Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models
SuperCowPowers/workbench tiene un índice de salud de 72 sobre 100, lo que lo sitúa en la banda Bueno. Su puntuación más alta es Vitality (96/100) y la más baja, AI Readiness (44/100). Se actualizó por última vez hoy. Una sola persona concentra la mayor parte del trabajo reciente.
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| PyPI | workbench | 0.8.409 | 10.144 | 330 | hace 0 días | sagemakermachine-learningawspythonutilities |
¿Está vivo el proyecto: se escribe código y se publican versiones?
| 36/36 | Recencia de push — último push hace 0 días |
| 36/36 | Cadencia de commits — 52/52 semanas con commits |
| 18/18 | Volumen de commits — 2128 commits en el último año |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 2128 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 52 |
| 27/27 | Publica versiones — 100 versiones publicadas |
| 36/36 | Recencia de las versiones — última versión hace 0 días |
| 27/27 | Cadencia de publicación — una versión cada ~1,1 días |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 100 |
| latest_release_tag | v0.8.409 |
| releases_from_tags | no |
| days_since_latest_release | 0 |
| mean_days_between_releases | 1,1 |
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
| 27.6/60 | Estrellas — 51 estrellas |
| 6.5/25 | Forks — 7 forks |
| 0/15 | Observadores — 2 observadores |
| forks | 7 |
| stars | 51 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Licencia — licencia reconocida (MIT) |
| 18/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 6.3/6.3 | Plantilla de PR |
| has_readme | sí |
| has_license | sí |
| has_contributing | sí |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | sí |
| 53.4/80 | Descargas mensuales — 10.144 descargas/mes en pypi |
| 0/20 | Dependientes en el registro — no lo informa este ecosistema |
| packages | workbench |
| dependents | — |
| ecosystems | pypi |
| total_downloads | — |
| monthly_downloads | 10.144 |
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 0.3/22.5 | Distribución de commits — el principal contribuyente firma el 99% de los commits |
| 10.8/13.5 | Amplitud de contribuyentes — 8 contribuyentes |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 8 |
| top_contributor_share | 0,986 |
| 28.3/46.8 | Resolución de issues — 60% de issues cerradas |
| 27.7/38.3 | Aceptación de PR — 81/112 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 81 |
| open_issues | 192 |
| closed_issues | 294 |
| issue_closed_ratio | 0,605 |
| closed_unmerged_prs | 31 |
| 30/30 | Respaldo de la propiedad — propiedad de una organización |
| 0/20 | Dominio verificado |
| 10.6/25 | Alcance del propietario — 29 seguidores de SuperCowPowers |
| 20.3/25 | Trayectoria — 13 repos públicos, cuenta de ~12 años |
| followers | 29 |
| owner_type | Organization |
| is_verified | — |
| owner_login | SuperCowPowers |
| public_repos | 13 |
| account_age_days | 4513 |
| 25/25 | Publicado y resoluble — 1 paquete(s) en pypi |
| 35/35 | Recencia de publicación — última publicación hace 0 días |
| 20/20 | Historial de versiones — 330 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
| packages | workbench |
| ecosystems | pypi |
| any_deprecated | no |
| min_days_since_publish | 0 |
¿Existen unas prácticas mínimas de ingeniería y documentación?
| 24/24 | Flujos de trabajo de CI — 7 flujo(s) de trabajo |
| 24/24 | Pruebas presentes |
| 16/16 | Configuración de linter — .flake8, tox.ini |
| 9.6/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — sin datos |
| has_ci | sí |
| has_tests | sí |
| has_editorconfig | no |
| has_linter_config | sí |
| has_precommit_config | sí |
| 30/30 | README |
| 25/25 | Directorio de documentación |
| 15/15 | Sitio de documentación / página del proyecto — https://www.supercowpowers.com |
| 10/10 | Descripción del repositorio |
| 10/10 | Topics — 7 topics |
| 10/10 | Wiki |
| topics | aws, big-data, machine-learning, python, spark, data-engineering, pandas |
| has_wiki | sí |
| homepage | https://www.supercowpowers.com |
| has_readme | sí |
| has_docs_dir | sí |
| has_description | sí |
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — sin datos |
| 0/2.5 | CI-Tests — sin datos |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Licencia — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 10 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
| 0/45 | Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 0/40 | Historial de commits legible — sin datos |
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 18/18 | Arranque con un solo comando — Makefile |
| 22/22 | Pruebas automatizadas |
| 11/11 | Configuración de lint / formato — .flake8, tox.ini |
| 0/11 | Verificación estática de tipos |
| 10/10 | Entorno reproducible — Dockerfile, lockfile |
| 0/10 | Práctica demostrada con agentes — sin datos |
| 5/8 | Mantenimiento automatizado — automatización de dependencias configurada, no observada en los commits muestreados |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | no |
| has_tests | sí |
| lockfiles | uv.lock |
| has_dockerfile | sí |
| typed_language | no |
| bootstrap_files | Makefile |
| has_devcontainer | no |
| has_linter_config | sí |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 0/45 | Código verificable por tipos — Python sin configuración de verificación de tipos |
| 54.7/55 | Tamaños de archivo manejables — 4/637 archivos fuente de más de 60 KB |
| primary_language | Python |
| largest_source_bytes | 70.242 |
| source_files_sampled | 637 |
| oversized_source_files | 4 |
| 0/40 | Esquema de API (OpenAPI/GraphQL/proto) |
| 0/20 | Servidor MCP |
| 40/40 | Ejemplos ejecutables — examples, notebooks |
| example_dirs | examples, notebooks |
| has_mcp_signal | no |
| api_schema_files | — |
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/d | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| n/d | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 10 existing vulnerabilities detected |
| Registro | Paquete | Restricción de versión | Manifiesto |
|---|---|---|---|
| PyPI | boto3 | >= 1.42.2 | pyproject.toml |
| PyPI | botocore | >= 1.42.2 | pyproject.toml |
| PyPI | awswrangler | >= 3.4.0 | pyproject.toml |
| PyPI | sagemaker | >= 3.6.0, < 3.13 | pyproject.toml |
| PyPI | sagemaker-core | >= 2.12.0, < 2.13 | pyproject.toml |
| PyPI | sagemaker-mlops | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-serve | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-train | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | redis | >= 5.0.1 | pyproject.toml |
| PyPI | cryptography | >= 46.0.0 | pyproject.toml |
| PyPI | requests | >= 2.26.0 | pyproject.toml |
| PyPI | aiobotocore | >= 3.7.0 | pyproject.toml |
| PyPI | pandas | >= 2.2.1, < 3.0 | pyproject.toml |
| PyPI | scikit-learn | >= 1.5.2 | pyproject.toml |
| PyPI | xgboost | >= 3.0.3 | pyproject.toml |
| PyPI | joblib | >= 1.3.2 | pyproject.toml |
| PyPI | rdkit | >= 2026.3.1 | pyproject.toml |
| PyPI | mordredcommunity | >= 2.0.6 | pyproject.toml |
| PyPI | ipython | >= 8.37.0 | pyproject.toml |
| PyPI | pyreadline3 | — | pyproject.toml |
| PyPI | matplotlib | >= 3.9.2 | pyproject.toml |
| PyPI | networkx | >= 3.2 | pyproject.toml |
Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 35 paquetes directos y 260 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.
| Registro | Paquete | Versión | Relación |
|---|---|---|---|
| PyPI | aiobotocore | 3.7.0 | directa |
| PyPI | awswrangler | — | directa |
| PyPI | awswrangler | 3.16.1 | directa |
| PyPI | boto3 | — | directa |
| PyPI | boto3 | 1.43.0 | directa |
| PyPI | botocore | — | directa |
| PyPI | botocore | 1.43.0 | directa |
| PyPI | cryptography | 48.0.1 | directa |
| PyPI | ipython | 8.39.0 | directa |
| PyPI | ipython | 9.14.1 | directa |
| PyPI | joblib | — | directa |
| PyPI | joblib | 1.5.3 | directa |
| PyPI | matplotlib | 3.10.9 | directa |
| PyPI | mordredcommunity | — | directa |
| PyPI | mordredcommunity | 2.0.7 | directa |
| PyPI | networkx | — | directa |
| PyPI | networkx | 3.4.2 | directa |
| PyPI | networkx | 3.6.1 | directa |
| PyPI | pandas | — | directa |
| PyPI | pandas | 2.3.3 | directa |
| PyPI | pyreadline3 | 3.5.6 | directa |
| PyPI | rdkit | — | directa |
| PyPI | rdkit | 2026.3.3 | directa |
| PyPI | redis | 8.0.0 | directa |
| PyPI | requests | — | directa |
| PyPI | requests | 2.34.2 | directa |
| PyPI | sagemaker | 3.12.0 | directa |
| PyPI | sagemaker-core | 2.12.0 | directa |
| PyPI | sagemaker-mlops | 1.12.0 | directa |
| PyPI | sagemaker-serve | 1.12.0 | directa |
| PyPI | sagemaker-train | 1.12.0 | directa |
| PyPI | scikit-learn | — | directa |
| PyPI | scikit-learn | 1.7.2 | directa |
| PyPI | scikit-learn | 1.9.0 | directa |
| PyPI | xgboost | 3.2.0 | directa |
| PyPI | aiohappyeyeballs | 2.6.2 | indirecta |
| PyPI | aiohttp | 3.14.1 | indirecta |
| PyPI | aioitertools | 0.13.0 | indirecta |
| PyPI | aiosignal | 1.4.0 | indirecta |
| PyPI | alembic | 1.18.4 | indirecta |
| PyPI | annotated-doc | 0.0.4 | indirecta |
| PyPI | annotated-types | 0.7.0 | indirecta |
| PyPI | antlr4-python3-runtime | 4.9.3 | indirecta |
| PyPI | anyio | 4.13.0 | indirecta |
| PyPI | asgiref | — | indirecta |
| PyPI | asttokens | 3.0.1 | indirecta |
| PyPI | async-timeout | 5.0.1 | indirecta |
| PyPI | attrs | 26.1.0 | indirecta |
| PyPI | aws-cdk-asset-awscli-v1 | 2.2.282 | indirecta |
| PyPI | aws-cdk-asset-node-proxy-agent-v6 | 2.1.2 | indirecta |
| PyPI | aws-cdk-cloud-assembly-schema | 54.8.0 | indirecta |
| PyPI | aws-cdk-lib | — | indirecta |
| PyPI | aws-cdk-lib | 2.211.0 | indirecta |
| PyPI | aws-cdk-lib | 2.261.0 | indirecta |
| PyPI | babel | 2.18.0 | indirecta |
| PyPI | backrefs | 7.0 | indirecta |
| PyPI | bcrypt | 5.0.0 | indirecta |
| PyPI | black | — | indirecta |
| PyPI | black | 26.5.1 | indirecta |
| PyPI | blinker | 1.9.0 | indirecta |
| PyPI | brotli | 1.2.0 | indirecta |
| PyPI | cachebox | 5.2.3 | indirecta |
| PyPI | cachetools | 6.2.6 | indirecta |
| PyPI | cattrs | 26.1.0 | indirecta |
| PyPI | certifi | 2026.5.20 | indirecta |
| PyPI | cffi | 2.0.0 | indirecta |
| PyPI | charset-normalizer | 3.4.7 | indirecta |
| PyPI | chemprop | — | indirecta |
| PyPI | click | 8.4.1 | indirecta |
| PyPI | cloudpickle | 3.1.2 | indirecta |
| PyPI | colorama | 0.4.6 | indirecta |
| PyPI | colorlog | 6.10.1 | indirecta |
| PyPI | constructs | — | indirecta |
| PyPI | constructs | 10.6.0 | indirecta |
| PyPI | contourpy | 1.3.2 | indirecta |
| PyPI | contourpy | 1.3.3 | indirecta |
| PyPI | coverage | — | indirecta |
| PyPI | coverage | 7.14.1 | indirecta |
| PyPI | cuda-bindings | 13.3.1 | indirecta |
| PyPI | cuda-pathfinder | 1.5.5 | indirecta |
| PyPI | cuda-toolkit | 13.0.2 | indirecta |
| PyPI | cycler | 0.12.1 | indirecta |
| PyPI | dash | 4.2.0 | indirecta |
| PyPI | dash-ag-grid | 35.2.0 | indirecta |
| PyPI | dash-bootstrap-components | 2.0.4 | indirecta |
| PyPI | databricks-sdk | 0.116.0 | indirecta |
| PyPI | decorator | 5.3.1 | indirecta |
| PyPI | deepdiff | 9.1.0 | indirecta |
| PyPI | docker | 7.1.0 | indirecta |
| PyPI | exceptiongroup | 1.3.1 | indirecta |
| PyPI | execnet | 2.1.2 | indirecta |
| PyPI | executing | 2.2.1 | indirecta |
| PyPI | fastapi | — | indirecta |
| PyPI | fastapi | 0.136.3 | indirecta |
| PyPI | filelock | 3.29.3 | indirecta |
| PyPI | flake8 | — | indirecta |
| PyPI | flake8 | 7.3.0 | indirecta |
| PyPI | flask | 3.1.3 | indirecta |
| PyPI | flask-cors | 6.0.5 | indirecta |
| PyPI | flatbuffers | 25.12.19 | indirecta |
| PyPI | fonttools | 4.63.0 | indirecta |
| PyPI | frozenlist | 1.8.0 | indirecta |
| PyPI | fsspec | 2026.4.0 | indirecta |
| PyPI | gevent | 26.5.0 | indirecta |
| PyPI | geventhttpclient | 2.3.9 | indirecta |
| PyPI | ghp-import | 2.1.0 | indirecta |
| PyPI | gitdb | 4.0.12 | indirecta |
| PyPI | gitpython | 3.1.50 | indirecta |
| PyPI | google-auth | 2.53.0 | indirecta |
| PyPI | graphene | 3.4.3 | indirecta |
| PyPI | graphql-core | 3.2.11 | indirecta |
| PyPI | graphql-relay | 3.2.0 | indirecta |
| PyPI | greenlet | 3.3.2 | indirecta |
| PyPI | griffelib | 2.1.0 | indirecta |
| PyPI | gunicorn | 26.0.0 | indirecta |
| PyPI | h11 | 0.16.0 | indirecta |
| PyPI | huey | 3.0.1 | indirecta |
| PyPI | idna | 3.18 | indirecta |
| PyPI | importlib-metadata | 6.11.0 | indirecta |
| PyPI | iniconfig | 2.3.0 | indirecta |
| PyPI | invoke | 3.0.3 | indirecta |
| PyPI | ipython-pygments-lexers | 1.1.1 | indirecta |
| PyPI | itsdangerous | 2.2.0 | indirecta |
| PyPI | janus | 2.0.0 | indirecta |
| PyPI | jedi | 0.20.0 | indirecta |
| PyPI | jinja2 | 3.1.6 | indirecta |
| PyPI | jmespath | 1.1.0 | indirecta |
| PyPI | jsii | 1.138.0 | indirecta |
| PyPI | json5 | 0.14.0 | indirecta |
| PyPI | jsonschema | 4.26.0 | indirecta |
| PyPI | jsonschema-specifications | 2025.9.1 | indirecta |
| PyPI | kiwisolver | 1.5.0 | indirecta |
| PyPI | llvmlite | 0.47.0 | indirecta |
| PyPI | mako | 1.3.12 | indirecta |
| PyPI | markdown | 3.10.2 | indirecta |
| PyPI | markdown-it-py | 4.2.0 | indirecta |
| PyPI | markupsafe | 3.0.3 | indirecta |
| PyPI | matplotlib-inline | 0.2.2 | indirecta |
| PyPI | mccabe | 0.7.0 | indirecta |
| PyPI | mdurl | 0.1.2 | indirecta |
| PyPI | mergedeep | 1.3.4 | indirecta |
| PyPI | mkdocs | 1.6.1 | indirecta |
| PyPI | mkdocs-autorefs | 1.4.4 | indirecta |
| PyPI | mkdocs-get-deps | 0.2.2 | indirecta |
| PyPI | mkdocs-material | 9.7.7 | indirecta |
| PyPI | mkdocs-material-extensions | 1.3.1 | indirecta |
| PyPI | mkdocstrings | 1.0.6 | indirecta |
| PyPI | mkdocstrings-python | 2.0.5 | indirecta |
| PyPI | ml-dtypes | 0.5.4 | indirecta |
| PyPI | mlflow | 3.13.0 | indirecta |
| PyPI | mlflow-skinny | 3.13.0 | indirecta |
| PyPI | mlflow-tracing | 3.13.0 | indirecta |
| PyPI | mmh3 | 5.2.1 | indirecta |
| PyPI | mock | 4.0.3 | indirecta |
| PyPI | mpmath | 1.3.0 | indirecta |
| PyPI | msgpack | 1.2.1 | indirecta |
| PyPI | multidict | 6.7.1 | indirecta |
| PyPI | mypy-extensions | 1.1.0 | indirecta |
| PyPI | narwhals | 2.22.1 | indirecta |
| PyPI | nest-asyncio | 1.6.0 | indirecta |
| PyPI | numba | 0.65.1 | indirecta |
| PyPI | numpy | 2.2.6 | indirecta |
| PyPI | numpy | 2.4.6 | indirecta |
| PyPI | nvidia-cublas | 13.1.1.3 | indirecta |
| PyPI | nvidia-cuda-cupti | 13.0.85 | indirecta |
| PyPI | nvidia-cuda-nvrtc | 13.0.88 | indirecta |
| PyPI | nvidia-cuda-runtime | 13.0.96 | indirecta |
| PyPI | nvidia-cudnn-cu13 | 9.20.0.48 | indirecta |
| PyPI | nvidia-cufft | 12.0.0.61 | indirecta |
| PyPI | nvidia-cufile | 1.15.1.6 | indirecta |
| PyPI | nvidia-curand | 10.4.0.35 | indirecta |
| PyPI | nvidia-cusolver | 12.0.4.66 | indirecta |
| PyPI | nvidia-cusparse | 12.6.3.3 | indirecta |
| PyPI | nvidia-cusparselt-cu13 | 0.8.1 | indirecta |
| PyPI | nvidia-nccl-cu12 | 2.30.7 | indirecta |
| PyPI | nvidia-nccl-cu13 | 2.29.7 | indirecta |
| PyPI | nvidia-nvjitlink | 13.0.88 | indirecta |
| PyPI | nvidia-nvshmem-cu13 | 3.4.5 | indirecta |
| PyPI | nvidia-nvtx | 13.0.85 | indirecta |
| PyPI | omegaconf | 2.3.0 | indirecta |
| PyPI | onnx | 1.22.0 | indirecta |
| PyPI | onnxruntime | 1.24.3 | indirecta |
| PyPI | onnxruntime | 1.26.0 | indirecta |
| PyPI | opentelemetry-api | 1.42.1 | indirecta |
| PyPI | opentelemetry-proto | 1.42.1 | indirecta |
| PyPI | opentelemetry-sdk | 1.42.1 | indirecta |
| PyPI | opentelemetry-semantic-conventions | 0.63b1 | indirecta |
| PyPI | optuna | 4.9.0 | indirecta |
| PyPI | orderly-set | 5.5.0 | indirecta |
| PyPI | packaging | 26.2 | indirecta |
| PyPI | paginate | 0.5.7 | indirecta |
| PyPI | paramiko | 5.0.0 | indirecta |
| PyPI | parso | 0.8.7 | indirecta |
| PyPI | pathspec | 1.1.1 | indirecta |
| PyPI | pexpect | 4.9.0 | indirecta |
| PyPI | pillow | 12.2.0 | indirecta |
| PyPI | platformdirs | 4.10.0 | indirecta |
| PyPI | plotly | 6.8.0 | indirecta |
| PyPI | pluggy | 1.6.0 | indirecta |
| PyPI | prettytable | 3.17.0 | indirecta |
| PyPI | prompt-toolkit | 3.0.52 | indirecta |
| PyPI | propcache | 0.5.2 | indirecta |
| PyPI | protobuf | 6.33.6 | indirecta |
| PyPI | psutil | 7.2.2 | indirecta |
| PyPI | ptyprocess | 0.7.0 | indirecta |
| PyPI | publication | 0.0.3 | indirecta |
| PyPI | pure-eval | 0.2.3 | indirecta |
| PyPI | pyarrow | 24.0.0 | indirecta |
| PyPI | pyasn1 | 0.6.3 | indirecta |
| PyPI | pyasn1-modules | 0.4.2 | indirecta |
| PyPI | pycodestyle | 2.14.0 | indirecta |
| PyPI | pycparser | 3.0 | indirecta |
| PyPI | pydantic | 2.13.4 | indirecta |
| PyPI | pydantic-core | 2.46.4 | indirecta |
| PyPI | pyflakes | 3.4.0 | indirecta |
| PyPI | pygments | 2.20.0 | indirecta |
| PyPI | pyiceberg | 0.11.1 | indirecta |
| PyPI | pymdown-extensions | 11.0.1 | indirecta |
| PyPI | pynacl | 1.6.2 | indirecta |
| PyPI | pynndescent | 0.6.0 | indirecta |
| PyPI | pyparsing | 3.3.2 | indirecta |
| PyPI | pyroaring | 1.1.0 | indirecta |
| PyPI | pytest | — | indirecta |
| PyPI | pytest | 9.0.3 | indirecta |
| PyPI | pytest-cov | — | indirecta |
| PyPI | pytest-cov | 7.1.0 | indirecta |
| PyPI | pytest-sugar | — | indirecta |
| PyPI | pytest-sugar | 1.1.1 | indirecta |
| PyPI | pytest-xdist | 3.8.0 | indirecta |
| PyPI | python-dateutil | 2.9.0.post0 | indirecta |
| PyPI | python-dotenv | 1.2.2 | indirecta |
| PyPI | python-rapidjson | 1.23 | indirecta |
| PyPI | pytokens | 0.4.1 | indirecta |
| PyPI | pytz | 2026.2 | indirecta |
| PyPI | pywin32 | 312 | indirecta |
| PyPI | pyyaml | 6.0.3 | indirecta |
| PyPI | pyyaml-env-tag | 1.1 | indirecta |
| PyPI | ray | 2.56.0 | indirecta |
| PyPI | referencing | 0.37.0 | indirecta |
| PyPI | retrying | 1.4.2 | indirecta |
| PyPI | rich | 14.3.4 | indirecta |
| PyPI | rpds-py | 0.30.0 | indirecta |
| PyPI | rpds-py | 2026.5.1 | indirecta |
| PyPI | s3fs | 2026.4.0 | indirecta |
| PyPI | s3transfer | 0.17.1 | indirecta |
| PyPI | sagemaker-mlflow | 0.4.0 | indirecta |
| PyPI | sagemaker-schema-inference-artifacts | 0.0.5 | indirecta |
| PyPI | schema | 0.7.8 | indirecta |
| PyPI | scipy | 1.15.3 | indirecta |
| PyPI | scipy | 1.17.1 | indirecta |
| PyPI | setuptools | 81.0.0 | indirecta |
| PyPI | shap | — | indirecta |
| PyPI | six | 1.17.0 | indirecta |
| PyPI | skops | 0.14.0 | indirecta |
| PyPI | smdebug-rulesconfig | 1.0.1 | indirecta |
| PyPI | smmap | 5.0.3 | indirecta |
| PyPI | sqlalchemy | 2.0.50 | indirecta |
| PyPI | sqlparse | 0.5.5 | indirecta |
| PyPI | stack-data | 0.6.3 | indirecta |
| PyPI | starlette | 1.3.1 | indirecta |
| PyPI | strictyaml | 1.7.3 | indirecta |
| PyPI | sympy | 1.14.0 | indirecta |
| PyPI | tblib | 3.2.2 | indirecta |
| PyPI | tenacity | 9.1.4 | indirecta |
| PyPI | tensorboardx | 2.6.5 | indirecta |
| PyPI | termcolor | 3.3.0 | indirecta |
| PyPI | threadpoolctl | 3.6.0 | indirecta |
| PyPI | tomli | 2.4.1 | indirecta |
| PyPI | torch | — | indirecta |
| PyPI | torch | 2.12.0 | indirecta |
| PyPI | tqdm | — | indirecta |
| PyPI | tqdm | 4.68.2 | indirecta |
| PyPI | traitlets | 5.15.1 | indirecta |
| PyPI | triton | 3.7.0 | indirecta |
| PyPI | tritonclient | 2.69.0 | indirecta |
| PyPI | typeguard | 2.13.3 | indirecta |
| PyPI | typing-extensions | 4.15.0 | indirecta |
| PyPI | typing-inspection | 0.4.2 | indirecta |
| PyPI | tzdata | 2026.2 | indirecta |
| PyPI | umap-learn | — | indirecta |
| PyPI | umap-learn | 0.5.12 | indirecta |
| PyPI | urllib3 | 2.7.0 | indirecta |
| PyPI | uvicorn | — | indirecta |
| PyPI | uvicorn | 0.49.0 | indirecta |
| PyPI | waitress | 3.0.2 | indirecta |
| PyPI | watchdog | 6.0.0 | indirecta |
| PyPI | wcwidth | 0.8.1 | indirecta |
| PyPI | werkzeug | 3.1.8 | indirecta |
| PyPI | wrapt | 2.2.1 | indirecta |
| PyPI | xgboost-cpu | — | indirecta |
| PyPI | yarl | 1.24.2 | indirecta |
| PyPI | zipp | 4.1.0 | indirecta |
| PyPI | zope-event | 6.2 | indirecta |
| PyPI | zope-interface | 8.5 | indirecta |
| PyPI | zstandard | 0.25.0 | indirecta |
{
"data": {
"repo": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"is_fork": false,
"size_kb": 91631,
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"languages": {
"CSS": 62868,
"Shell": 29010,
"Python": 3687778,
"Makefile": 971,
"Batchfile": 874,
"Dockerfile": 12108,
"JavaScript": 46472,
"Jupyter Notebook": 81119
},
"pushed_at": "2026-07-18T17:24:31Z",
"created_at": "2022-12-06T17:41:31Z",
"owner_type": "Organization",
"updated_at": "2026-07-18T17:24:34Z",
"description": "Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://www.supercowpowers.com",
"name": "SuperCowPowers",
"type": "Organization",
"login": "SuperCowPowers",
"company": null,
"location": "United States of America",
"followers": 29,
"avatar_url": "https://avatars.githubusercontent.com/u/6900187?v=4",
"created_at": "2014-03-09T18:36:12Z",
"is_verified": null,
"public_repos": 13,
"account_age_days": 4513
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 100,
"commits_last_year": 2128,
"latest_release_at": "2026-07-18T17:24:11Z",
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 52,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 75,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "workbench",
"exists": true,
"license": null,
"keywords": [
"SageMaker",
"Machine Learning",
"AWS",
"Python",
"Utilities",
"Development Status :: 4 - Beta",
"Programming Language :: Python :: 3.10",
"Programming Language :: Python :: 3.11",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Topic :: Scientific/Engineering"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/workbench/",
"is_deprecated": false,
"latest_version": "0.8.409",
"repository_url": "https://github.com/SuperCowPowers/workbench",
"versions_count": 330,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 10144,
"first_published_at": "2014-07-08T00:59:42.285343Z",
"latest_published_at": "2026-07-18T17:24:07.930211Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 7,
"stars": 51,
"watchers": 2,
"open_issues_and_prs": 192
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples",
"notebooks"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"lambda_layers/requirements.txt",
"pyproject.toml",
"tests/requirements-dev.txt"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "boto3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "botocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "awswrangler",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.4.0"
},
{
"name": "sagemaker",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.6.0, < 3.13"
},
{
"name": "sagemaker-core",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.12.0, < 2.13"
},
{
"name": "sagemaker-mlops",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-serve",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-train",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "redis",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 5.0.1"
},
{
"name": "cryptography",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 46.0.0"
},
{
"name": "requests",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.26.0"
},
{
"name": "aiobotocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.7.0"
},
{
"name": "pandas",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.2.1, < 3.0"
},
{
"name": "scikit-learn",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.5.2"
},
{
"name": "xgboost",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.0.3"
},
{
"name": "joblib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.3.2"
},
{
"name": "rdkit",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2026.3.1"
},
{
"name": "mordredcommunity",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.0.6"
},
{
"name": "ipython",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 8.37.0"
},
{
"name": "pyreadline3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": null
},
{
"name": "matplotlib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.9.2"
},
{
"name": "networkx",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.2"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "aiobotocore",
"direct": true,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": "3.16.1",
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "cryptography",
"direct": true,
"version": "48.0.1",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "8.39.0",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "9.14.1",
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": "1.5.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib",
"direct": true,
"version": "3.10.9",
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": "2.0.7",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.4.2",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.6.1",
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": "2.3.3",
"ecosystem": "pypi"
},
{
"name": "pyreadline3",
"direct": true,
"version": "3.5.6",
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": "2026.3.3",
"ecosystem": "pypi"
},
{
"name": "redis",
"direct": true,
"version": "8.0.0",
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": "2.34.2",
"ecosystem": "pypi"
},
{
"name": "sagemaker",
"direct": true,
"version": "3.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-core",
"direct": true,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlops",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-serve",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-train",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.7.2",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "xgboost",
"direct": true,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "aiohappyeyeballs",
"direct": false,
"version": "2.6.2",
"ecosystem": "pypi"
},
{
"name": "aiohttp",
"direct": false,
"version": "3.14.1",
"ecosystem": "pypi"
},
{
"name": "aioitertools",
"direct": false,
"version": "0.13.0",
"ecosystem": "pypi"
},
{
"name": "aiosignal",
"direct": false,
"version": "1.4.0",
"ecosystem": "pypi"
},
{
"name": "alembic",
"direct": false,
"version": "1.18.4",
"ecosystem": "pypi"
},
{
"name": "annotated-doc",
"direct": false,
"version": "0.0.4",
"ecosystem": "pypi"
},
{
"name": "annotated-types",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "antlr4-python3-runtime",
"direct": false,
"version": "4.9.3",
"ecosystem": "pypi"
},
{
"name": "anyio",
"direct": false,
"version": "4.13.0",
"ecosystem": "pypi"
},
{
"name": "asgiref",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "asttokens",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "async-timeout",
"direct": false,
"version": "5.0.1",
"ecosystem": "pypi"
},
{
"name": "attrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-awscli-v1",
"direct": false,
"version": "2.2.282",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-node-proxy-agent-v6",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-cloud-assembly-schema",
"direct": false,
"version": "54.8.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.211.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.261.0",
"ecosystem": "pypi"
},
{
"name": "babel",
"direct": false,
"version": "2.18.0",
"ecosystem": "pypi"
},
{
"name": "backrefs",
"direct": false,
"version": "7.0",
"ecosystem": "pypi"
},
{
"name": "bcrypt",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": "26.5.1",
"ecosystem": "pypi"
},
{
"name": "blinker",
"direct": false,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "brotli",
"direct": false,
"version": "1.2.0",
"ecosystem": "pypi"
},
{
"name": "cachebox",
"direct": false,
"version": "5.2.3",
"ecosystem": "pypi"
},
{
"name": "cachetools",
"direct": false,
"version": "6.2.6",
"ecosystem": "pypi"
},
{
"name": "cattrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "certifi",
"direct": false,
"version": "2026.5.20",
"ecosystem": "pypi"
},
{
"name": "cffi",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "charset-normalizer",
"direct": false,
"version": "3.4.7",
"ecosystem": "pypi"
},
{
"name": "chemprop",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "click",
"direct": false,
"version": "8.4.1",
"ecosystem": "pypi"
},
{
"name": "cloudpickle",
"direct": false,
"version": "3.1.2",
"ecosystem": "pypi"
},
{
"name": "colorama",
"direct": false,
"version": "0.4.6",
"ecosystem": "pypi"
},
{
"name": "colorlog",
"direct": false,
"version": "6.10.1",
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": "10.6.0",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.2",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.3",
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": "7.14.1",
"ecosystem": "pypi"
},
{
"name": "cuda-bindings",
"direct": false,
"version": "13.3.1",
"ecosystem": "pypi"
},
{
"name": "cuda-pathfinder",
"direct": false,
"version": "1.5.5",
"ecosystem": "pypi"
},
{
"name": "cuda-toolkit",
"direct": false,
"version": "13.0.2",
"ecosystem": "pypi"
},
{
"name": "cycler",
"direct": false,
"version": "0.12.1",
"ecosystem": "pypi"
},
{
"name": "dash",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-ag-grid",
"direct": false,
"version": "35.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-bootstrap-components",
"direct": false,
"version": "2.0.4",
"ecosystem": "pypi"
},
{
"name": "databricks-sdk",
"direct": false,
"version": "0.116.0",
"ecosystem": "pypi"
},
{
"name": "decorator",
"direct": false,
"version": "5.3.1",
"ecosystem": "pypi"
},
{
"name": "deepdiff",
"direct": false,
"version": "9.1.0",
"ecosystem": "pypi"
},
{
"name": "docker",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "exceptiongroup",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "execnet",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "executing",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": "0.136.3",
"ecosystem": "pypi"
},
{
"name": "filelock",
"direct": false,
"version": "3.29.3",
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": "7.3.0",
"ecosystem": "pypi"
},
{
"name": "flask",
"direct": false,
"version": "3.1.3",
"ecosystem": "pypi"
},
{
"name": "flask-cors",
"direct": false,
"version": "6.0.5",
"ecosystem": "pypi"
},
{
"name": "flatbuffers",
"direct": false,
"version": "25.12.19",
"ecosystem": "pypi"
},
{
"name": "fonttools",
"direct": false,
"version": "4.63.0",
"ecosystem": "pypi"
},
{
"name": "frozenlist",
"direct": false,
"version": "1.8.0",
"ecosystem": "pypi"
},
{
"name": "fsspec",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "gevent",
"direct": false,
"version": "26.5.0",
"ecosystem": "pypi"
},
{
"name": "geventhttpclient",
"direct": false,
"version": "2.3.9",
"ecosystem": "pypi"
},
{
"name": "ghp-import",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gitdb",
"direct": false,
"version": "4.0.12",
"ecosystem": "pypi"
},
{
"name": "gitpython",
"direct": false,
"version": "3.1.50",
"ecosystem": "pypi"
},
{
"name": "google-auth",
"direct": false,
"version": "2.53.0",
"ecosystem": "pypi"
},
{
"name": "graphene",
"direct": false,
"version": "3.4.3",
"ecosystem": "pypi"
},
{
"name": "graphql-core",
"direct": false,
"version": "3.2.11",
"ecosystem": "pypi"
},
{
"name": "graphql-relay",
"direct": false,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "greenlet",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "griffelib",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gunicorn",
"direct": false,
"version": "26.0.0",
"ecosystem": "pypi"
},
{
"name": "h11",
"direct": false,
"version": "0.16.0",
"ecosystem": "pypi"
},
{
"name": "huey",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "idna",
"direct": false,
"version": "3.18",
"ecosystem": "pypi"
},
{
"name": "importlib-metadata",
"direct": false,
"version": "6.11.0",
"ecosystem": "pypi"
},
{
"name": "iniconfig",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "invoke",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "ipython-pygments-lexers",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "itsdangerous",
"direct": false,
"version": "2.2.0",
"ecosystem": "pypi"
},
{
"name": "janus",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "jedi",
"direct": false,
"version": "0.20.0",
"ecosystem": "pypi"
},
{
"name": "jinja2",
"direct": false,
"version": "3.1.6",
"ecosystem": "pypi"
},
{
"name": "jmespath",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "jsii",
"direct": false,
"version": "1.138.0",
"ecosystem": "pypi"
},
{
"name": "json5",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema",
"direct": false,
"version": "4.26.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema-specifications",
"direct": false,
"version": "2025.9.1",
"ecosystem": "pypi"
},
{
"name": "kiwisolver",
"direct": false,
"version": "1.5.0",
"ecosystem": "pypi"
},
{
"name": "llvmlite",
"direct": false,
"version": "0.47.0",
"ecosystem": "pypi"
},
{
"name": "mako",
"direct": false,
"version": "1.3.12",
"ecosystem": "pypi"
},
{
"name": "markdown",
"direct": false,
"version": "3.10.2",
"ecosystem": "pypi"
},
{
"name": "markdown-it-py",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "markupsafe",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib-inline",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mccabe",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "mdurl",
"direct": false,
"version": "0.1.2",
"ecosystem": "pypi"
},
{
"name": "mergedeep",
"direct": false,
"version": "1.3.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs",
"direct": false,
"version": "1.6.1",
"ecosystem": "pypi"
},
{
"name": "mkdocs-autorefs",
"direct": false,
"version": "1.4.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs-get-deps",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material",
"direct": false,
"version": "9.7.7",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material-extensions",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings",
"direct": false,
"version": "1.0.6",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings-python",
"direct": false,
"version": "2.0.5",
"ecosystem": "pypi"
},
{
"name": "ml-dtypes",
"direct": false,
"version": "0.5.4",
"ecosystem": "pypi"
},
{
"name": "mlflow",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-skinny",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-tracing",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mmh3",
"direct": false,
"version": "5.2.1",
"ecosystem": "pypi"
},
{
"name": "mock",
"direct": false,
"version": "4.0.3",
"ecosystem": "pypi"
},
{
"name": "mpmath",
"direct": false,
"version": "1.3.0",
"ecosystem": "pypi"
},
{
"name": "msgpack",
"direct": false,
"version": "1.2.1",
"ecosystem": "pypi"
},
{
"name": "multidict",
"direct": false,
"version": "6.7.1",
"ecosystem": "pypi"
},
{
"name": "mypy-extensions",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "narwhals",
"direct": false,
"version": "2.22.1",
"ecosystem": "pypi"
},
{
"name": "nest-asyncio",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "numba",
"direct": false,
"version": "0.65.1",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.2.6",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.4.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-cublas",
"direct": false,
"version": "13.1.1.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-cupti",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-nvrtc",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-runtime",
"direct": false,
"version": "13.0.96",
"ecosystem": "pypi"
},
{
"name": "nvidia-cudnn-cu13",
"direct": false,
"version": "9.20.0.48",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufft",
"direct": false,
"version": "12.0.0.61",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufile",
"direct": false,
"version": "1.15.1.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-curand",
"direct": false,
"version": "10.4.0.35",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusolver",
"direct": false,
"version": "12.0.4.66",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparse",
"direct": false,
"version": "12.6.3.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparselt-cu13",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu12",
"direct": false,
"version": "2.30.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu13",
"direct": false,
"version": "2.29.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvjitlink",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvshmem-cu13",
"direct": false,
"version": "3.4.5",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvtx",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "omegaconf",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "onnx",
"direct": false,
"version": "1.22.0",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.24.3",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.26.0",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-api",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-proto",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-sdk",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-semantic-conventions",
"direct": false,
"version": "0.63b1",
"ecosystem": "pypi"
},
{
"name": "optuna",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "orderly-set",
"direct": false,
"version": "5.5.0",
"ecosystem": "pypi"
},
{
"name": "packaging",
"direct": false,
"version": "26.2",
"ecosystem": "pypi"
},
{
"name": "paginate",
"direct": false,
"version": "0.5.7",
"ecosystem": "pypi"
},
{
"name": "paramiko",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "parso",
"direct": false,
"version": "0.8.7",
"ecosystem": "pypi"
},
{
"name": "pathspec",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pexpect",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "pillow",
"direct": false,
"version": "12.2.0",
"ecosystem": "pypi"
},
{
"name": "platformdirs",
"direct": false,
"version": "4.10.0",
"ecosystem": "pypi"
},
{
"name": "plotly",
"direct": false,
"version": "6.8.0",
"ecosystem": "pypi"
},
{
"name": "pluggy",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "prettytable",
"direct": false,
"version": "3.17.0",
"ecosystem": "pypi"
},
{
"name": "prompt-toolkit",
"direct": false,
"version": "3.0.52",
"ecosystem": "pypi"
},
{
"name": "propcache",
"direct": false,
"version": "0.5.2",
"ecosystem": "pypi"
},
{
"name": "protobuf",
"direct": false,
"version": "6.33.6",
"ecosystem": "pypi"
},
{
"name": "psutil",
"direct": false,
"version": "7.2.2",
"ecosystem": "pypi"
},
{
"name": "ptyprocess",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "publication",
"direct": false,
"version": "0.0.3",
"ecosystem": "pypi"
},
{
"name": "pure-eval",
"direct": false,
"version": "0.2.3",
"ecosystem": "pypi"
},
{
"name": "pyarrow",
"direct": false,
"version": "24.0.0",
"ecosystem": "pypi"
},
{
"name": "pyasn1",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "pyasn1-modules",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "pycodestyle",
"direct": false,
"version": "2.14.0",
"ecosystem": "pypi"
},
{
"name": "pycparser",
"direct": false,
"version": "3.0",
"ecosystem": "pypi"
},
{
"name": "pydantic",
"direct": false,
"version": "2.13.4",
"ecosystem": "pypi"
},
{
"name": "pydantic-core",
"direct": false,
"version": "2.46.4",
"ecosystem": "pypi"
},
{
"name": "pyflakes",
"direct": false,
"version": "3.4.0",
"ecosystem": "pypi"
},
{
"name": "pygments",
"direct": false,
"version": "2.20.0",
"ecosystem": "pypi"
},
{
"name": "pyiceberg",
"direct": false,
"version": "0.11.1",
"ecosystem": "pypi"
},
{
"name": "pymdown-extensions",
"direct": false,
"version": "11.0.1",
"ecosystem": "pypi"
},
{
"name": "pynacl",
"direct": false,
"version": "1.6.2",
"ecosystem": "pypi"
},
{
"name": "pynndescent",
"direct": false,
"version": "0.6.0",
"ecosystem": "pypi"
},
{
"name": "pyparsing",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "pyroaring",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": "9.0.3",
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pytest-xdist",
"direct": false,
"version": "3.8.0",
"ecosystem": "pypi"
},
{
"name": "python-dateutil",
"direct": false,
"version": "2.9.0.post0",
"ecosystem": "pypi"
},
{
"name": "python-dotenv",
"direct": false,
"version": "1.2.2",
"ecosystem": "pypi"
},
{
"name": "python-rapidjson",
"direct": false,
"version": "1.23",
"ecosystem": "pypi"
},
{
"name": "pytokens",
"direct": false,
"version": "0.4.1",
"ecosystem": "pypi"
},
{
"name": "pytz",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "pywin32",
"direct": false,
"version": "312",
"ecosystem": "pypi"
},
{
"name": "pyyaml",
"direct": false,
"version": "6.0.3",
"ecosystem": "pypi"
},
{
"name": "pyyaml-env-tag",
"direct": false,
"version": "1.1",
"ecosystem": "pypi"
},
{
"name": "ray",
"direct": false,
"version": "2.56.0",
"ecosystem": "pypi"
},
{
"name": "referencing",
"direct": false,
"version": "0.37.0",
"ecosystem": "pypi"
},
{
"name": "retrying",
"direct": false,
"version": "1.4.2",
"ecosystem": "pypi"
},
{
"name": "rich",
"direct": false,
"version": "14.3.4",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "0.30.0",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "2026.5.1",
"ecosystem": "pypi"
},
{
"name": "s3fs",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "s3transfer",
"direct": false,
"version": "0.17.1",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlflow",
"direct": false,
"version": "0.4.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-schema-inference-artifacts",
"direct": false,
"version": "0.0.5",
"ecosystem": "pypi"
},
{
"name": "schema",
"direct": false,
"version": "0.7.8",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.15.3",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.17.1",
"ecosystem": "pypi"
},
{
"name": "setuptools",
"direct": false,
"version": "81.0.0",
"ecosystem": "pypi"
},
{
"name": "shap",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "six",
"direct": false,
"version": "1.17.0",
"ecosystem": "pypi"
},
{
"name": "skops",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "smdebug-rulesconfig",
"direct": false,
"version": "1.0.1",
"ecosystem": "pypi"
},
{
"name": "smmap",
"direct": false,
"version": "5.0.3",
"ecosystem": "pypi"
},
{
"name": "sqlalchemy",
"direct": false,
"version": "2.0.50",
"ecosystem": "pypi"
},
{
"name": "sqlparse",
"direct": false,
"version": "0.5.5",
"ecosystem": "pypi"
},
{
"name": "stack-data",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "starlette",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "strictyaml",
"direct": false,
"version": "1.7.3",
"ecosystem": "pypi"
},
{
"name": "sympy",
"direct": false,
"version": "1.14.0",
"ecosystem": "pypi"
},
{
"name": "tblib",
"direct": false,
"version": "3.2.2",
"ecosystem": "pypi"
},
{
"name": "tenacity",
"direct": false,
"version": "9.1.4",
"ecosystem": "pypi"
},
{
"name": "tensorboardx",
"direct": false,
"version": "2.6.5",
"ecosystem": "pypi"
},
{
"name": "termcolor",
"direct": false,
"version": "3.3.0",
"ecosystem": "pypi"
},
{
"name": "threadpoolctl",
"direct": false,
"version": "3.6.0",
"ecosystem": "pypi"
},
{
"name": "tomli",
"direct": false,
"version": "2.4.1",
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": "4.68.2",
"ecosystem": "pypi"
},
{
"name": "traitlets",
"direct": false,
"version": "5.15.1",
"ecosystem": "pypi"
},
{
"name": "triton",
"direct": false,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "tritonclient",
"direct": false,
"version": "2.69.0",
"ecosystem": "pypi"
},
{
"name": "typeguard",
"direct": false,
"version": "2.13.3",
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": false,
"version": "4.15.0",
"ecosystem": "pypi"
},
{
"name": "typing-inspection",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "tzdata",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": "0.5.12",
"ecosystem": "pypi"
},
{
"name": "urllib3",
"direct": false,
"version": "2.7.0",
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": "0.49.0",
"ecosystem": "pypi"
},
{
"name": "waitress",
"direct": false,
"version": "3.0.2",
"ecosystem": "pypi"
},
{
"name": "watchdog",
"direct": false,
"version": "6.0.0",
"ecosystem": "pypi"
},
{
"name": "wcwidth",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "werkzeug",
"direct": false,
"version": "3.1.8",
"ecosystem": "pypi"
},
{
"name": "wrapt",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "xgboost-cpu",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "yarl",
"direct": false,
"version": "1.24.2",
"ecosystem": "pypi"
},
{
"name": "zipp",
"direct": false,
"version": "4.1.0",
"ecosystem": "pypi"
},
{
"name": "zope-event",
"direct": false,
"version": "6.2",
"ecosystem": "pypi"
},
{
"name": "zope-interface",
"direct": false,
"version": "8.5",
"ecosystem": "pypi"
},
{
"name": "zstandard",
"direct": false,
"version": "0.25.0",
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 295,
"direct_count": 35,
"indirect_count": 260
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 81,
"open_issues": 192,
"closed_ratio": 0.605,
"closed_issues": 294,
"closed_unmerged_prs": 31
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "brifordwylie",
"commits": 7193,
"avatar_url": "https://avatars.githubusercontent.com/u/4806709?u=4621f8834a58a072c0487a11c1a464ba79001d85&v=4"
},
{
"type": "User",
"login": "ScottKolmarWFI",
"commits": 47,
"avatar_url": "https://avatars.githubusercontent.com/u/103940733?u=66d82044a9f6ec5a505b6b5dad879448881f2e78&v=4"
},
{
"type": "User",
"login": "giupb",
"commits": 32,
"avatar_url": "https://avatars.githubusercontent.com/u/52609794?u=7e31f70e3b071aecc0ca8da0971ed6e7e05a1fdf&v=4"
},
{
"type": "User",
"login": "luiztauffer",
"commits": 17,
"avatar_url": "https://avatars.githubusercontent.com/u/24541631?u=982d8cef4df0c59e59ce14dc54909c10dded7905&v=4"
},
{
"type": "User",
"login": "sdidier-dev",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/73602526?u=c6239ee652448f997bfd774484b5163faa2d691c&v=4"
},
{
"type": "User",
"login": "andrew-huynh",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/86267299?u=e6337b661122f0d3838a6ea2746649992a30e3a1&v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "User",
"login": "keilogic",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/189083319?v=4"
}
],
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"aws-tests.yml",
"deploy-docs.yml",
"endpoint-import-smoke.yml",
"gitleaks.yml",
"lockfile-drift.yml",
"publish.yml",
"python-lint.yml"
],
"has_docs_dir": true,
"linter_configs": [
".flake8",
"tox.ini"
],
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"security_signals": {
"lockfiles": [
"uv.lock"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 6 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 0,
"reason": "10 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "fc6c71b64a7b3506b6a1b4d5feac6fbc5eb225fb",
"ran_at": "2026-07-18T17:24:45Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/SuperCowPowers/workbench",
"host": "github.com",
"name": "workbench",
"owner": "SuperCowPowers"
},
"metrics": {
"overall": {
"key": "overall",
"band": "good",
"name": "Overall health",
"note": null,
"notes": [],
"value": 72,
"inputs": {
"security": 50,
"vitality": 96,
"community": 57,
"governance": 58,
"engineering": 95
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 96,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"commits_last_year": 2128,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 52
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "52/52 weeks with commits",
"points": 36,
"status": "met",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 52
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "2128 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 2128
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 100,
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~1.1 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 1.1
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"forks": 7,
"stars": 51,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "51 stars",
"points": 27.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 51
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "7 forks",
"points": 6.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 7
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 67,
"inputs": {
"packages": [
"workbench"
],
"dependents": null,
"ecosystems": "pypi",
"total_downloads": null,
"monthly_downloads": 10144
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "10,144 downloads/month across pypi",
"points": 53.4,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 10144,
"ecosystems": "pypi"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 58,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 30,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.3,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "8 contributors",
"points": 10.8,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 8
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"merged_prs": 81,
"open_issues": 192,
"closed_issues": 294,
"issue_closed_ratio": 0.605,
"closed_unmerged_prs": 31
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "60% of issues closed",
"points": 28.3,
"status": "partial",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 60
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "81/112 decided PRs merged",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 81,
"decided": 112
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"followers": 29,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "SuperCowPowers",
"public_repos": 13,
"account_age_days": 4513
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "29 followers of SuperCowPowers",
"points": 10.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 29,
"login": "SuperCowPowers"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "13 public repos, account ~12 yr old",
"points": 20.3,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 13
}
},
{
"code": "account_age_years",
"params": {
"years": 12
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"workbench"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "330 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 330
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "excellent",
"name": "Engineering Quality",
"value": 95,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "excellent",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "7 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 7
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": ".flake8, tox.ini",
"points": 16,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 9.6,
"status": "met",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "excellent",
"name": "Documentation",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://www.supercowpowers.com",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "7 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 7
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 50,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "10 existing vulnerabilities detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 3
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 44,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 73,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"uv.lock"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"Makefile"
],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": ".flake8, tox.ini",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "4/637 source files over 60KB",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 637,
"oversized": 4
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples",
"notebooks"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples, notebooks",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples, notebooks"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-18T17:25:10.029741Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/s/SuperCowPowers/workbench.svg",
"full_name": "SuperCowPowers/workbench",
"license_state": "standard",
"license_spdx": "MIT"
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.14.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — PyPI.