongroup | 1.3.1 | indirecta |
| PyPI | execnet | 2.1.2 | indirecta |
| PyPI | executing | 2.2.1 | indirecta |
| PyPI | fastapi | — | indirecta |
| PyPI | fastapi | 0.136.3 | indirecta |
| PyPI | filelock | 3.29.3 | indirecta |
| PyPI | flake8 | — | indirecta |
| PyPI | flake8 | 7.3.0 | indirecta |
| PyPI | flask | 3.1.3 | indirecta |
| PyPI | flask-cors | 6.0.5 | indirecta |
| PyPI | flatbuffers | 25.12.19 | indirecta |
| PyPI | fonttools | 4.63.0 | indirecta |
| PyPI | frozenlist | 1.8.0 | indirecta |
| PyPI | fsspec | 2026.4.0 | indirecta |
| PyPI | gevent | 26.5.0 | indirecta |
| PyPI | geventhttpclient | 2.3.9 | indirecta |
| PyPI | ghp-import | 2.1.0 | indirecta |
| PyPI | gitdb | 4.0.12 | indirecta |
| PyPI | gitpython | 3.1.50 | indirecta |
| PyPI | google-auth | 2.53.0 | indirecta |
| PyPI | graphene | 3.4.3 | indirecta |
| PyPI | graphql-core | 3.2.11 | indirecta |
| PyPI | graphql-relay | 3.2.0 | indirecta |
| PyPI | greenlet | 3.3.2 | indirecta |
| PyPI | griffelib | 2.1.0 | indirecta |
| PyPI | gunicorn | 26.0.0 | indirecta |
| PyPI | h11 | 0.16.0 | indirecta |
| PyPI | huey | 3.0.1 | indirecta |
| PyPI | idna | 3.18 | indirecta |
| PyPI | importlib-metadata | 6.11.0 | indirecta |
| PyPI | iniconfig | 2.3.0 | indirecta |
| PyPI | invoke | 3.0.3 | indirecta |
| PyPI | ipython-pygments-lexers | 1.1.1 | indirecta |
| PyPI | itsdangerous | 2.2.0 | indirecta |
| PyPI | janus | 2.0.0 | indirecta |
| PyPI | jedi | 0.20.0 | indirecta |
| PyPI | jinja2 | 3.1.6 | indirecta |
| PyPI | jmespath | 1.1.0 | indirecta |
| PyPI | jsii | 1.138.0 | indirecta |
| PyPI | json5 | 0.14.0 | indirecta |
| PyPI | jsonschema | 4.26.0 | indirecta |
| PyPI | jsonschema-specifications | 2025.9.1 | indirecta |
| PyPI | kiwisolver | 1.5.0 | indirecta |
| PyPI | llvmlite | 0.47.0 | indirecta |
| PyPI | mako | 1.3.12 | indirecta |
| PyPI | markdown | 3.10.2 | indirecta |
| PyPI | markdown-it-py | 4.2.0 | indirecta |
| PyPI | markupsafe | 3.0.3 | indirecta |
| PyPI | matplotlib-inline | 0.2.2 | indirecta |
| PyPI | mccabe | 0.7.0 | indirecta |
| PyPI | mdurl | 0.1.2 | indirecta |
| PyPI | mergedeep | 1.3.4 | indirecta |
| PyPI | mkdocs | 1.6.1 | indirecta |
| PyPI | mkdocs-autorefs | 1.4.4 | indirecta |
| PyPI | mkdocs-get-deps | 0.2.2 | indirecta |
| PyPI | mkdocs-material | 9.7.7 | indirecta |
| PyPI | mkdocs-material-extensions | 1.3.1 | indirecta |
| PyPI | mkdocstrings | 1.0.6 | indirecta |
| PyPI | mkdocstrings-python | 2.0.5 | indirecta |
| PyPI | ml-dtypes | 0.5.4 | indirecta |
| PyPI | mlflow | 3.13.0 | indirecta |
| PyPI | mlflow-skinny | 3.13.0 | indirecta |
| PyPI | mlflow-tracing | 3.13.0 | indirecta |
| PyPI | mmh3 | 5.2.1 | indirecta |
| PyPI | mock | 4.0.3 | indirecta |
| PyPI | mpmath | 1.3.0 | indirecta |
| PyPI | msgpack | 1.2.1 | indirecta |
| PyPI | multidict | 6.7.1 | indirecta |
| PyPI | mypy-extensions | 1.1.0 | indirecta |
| PyPI | narwhals | 2.22.1 | indirecta |
| PyPI | nest-asyncio | 1.6.0 | indirecta |
| PyPI | numba | 0.65.1 | indirecta |
| PyPI | numpy | 2.2.6 | indirecta |
| PyPI | numpy | 2.4.6 | indirecta |
| PyPI | nvidia-cublas | 13.1.1.3 | indirecta |
| PyPI | nvidia-cuda-cupti | 13.0.85 | indirecta |
| PyPI | nvidia-cuda-nvrtc | 13.0.88 | indirecta |
| PyPI | nvidia-cuda-runtime | 13.0.96 | indirecta |
| PyPI | nvidia-cudnn-cu13 | 9.20.0.48 | indirecta |
| PyPI | nvidia-cufft | 12.0.0.61 | indirecta |
| PyPI | nvidia-cufile | 1.15.1.6 | indirecta |
| PyPI | nvidia-curand | 10.4.0.35 | indirecta |
| PyPI | nvidia-cusolver | 12.0.4.66 | indirecta |
| PyPI | nvidia-cusparse | 12.6.3.3 | indirecta |
| PyPI | nvidia-cusparselt-cu13 | 0.8.1 | indirecta |
| PyPI | nvidia-nccl-cu12 | 2.30.7 | indirecta |
| PyPI | nvidia-nccl-cu13 | 2.29.7 | indirecta |
| PyPI | nvidia-nvjitlink | 13.0.88 | indirecta |
| PyPI | nvidia-nvshmem-cu13 | 3.4.5 | indirecta |
| PyPI | nvidia-nvtx | 13.0.85 | indirecta |
| PyPI | omegaconf | 2.3.0 | indirecta |
| PyPI | onnx | 1.22.0 | indirecta |
| PyPI | onnxruntime | 1.24.3 | indirecta |
| PyPI | onnxruntime | 1.26.0 | indirecta |
| PyPI | opentelemetry-api | 1.42.1 | indirecta |
| PyPI | opentelemetry-proto | 1.42.1 | indirecta |
| PyPI | opentelemetry-sdk | 1.42.1 | indirecta |
| PyPI | opentelemetry-semantic-conventions | 0.63b1 | indirecta |
| PyPI | optuna | 4.9.0 | indirecta |
| PyPI | orderly-set | 5.5.0 | indirecta |
| PyPI | packaging | 26.2 | indirecta |
| PyPI | paginate | 0.5.7 | indirecta |
| PyPI | paramiko | 5.0.0 | indirecta |
| PyPI | parso | 0.8.7 | indirecta |
| PyPI | pathspec | 1.1.1 | indirecta |
| PyPI | pexpect | 4.9.0 | indirecta |
| PyPI | pillow | 12.2.0 | indirecta |
| PyPI | platformdirs | 4.10.0 | indirecta |
| PyPI | plotly | 6.8.0 | indirecta |
| PyPI | pluggy | 1.6.0 | indirecta |
| PyPI | prettytable | 3.17.0 | indirecta |
| PyPI | prompt-toolkit | 3.0.52 | indirecta |
| PyPI | propcache | 0.5.2 | indirecta |
| PyPI | protobuf | 6.33.6 | indirecta |
| PyPI | psutil | 7.2.2 | indirecta |
| PyPI | ptyprocess | 0.7.0 | indirecta |
| PyPI | publication | 0.0.3 | indirecta |
| PyPI | pure-eval | 0.2.3 | indirecta |
| PyPI | pyarrow | 24.0.0 | indirecta |
| PyPI | pyasn1 | 0.6.3 | indirecta |
| PyPI | pyasn1-modules | 0.4.2 | indirecta |
| PyPI | pycodestyle | 2.14.0 | indirecta |
| PyPI | pycparser | 3.0 | indirecta |
| PyPI | pydantic | 2.13.4 | indirecta |
| PyPI | pydantic-core | 2.46.4 | indirecta |
| PyPI | pyflakes | 3.4.0 | indirecta |
| PyPI | pygments | 2.20.0 | indirecta |
| PyPI | pyiceberg | 0.11.1 | indirecta |
| PyPI | pymdown-extensions | 11.0.1 | indirecta |
| PyPI | pynacl | 1.6.2 | indirecta |
| PyPI | pynndescent | 0.6.0 | indirecta |
| PyPI | pyparsing | 3.3.2 | indirecta |
| PyPI | pyroaring | 1.1.0 | indirecta |
| PyPI | pytest | — | indirecta |
| PyPI | pytest | 9.0.3 | indirecta |
| PyPI | pytest-cov | — | indirecta |
| PyPI | pytest-cov | 7.1.0 | indirecta |
| PyPI | pytest-sugar | — | indirecta |
| PyPI | pytest-sugar | 1.1.1 | indirecta |
| PyPI | pytest-xdist | 3.8.0 | indirecta |
| PyPI | python-dateutil | 2.9.0.post0 | indirecta |
| PyPI | python-dotenv | 1.2.2 | indirecta |
| PyPI | python-rapidjson | 1.23 | indirecta |
| PyPI | pytokens | 0.4.1 | indirecta |
| PyPI | pytz | 2026.2 | indirecta |
| PyPI | pywin32 | 312 | indirecta |
| PyPI | pyyaml | 6.0.3 | indirecta |
| PyPI | pyyaml-env-tag | 1.1 | indirecta |
| PyPI | ray | 2.56.0 | indirecta |
| PyPI | referencing | 0.37.0 | indirecta |
| PyPI | retrying | 1.4.2 | indirecta |
| PyPI | rich | 14.3.4 | indirecta |
| PyPI | rpds-py | 0.30.0 | indirecta |
| PyPI | rpds-py | 2026.5.1 | indirecta |
| PyPI | s3fs | 2026.4.0 | indirecta |
| PyPI | s3transfer | 0.17.1 | indirecta |
| PyPI | sagemaker-mlflow | 0.4.0 | indirecta |
| PyPI | sagemaker-schema-inference-artifacts | 0.0.5 | indirecta |
| PyPI | schema | 0.7.8 | indirecta |
| PyPI | scipy | 1.15.3 | indirecta |
| PyPI | scipy | 1.17.1 | indirecta |
| PyPI | setuptools | 81.0.0 | indirecta |
| PyPI | shap | — | indirecta |
| PyPI | six | 1.17.0 | indirecta |
| PyPI | skops | 0.14.0 | indirecta |
| PyPI | smdebug-rulesconfig | 1.0.1 | indirecta |
| PyPI | smmap | 5.0.3 | indirecta |
| PyPI | sqlalchemy | 2.0.50 | indirecta |
| PyPI | sqlparse | 0.5.5 | indirecta |
| PyPI | stack-data | 0.6.3 | indirecta |
| PyPI | starlette | 1.3.1 | indirecta |
| PyPI | strictyaml | 1.7.3 | indirecta |
| PyPI | sympy | 1.14.0 | indirecta |
| PyPI | tblib | 3.2.2 | indirecta |
| PyPI | tenacity | 9.1.4 | indirecta |
| PyPI | tensorboardx | 2.6.5 | indirecta |
| PyPI | termcolor | 3.3.0 | indirecta |
| PyPI | threadpoolctl | 3.6.0 | indirecta |
| PyPI | tomli | 2.4.1 | indirecta |
| PyPI | torch | — | indirecta |
| PyPI | torch | 2.12.0 | indirecta |
| PyPI | tqdm | — | indirecta |
| PyPI | tqdm | 4.68.2 | indirecta |
| PyPI | traitlets | 5.15.1 | indirecta |
| PyPI | triton | 3.7.0 | indirecta |
| PyPI | tritonclient | 2.69.0 | indirecta |
| PyPI | typeguard | 2.13.3 | indirecta |
| PyPI | typing-extensions | 4.15.0 | indirecta |
| PyPI | typing-inspection | 0.4.2 | indirecta |
| PyPI | tzdata | 2026.2 | indirecta |
| PyPI | umap-learn | — | indirecta |
| PyPI | umap-learn | 0.5.12 | indirecta |
| PyPI | urllib3 | 2.7.0 | indirecta |
| PyPI | uvicorn | — | indirecta |
| PyPI | uvicorn | 0.49.0 | indirecta |
| PyPI | waitress | 3.0.2 | indirecta |
| PyPI | watchdog | 6.0.0 | indirecta |
| PyPI | wcwidth | 0.8.1 | indirecta |
| PyPI | werkzeug | 3.1.8 | indirecta |
| PyPI | wrapt | 2.2.1 | indirecta |
| PyPI | xgboost-cpu | — | indirecta |
| PyPI | yarl | 1.24.2 | indirecta |
| PyPI | zipp | 4.1.0 | indirecta |
| PyPI | zope-event | 6.2 | indirecta |
| PyPI | zope-interface | 8.5 | indirecta |
| PyPI | zstandard | 0.25.0 | indirecta |
Informe JSON sin procesar legible por máquina
{
"data": {
"repo": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"is_fork": false,
"size_kb": 91631,
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"languages": {
"CSS": 62868,
"Shell": 29010,
"Python": 3687778,
"Makefile": 971,
"Batchfile": 874,
"Dockerfile": 12108,
"JavaScript": 46472,
"Jupyter Notebook": 81119
},
"pushed_at": "2026-07-18T17:24:31Z",
"created_at": "2022-12-06T17:41:31Z",
"owner_type": "Organization",
"updated_at": "2026-07-18T17:24:34Z",
"description": "Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://www.supercowpowers.com",
"name": "SuperCowPowers",
"type": "Organization",
"login": "SuperCowPowers",
"company": null,
"location": "United States of America",
"followers": 29,
"avatar_url": "https://avatars.githubusercontent.com/u/6900187?v=4",
"created_at": "2014-03-09T18:36:12Z",
"is_verified": null,
"public_repos": 13,
"account_age_days": 4513
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 100,
"commits_last_year": 2128,
"latest_release_at": "2026-07-18T17:24:11Z",
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 52,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 75,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "workbench",
"exists": true,
"license": null,
"keywords": [
"SageMaker",
"Machine Learning",
"AWS",
"Python",
"Utilities",
"Development Status :: 4 - Beta",
"Programming Language :: Python :: 3.10",
"Programming Language :: Python :: 3.11",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Topic :: Scientific/Engineering"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/workbench/",
"is_deprecated": false,
"latest_version": "0.8.409",
"repository_url": "https://github.com/SuperCowPowers/workbench",
"versions_count": 330,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 10144,
"first_published_at": "2014-07-08T00:59:42.285343Z",
"latest_published_at": "2026-07-18T17:24:07.930211Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 7,
"stars": 51,
"watchers": 2,
"open_issues_and_prs": 192
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples",
"notebooks"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"lambda_layers/requirements.txt",
"pyproject.toml",
"tests/requirements-dev.txt"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "boto3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "botocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "awswrangler",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.4.0"
},
{
"name": "sagemaker",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.6.0, < 3.13"
},
{
"name": "sagemaker-core",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.12.0, < 2.13"
},
{
"name": "sagemaker-mlops",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-serve",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-train",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "redis",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 5.0.1"
},
{
"name": "cryptography",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 46.0.0"
},
{
"name": "requests",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.26.0"
},
{
"name": "aiobotocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.7.0"
},
{
"name": "pandas",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.2.1, < 3.0"
},
{
"name": "scikit-learn",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.5.2"
},
{
"name": "xgboost",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.0.3"
},
{
"name": "joblib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.3.2"
},
{
"name": "rdkit",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2026.3.1"
},
{
"name": "mordredcommunity",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.0.6"
},
{
"name": "ipython",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 8.37.0"
},
{
"name": "pyreadline3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": null
},
{
"name": "matplotlib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.9.2"
},
{
"name": "networkx",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.2"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "aiobotocore",
"direct": true,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": "3.16.1",
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "cryptography",
"direct": true,
"version": "48.0.1",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "8.39.0",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "9.14.1",
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": "1.5.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib",
"direct": true,
"version": "3.10.9",
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": "2.0.7",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.4.2",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.6.1",
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": "2.3.3",
"ecosystem": "pypi"
},
{
"name": "pyreadline3",
"direct": true,
"version": "3.5.6",
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": "2026.3.3",
"ecosystem": "pypi"
},
{
"name": "redis",
"direct": true,
"version": "8.0.0",
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": "2.34.2",
"ecosystem": "pypi"
},
{
"name": "sagemaker",
"direct": true,
"version": "3.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-core",
"direct": true,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlops",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-serve",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-train",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.7.2",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "xgboost",
"direct": true,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "aiohappyeyeballs",
"direct": false,
"version": "2.6.2",
"ecosystem": "pypi"
},
{
"name": "aiohttp",
"direct": false,
"version": "3.14.1",
"ecosystem": "pypi"
},
{
"name": "aioitertools",
"direct": false,
"version": "0.13.0",
"ecosystem": "pypi"
},
{
"name": "aiosignal",
"direct": false,
"version": "1.4.0",
"ecosystem": "pypi"
},
{
"name": "alembic",
"direct": false,
"version": "1.18.4",
"ecosystem": "pypi"
},
{
"name": "annotated-doc",
"direct": false,
"version": "0.0.4",
"ecosystem": "pypi"
},
{
"name": "annotated-types",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "antlr4-python3-runtime",
"direct": false,
"version": "4.9.3",
"ecosystem": "pypi"
},
{
"name": "anyio",
"direct": false,
"version": "4.13.0",
"ecosystem": "pypi"
},
{
"name": "asgiref",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "asttokens",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "async-timeout",
"direct": false,
"version": "5.0.1",
"ecosystem": "pypi"
},
{
"name": "attrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-awscli-v1",
"direct": false,
"version": "2.2.282",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-node-proxy-agent-v6",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-cloud-assembly-schema",
"direct": false,
"version": "54.8.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.211.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.261.0",
"ecosystem": "pypi"
},
{
"name": "babel",
"direct": false,
"version": "2.18.0",
"ecosystem": "pypi"
},
{
"name": "backrefs",
"direct": false,
"version": "7.0",
"ecosystem": "pypi"
},
{
"name": "bcrypt",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": "26.5.1",
"ecosystem": "pypi"
},
{
"name": "blinker",
"direct": false,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "brotli",
"direct": false,
"version": "1.2.0",
"ecosystem": "pypi"
},
{
"name": "cachebox",
"direct": false,
"version": "5.2.3",
"ecosystem": "pypi"
},
{
"name": "cachetools",
"direct": false,
"version": "6.2.6",
"ecosystem": "pypi"
},
{
"name": "cattrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "certifi",
"direct": false,
"version": "2026.5.20",
"ecosystem": "pypi"
},
{
"name": "cffi",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "charset-normalizer",
"direct": false,
"version": "3.4.7",
"ecosystem": "pypi"
},
{
"name": "chemprop",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "click",
"direct": false,
"version": "8.4.1",
"ecosystem": "pypi"
},
{
"name": "cloudpickle",
"direct": false,
"version": "3.1.2",
"ecosystem": "pypi"
},
{
"name": "colorama",
"direct": false,
"version": "0.4.6",
"ecosystem": "pypi"
},
{
"name": "colorlog",
"direct": false,
"version": "6.10.1",
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": "10.6.0",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.2",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.3",
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": "7.14.1",
"ecosystem": "pypi"
},
{
"name": "cuda-bindings",
"direct": false,
"version": "13.3.1",
"ecosystem": "pypi"
},
{
"name": "cuda-pathfinder",
"direct": false,
"version": "1.5.5",
"ecosystem": "pypi"
},
{
"name": "cuda-toolkit",
"direct": false,
"version": "13.0.2",
"ecosystem": "pypi"
},
{
"name": "cycler",
"direct": false,
"version": "0.12.1",
"ecosystem": "pypi"
},
{
"name": "dash",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-ag-grid",
"direct": false,
"version": "35.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-bootstrap-components",
"direct": false,
"version": "2.0.4",
"ecosystem": "pypi"
},
{
"name": "databricks-sdk",
"direct": false,
"version": "0.116.0",
"ecosystem": "pypi"
},
{
"name": "decorator",
"direct": false,
"version": "5.3.1",
"ecosystem": "pypi"
},
{
"name": "deepdiff",
"direct": false,
"version": "9.1.0",
"ecosystem": "pypi"
},
{
"name": "docker",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "exceptiongroup",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "execnet",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "executing",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": "0.136.3",
"ecosystem": "pypi"
},
{
"name": "filelock",
"direct": false,
"version": "3.29.3",
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": "7.3.0",
"ecosystem": "pypi"
},
{
"name": "flask",
"direct": false,
"version": "3.1.3",
"ecosystem": "pypi"
},
{
"name": "flask-cors",
"direct": false,
"version": "6.0.5",
"ecosystem": "pypi"
},
{
"name": "flatbuffers",
"direct": false,
"version": "25.12.19",
"ecosystem": "pypi"
},
{
"name": "fonttools",
"direct": false,
"version": "4.63.0",
"ecosystem": "pypi"
},
{
"name": "frozenlist",
"direct": false,
"version": "1.8.0",
"ecosystem": "pypi"
},
{
"name": "fsspec",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "gevent",
"direct": false,
"version": "26.5.0",
"ecosystem": "pypi"
},
{
"name": "geventhttpclient",
"direct": false,
"version": "2.3.9",
"ecosystem": "pypi"
},
{
"name": "ghp-import",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gitdb",
"direct": false,
"version": "4.0.12",
"ecosystem": "pypi"
},
{
"name": "gitpython",
"direct": false,
"version": "3.1.50",
"ecosystem": "pypi"
},
{
"name": "google-auth",
"direct": false,
"version": "2.53.0",
"ecosystem": "pypi"
},
{
"name": "graphene",
"direct": false,
"version": "3.4.3",
"ecosystem": "pypi"
},
{
"name": "graphql-core",
"direct": false,
"version": "3.2.11",
"ecosystem": "pypi"
},
{
"name": "graphql-relay",
"direct": false,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "greenlet",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "griffelib",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gunicorn",
"direct": false,
"version": "26.0.0",
"ecosystem": "pypi"
},
{
"name": "h11",
"direct": false,
"version": "0.16.0",
"ecosystem": "pypi"
},
{
"name": "huey",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "idna",
"direct": false,
"version": "3.18",
"ecosystem": "pypi"
},
{
"name": "importlib-metadata",
"direct": false,
"version": "6.11.0",
"ecosystem": "pypi"
},
{
"name": "iniconfig",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "invoke",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "ipython-pygments-lexers",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "itsdangerous",
"direct": false,
"version": "2.2.0",
"ecosystem": "pypi"
},
{
"name": "janus",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "jedi",
"direct": false,
"version": "0.20.0",
"ecosystem": "pypi"
},
{
"name": "jinja2",
"direct": false,
"version": "3.1.6",
"ecosystem": "pypi"
},
{
"name": "jmespath",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "jsii",
"direct": false,
"version": "1.138.0",
"ecosystem": "pypi"
},
{
"name": "json5",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema",
"direct": false,
"version": "4.26.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema-specifications",
"direct": false,
"version": "2025.9.1",
"ecosystem": "pypi"
},
{
"name": "kiwisolver",
"direct": false,
"version": "1.5.0",
"ecosystem": "pypi"
},
{
"name": "llvmlite",
"direct": false,
"version": "0.47.0",
"ecosystem": "pypi"
},
{
"name": "mako",
"direct": false,
"version": "1.3.12",
"ecosystem": "pypi"
},
{
"name": "markdown",
"direct": false,
"version": "3.10.2",
"ecosystem": "pypi"
},
{
"name": "markdown-it-py",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "markupsafe",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib-inline",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mccabe",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "mdurl",
"direct": false,
"version": "0.1.2",
"ecosystem": "pypi"
},
{
"name": "mergedeep",
"direct": false,
"version": "1.3.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs",
"direct": false,
"version": "1.6.1",
"ecosystem": "pypi"
},
{
"name": "mkdocs-autorefs",
"direct": false,
"version": "1.4.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs-get-deps",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material",
"direct": false,
"version": "9.7.7",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material-extensions",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings",
"direct": false,
"version": "1.0.6",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings-python",
"direct": false,
"version": "2.0.5",
"ecosystem": "pypi"
},
{
"name": "ml-dtypes",
"direct": false,
"version": "0.5.4",
"ecosystem": "pypi"
},
{
"name": "mlflow",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-skinny",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-tracing",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mmh3",
"direct": false,
"version": "5.2.1",
"ecosystem": "pypi"
},
{
"name": "mock",
"direct": false,
"version": "4.0.3",
"ecosystem": "pypi"
},
{
"name": "mpmath",
"direct": false,
"version": "1.3.0",
"ecosystem": "pypi"
},
{
"name": "msgpack",
"direct": false,
"version": "1.2.1",
"ecosystem": "pypi"
},
{
"name": "multidict",
"direct": false,
"version": "6.7.1",
"ecosystem": "pypi"
},
{
"name": "mypy-extensions",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "narwhals",
"direct": false,
"version": "2.22.1",
"ecosystem": "pypi"
},
{
"name": "nest-asyncio",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "numba",
"direct": false,
"version": "0.65.1",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.2.6",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.4.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-cublas",
"direct": false,
"version": "13.1.1.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-cupti",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-nvrtc",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-runtime",
"direct": false,
"version": "13.0.96",
"ecosystem": "pypi"
},
{
"name": "nvidia-cudnn-cu13",
"direct": false,
"version": "9.20.0.48",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufft",
"direct": false,
"version": "12.0.0.61",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufile",
"direct": false,
"version": "1.15.1.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-curand",
"direct": false,
"version": "10.4.0.35",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusolver",
"direct": false,
"version": "12.0.4.66",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparse",
"direct": false,
"version": "12.6.3.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparselt-cu13",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu12",
"direct": false,
"version": "2.30.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu13",
"direct": false,
"version": "2.29.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvjitlink",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvshmem-cu13",
"direct": false,
"version": "3.4.5",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvtx",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "omegaconf",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "onnx",
"direct": false,
"version": "1.22.0",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.24.3",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.26.0",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-api",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-proto",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-sdk",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-semantic-conventions",
"direct": false,
"version": "0.63b1",
"ecosystem": "pypi"
},
{
"name": "optuna",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "orderly-set",
"direct": false,
"version": "5.5.0",
"ecosystem": "pypi"
},
{
"name": "packaging",
"direct": false,
"version": "26.2",
"ecosystem": "pypi"
},
{
"name": "paginate",
"direct": false,
"version": "0.5.7",
"ecosystem": "pypi"
},
{
"name": "paramiko",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "parso",
"direct": false,
"version": "0.8.7",
"ecosystem": "pypi"
},
{
"name": "pathspec",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pexpect",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "pillow",
"direct": false,
"version": "12.2.0",
"ecosystem": "pypi"
},
{
"name": "platformdirs",
"direct": false,
"version": "4.10.0",
"ecosystem": "pypi"
},
{
"name": "plotly",
"direct": false,
"version": "6.8.0",
"ecosystem": "pypi"
},
{
"name": "pluggy",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "prettytable",
"direct": false,
"version": "3.17.0",
"ecosystem": "pypi"
},
{
"name": "prompt-toolkit",
"direct": false,
"version": "3.0.52",
"ecosystem": "pypi"
},
{
"name": "propcache",
"direct": false,
"version": "0.5.2",
"ecosystem": "pypi"
},
{
"name": "protobuf",
"direct": false,
"version": "6.33.6",
"ecosystem": "pypi"
},
{
"name": "psutil",
"direct": false,
"version": "7.2.2",
"ecosystem": "pypi"
},
{
"name": "ptyprocess",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "publication",
"direct": false,
"version": "0.0.3",
"ecosystem": "pypi"
},
{
"name": "pure-eval",
"direct": false,
"version": "0.2.3",
"ecosystem": "pypi"
},
{
"name": "pyarrow",
"direct": false,
"version": "24.0.0",
"ecosystem": "pypi"
},
{
"name": "pyasn1",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "pyasn1-modules",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "pycodestyle",
"direct": false,
"version": "2.14.0",
"ecosystem": "pypi"
},
{
"name": "pycparser",
"direct": false,
"version": "3.0",
"ecosystem": "pypi"
},
{
"name": "pydantic",
"direct": false,
"version": "2.13.4",
"ecosystem": "pypi"
},
{
"name": "pydantic-core",
"direct": false,
"version": "2.46.4",
"ecosystem": "pypi"
},
{
"name": "pyflakes",
"direct": false,
"version": "3.4.0",
"ecosystem": "pypi"
},
{
"name": "pygments",
"direct": false,
"version": "2.20.0",
"ecosystem": "pypi"
},
{
"name": "pyiceberg",
"direct": false,
"version": "0.11.1",
"ecosystem": "pypi"
},
{
"name": "pymdown-extensions",
"direct": false,
"version": "11.0.1",
"ecosystem": "pypi"
},
{
"name": "pynacl",
"direct": false,
"version": "1.6.2",
"ecosystem": "pypi"
},
{
"name": "pynndescent",
"direct": false,
"version": "0.6.0",
"ecosystem": "pypi"
},
{
"name": "pyparsing",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "pyroaring",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": "9.0.3",
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pytest-xdist",
"direct": false,
"version": "3.8.0",
"ecosystem": "pypi"
},
{
"name": "python-dateutil",
"direct": false,
"version": "2.9.0.post0",
"ecosystem": "pypi"
},
{
"name": "python-dotenv",
"direct": false,
"version": "1.2.2",
"ecosystem": "pypi"
},
{
"name": "python-rapidjson",
"direct": false,
"version": "1.23",
"ecosystem": "pypi"
},
{
"name": "pytokens",
"direct": false,
"version": "0.4.1",
"ecosystem": "pypi"
},
{
"name": "pytz",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "pywin32",
"direct": false,
"version": "312",
"ecosystem": "pypi"
},
{
"name": "pyyaml",
"direct": false,
"version": "6.0.3",
"ecosystem": "pypi"
},
{
"name": "pyyaml-env-tag",
"direct": false,
"version": "1.1",
"ecosystem": "pypi"
},
{
"name": "ray",
"direct": false,
"version": "2.56.0",
"ecosystem": "pypi"
},
{
"name": "referencing",
"direct": false,
"version": "0.37.0",
"ecosystem": "pypi"
},
{
"name": "retrying",
"direct": false,
"version": "1.4.2",
"ecosystem": "pypi"
},
{
"name": "rich",
"direct": false,
"version": "14.3.4",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "0.30.0",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "2026.5.1",
"ecosystem": "pypi"
},
{
"name": "s3fs",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "s3transfer",
"direct": false,
"version": "0.17.1",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlflow",
"direct": false,
"version": "0.4.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-schema-inference-artifacts",
"direct": false,
"version": "0.0.5",
"ecosystem": "pypi"
},
{
"name": "schema",
"direct": false,
"version": "0.7.8",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.15.3",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.17.1",
"ecosystem": "pypi"
},
{
"name": "setuptools",
"direct": false,
"version": "81.0.0",
"ecosystem": "pypi"
},
{
"name": "shap",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "six",
"direct": false,
"version": "1.17.0",
"ecosystem": "pypi"
},
{
"name": "skops",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "smdebug-rulesconfig",
"direct": false,
"version": "1.0.1",
"ecosystem": "pypi"
},
{
"name": "smmap",
"direct": false,
"version": "5.0.3",
"ecosystem": "pypi"
},
{
"name": "sqlalchemy",
"direct": false,
"version": "2.0.50",
"ecosystem": "pypi"
},
{
"name": "sqlparse",
"direct": false,
"version": "0.5.5",
"ecosystem": "pypi"
},
{
"name": "stack-data",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "starlette",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "strictyaml",
"direct": false,
"version": "1.7.3",
"ecosystem": "pypi"
},
{
"name": "sympy",
"direct": false,
"version": "1.14.0",
"ecosystem": "pypi"
},
{
"name": "tblib",
"direct": false,
"version": "3.2.2",
"ecosystem": "pypi"
},
{
"name": "tenacity",
"direct": false,
"version": "9.1.4",
"ecosystem": "pypi"
},
{
"name": "tensorboardx",
"direct": false,
"version": "2.6.5",
"ecosystem": "pypi"
},
{
"name": "termcolor",
"direct": false,
"version": "3.3.0",
"ecosystem": "pypi"
},
{
"name": "threadpoolctl",
"direct": false,
"version": "3.6.0",
"ecosystem": "pypi"
},
{
"name": "tomli",
"direct": false,
"version": "2.4.1",
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": "4.68.2",
"ecosystem": "pypi"
},
{
"name": "traitlets",
"direct": false,
"version": "5.15.1",
"ecosystem": "pypi"
},
{
"name": "triton",
"direct": false,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "tritonclient",
"direct": false,
"version": "2.69.0",
"ecosystem": "pypi"
},
{
"name": "typeguard",
"direct": false,
"version": "2.13.3",
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": false,
"version": "4.15.0",
"ecosystem": "pypi"
},
{
"name": "typing-inspection",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "tzdata",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": "0.5.12",
"ecosystem": "pypi"
},
{
"name": "urllib3",
"direct": false,
"version": "2.7.0",
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": "0.49.0",
"ecosystem": "pypi"
},
{
"name": "waitress",
"direct": false,
"version": "3.0.2",
"ecosystem": "pypi"
},
{
"name": "watchdog",
"direct": false,
"version": "6.0.0",
"ecosystem": "pypi"
},
{
"name": "wcwidth",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "werkzeug",
"direct": false,
"version": "3.1.8",
"ecosystem": "pypi"
},
{
"name": "wrapt",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "xgboost-cpu",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "yarl",
"direct": false,
"version": "1.24.2",
"ecosystem": "pypi"
},
{
"name": "zipp",
"direct": false,
"version": "4.1.0",
"ecosystem": "pypi"
},
{
"name": "zope-event",
"direct": false,
"version": "6.2",
"ecosystem": "pypi"
},
{
"name": "zope-interface",
"direct": false,
"version": "8.5",
"ecosystem": "pypi"
},
{
"name": "zstandard",
"direct": false,
"version": "0.25.0",
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 295,
"direct_count": 35,
"indirect_count": 260
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 81,
"open_issues": 192,
"closed_ratio": 0.605,
"closed_issues": 294,
"closed_unmerged_prs": 31
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "brifordwylie",
"commits": 7193,
"avatar_url": "https://avatars.githubusercontent.com/u/4806709?u=4621f8834a58a072c0487a11c1a464ba79001d85&v=4"
},
{
"type": "User",
"login": "ScottKolmarWFI",
"commits": 47,
"avatar_url": "https://avatars.githubusercontent.com/u/103940733?u=66d82044a9f6ec5a505b6b5dad879448881f2e78&v=4"
},
{
"type": "User",
"login": "giupb",
"commits": 32,
"avatar_url": "https://avatars.githubusercontent.com/u/52609794?u=7e31f70e3b071aecc0ca8da0971ed6e7e05a1fdf&v=4"
},
{
"type": "User",
"login": "luiztauffer",
"commits": 17,
"avatar_url": "https://avatars.githubusercontent.com/u/24541631?u=982d8cef4df0c59e59ce14dc54909c10dded7905&v=4"
},
{
"type": "User",
"login": "sdidier-dev",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/73602526?u=c6239ee652448f997bfd774484b5163faa2d691c&v=4"
},
{
"type": "User",
"login": "andrew-huynh",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/86267299?u=e6337b661122f0d3838a6ea2746649992a30e3a1&v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "User",
"login": "keilogic",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/189083319?v=4"
}
],
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"aws-tests.yml",
"deploy-docs.yml",
"endpoint-import-smoke.yml",
"gitleaks.yml",
"lockfile-drift.yml",
"publish.yml",
"python-lint.yml"
],
"has_docs_dir": true,
"linter_configs": [
".flake8",
"tox.ini"
],
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"security_signals": {
"lockfiles": [
"uv.lock"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 6 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 0,
"reason": "10 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "fc6c71b64a7b3506b6a1b4d5feac6fbc5eb225fb",
"ran_at": "2026-07-18T17:24:45Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/SuperCowPowers/workbench",
"host": "github.com",
"name": "workbench",
"owner": "SuperCowPowers"
},
"metrics": {
"overall": {
"key": "overall",
"band": "good",
"name": "Overall health",
"note": null,
"notes": [],
"value": 72,
"inputs": {
"security": 50,
"vitality": 96,
"community": 57,
"governance": 58,
"engineering": 95
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 96,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"commits_last_year": 2128,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 52
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "52/52 weeks with commits",
"points": 36,
"status": "met",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 52
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "2128 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 2128
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 100,
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~1.1 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 1.1
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"forks": 7,
"stars": 51,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "51 stars",
"points": 27.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 51
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "7 forks",
"points": 6.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 7
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 67,
"inputs": {
"packages": [
"workbench"
],
"dependents": null,
"ecosystems": "pypi",
"total_downloads": null,
"monthly_downloads": 10144
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "10,144 downloads/month across pypi",
"points": 53.4,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 10144,
"ecosystems": "pypi"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 58,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 30,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.3,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "8 contributors",
"points": 10.8,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 8
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"merged_prs": 81,
"open_issues": 192,
"closed_issues": 294,
"issue_closed_ratio": 0.605,
"closed_unmerged_prs": 31
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "60% of issues closed",
"points": 28.3,
"status": "partial",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 60
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "81/112 decided PRs merged",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 81,
"decided": 112
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"followers": 29,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "SuperCowPowers",
"public_repos": 13,
"account_age_days": 4513
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "29 followers of SuperCowPowers",
"points": 10.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 29,
"login": "SuperCowPowers"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "13 public repos, account ~12 yr old",
"points": 20.3,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 13
}
},
{
"code": "account_age_years",
"params": {
"years": 12
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"workbench"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "330 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 330
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "excellent",
"name": "Engineering Quality",
"value": 95,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "excellent",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "7 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 7
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": ".flake8, tox.ini",
"points": 16,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 9.6,
"status": "met",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "excellent",
"name": "Documentation",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://www.supercowpowers.com",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "7 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 7
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 50,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "10 existing vulnerabilities detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 3
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 44,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 73,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"uv.lock"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"Makefile"
],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": ".flake8, tox.ini",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "4/637 source files over 60KB",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 637,
"oversized": 4
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples",
"notebooks"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples, notebooks",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples, notebooks"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-18T17:25:10.029741Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/s/SuperCowPowers/workbench.svg",
"full_name": "SuperCowPowers/workbench",
"license_state": "standard",
"license_spdx": "MIT"
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.14.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — PyPI.