Публічний реєстрДобрий
Звіт про здоров'я програмного забезпеченнясхема 0.14.0 · метрики 1.13.0 · 2026-07-18 17:25 UTC
SuperCowPowers / workbench
Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models
SuperCowPowers/workbench має індекс здоров’я 72 зі 100, що відповідає смузі «Добрий». Найвищий показник — Vitality (96/100), найнижчий — AI Readiness (44/100). Останнє оновлення — сьогодні. Більшість нещодавньої роботи виконує один учасник.
72
загалом / 100Індекс здоров'я програмного забезпечення
Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.
72
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
Профіль оцінок
Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.
Власність
SuperCowPowersОрганізація
29 підписників13 публічних репозиторіївз бер. 2014 р.
За цим репозиторієм стоїть організація — спільна, підзвітна опіка, здатна пережити будь-якого окремого мейнтейнера.
Пакетні екосистеми
| Реєстр | Пакет | Версія | Завантажень / міс | Версії | Остання публікація | Теги |
|---|---|---|---|---|---|---|
| PyPI | workbench | 0.8.409 | 10 144 | 330 | 0 днів тому | sagemakermachine-learningawspythonutilities |
Метрики за категоріями
Життєздатність
Чи живий проєкт — чи пишеться код і чи виходять релізи?
96
Активність розробки
100Відмінний
Як обчислюється оцінка
| 36/36 | Свіжість push — останній push 0 дн. тому |
| 36/36 | Ритм комітів — 52/52 тижнів із комітами |
| 18/18 | Обсяг комітів — 2 128 комітів за останній рік |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
Використані вхідні дані
| commits_last_year | 2 128 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 52 |
Дисципліна релізів
90Відмінний
Як обчислюється оцінка
| 27/27 | Випускає релізи — опубліковано 100 релізів |
| 36/36 | Свіжість релізів — останній реліз 0 дн. тому |
| 27/27 | Ритм релізів — реліз кожні ~1,1 дн. |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
Використані вхідні дані
| releases_count | 100 |
| latest_release_tag | v0.8.409 |
| releases_from_tags | ні |
| days_since_latest_release | 0 |
| mean_days_between_releases | 1,1 |
Спільнота та впровадження
Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?
57
Популярність і впровадження
34У зоні ризику
Як обчислюється оцінка
| 27.6/60 | Зірки — 51 зірок |
| 6.5/25 | Форки — 7 форків |
| 0/15 | Спостерігачі — 2 спостерігачів |
Використані вхідні дані
| forks | 7 |
| stars | 51 |
| watchers | 2 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Здоров'я спільноти
77Добрий
Як обчислюється оцінка
| 22.5/22.5 | README |
| 22.5/22.5 | Ліцензія — визнана ліцензія (MIT) |
| 18/18 | Настанови CONTRIBUTING |
| 0/13.5 | Кодекс поведінки |
| 0/7.2 | Шаблон issue |
| 6.3/6.3 | Шаблон PR |
Використані вхідні дані
| has_readme | так |
| has_license | так |
| has_contributing | так |
| has_issue_template | ні |
| has_code_of_conduct | ні |
| has_pull_request_template | так |
Впровадження в екосистемі (завантаження)
67Помірний
Як обчислюється оцінка
| 53.4/80 | Щомісячні завантаження — 10 144 завантажень/місяць у pypi |
| 0/20 | Залежні пакети в реєстрі — ця екосистема цього не повідомляє |
Використані вхідні дані
| packages | workbench |
| dependents | — |
| ecosystems | pypi |
| total_downloads | — |
| monthly_downloads | 10 144 |
Виключено з оцінювання (немає даних або не застосовно): Залежні пакети в реєстрі. Залишкові ваги перенормовано.
Сталість та врядування
Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?
58
Стійкість мейнтейнерів (бас-фактор)
30У зоні ризику
Як обчислюється оцінка
| 9/54 | Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів |
| 0.3/22.5 | Розподіл комітів — головний контриб’ютор — автор 99% комітів |
| 10.8/13.5 | Широта контриб’юторів — 8 контриб’юторів |
| 10/10 | OpenSSF Scorecard: Contributors — project has 6 contributing companies or organizations |
Використані вхідні дані
| bus_factor | 1 |
| contributors_sampled | 8 |
| top_contributor_share | 0,986 |
Реактивність на issue та PR
56Помірний
Як обчислюється оцінка
| 28.3/46.8 | Вирішення issue — закрито 60% issue |
| 27.7/38.3 | Прийняття PR — злито 81/112 вирішених PR |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Використані вхідні дані
| merged_prs | 81 |
| open_issues | 192 |
| closed_issues | 294 |
| issue_closed_ratio | 0,605 |
| closed_unmerged_prs | 31 |
Власність та опіка
61Помірний
Як обчислюється оцінка
| 30/30 | Підтримка власника — у власності організації |
| 0/20 | Верифікований домен |
| 10.6/25 | Охоплення власника — 29 підписників у SuperCowPowers |
| 20.3/25 | Послужний список — 13 публічних репозиторіїв, вік облікового запису ~12 р. |
Використані вхідні дані
| followers | 29 |
| owner_type | Organization |
| is_verified | — |
| owner_login | SuperCowPowers |
| public_repos | 13 |
| account_age_days | 4 513 |
Супровід пакетів
100Відмінний
Як обчислюється оцінка
| 25/25 | Опубліковано й доступно — 1 пакет(ів) у pypi |
| 35/35 | Свіжість публікацій — остання публікація 0 дн. тому |
| 20/20 | Історія версій — 330 опублікованих версій |
| 20/20 | Не застарілий — активний, не deprecated і не yanked |
Використані вхідні дані
| packages | workbench |
| ecosystems | pypi |
| any_deprecated | ні |
| min_days_since_publish | 0 |
Інженерна якість
Чи наявні базові інженерні практики та документація?
95
Інженерні практики
92Відмінний
Як обчислюється оцінка
| 24/24 | Процеси CI — 7 процес(ів) CI |
| 24/24 | Наявні тести |
| 16/16 | Конфігурація лінтера — .flake8, tox.ini |
| 9.6/9.6 | Pre-commit-хуки |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — немає даних |
Використані вхідні дані
| has_ci | так |
| has_tests | так |
| has_editorconfig | ні |
| has_linter_config | так |
| has_precommit_config | так |
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: CI-Tests. Залишкові ваги перенормовано.
Документація
100Відмінний
Як обчислюється оцінка
| 30/30 | README |
| 25/25 | Каталог документації |
| 15/15 | Сайт документації / домашня сторінка — https://www.supercowpowers.com |
| 10/10 | Опис репозиторію |
| 10/10 | Теми — 7 тем |
| 10/10 | Wiki |
Використані вхідні дані
| topics | aws, big-data, machine-learning, python, spark, data-engineering, pandas |
| has_wiki | так |
| homepage | https://www.supercowpowers.com |
| has_readme | так |
| has_docs_dir | так |
| has_description | так |
Безпека
Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?
50
Стан безпеки
50Помірний
Як обчислюється оцінка
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — немає даних |
| 0/2.5 | CI-Tests — немає даних |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 6 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Ліцензія — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 10 existing vulnerabilities detected |
Використані вхідні дані
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
Виключено з оцінювання (немає даних або не застосовно): branch_protection, ci_tests. Залишкові ваги перенормовано.
Готовність до ШІ
Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.
44
Контекст і настанови для агентів
1Критичний
Як обчислюється оцінка
| 0/45 | Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора |
| 0/15 | Машиночитана документація (llms.txt) |
| 0/40 | Читабельна історія комітів — немає даних |
Використані вхідні дані
| has_llms_txt | ні |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Виключено з оцінювання (немає даних або не застосовно): Читабельна історія комітів. Залишкові ваги перенормовано.
Як обчислюється оцінка
| 18/18 | Розгортання однією командою — Makefile |
| 22/22 | Автоматизовані тести |
| 11/11 | Конфігурація лінтера / форматера — .flake8, tox.ini |
| 0/11 | Статична перевірка типів |
| 10/10 | Відтворюване середовище — Dockerfile, lockfile |
| 0/10 | Підтверджена практика роботи з агентами — немає даних |
| 5/8 | Автоматизоване супроводження — автоматизацію залежностей налаштовано, але у вибірці комітів її не видно |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
Використані вхідні дані
| has_nix | ні |
| has_tests | так |
| lockfiles | uv.lock |
| has_dockerfile | так |
| typed_language | ні |
| bootstrap_files | Makefile |
| has_devcontainer | ні |
| has_linter_config | так |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Виключено з оцінювання (немає даних або не застосовно): Підтверджена практика роботи з агентами. Залишкові ваги перенормовано.
Читабельність коду для моделей
55Помірний
Як обчислюється оцінка
| 0/45 | Типізований код — Python без конфігурації перевірки типів |
| 54.7/55 | Керовані розміри файлів — 4/637 файлів вихідного коду понад 60 КБ |
Використані вхідні дані
| primary_language | Python |
| largest_source_bytes | 70 242 |
| source_files_sampled | 637 |
| oversized_source_files | 4 |
Машиночитні інтерфейси
40У зоні ризику
Як обчислюється оцінка
| 0/40 | Схема API (OpenAPI/GraphQL/proto) |
| 0/20 | Сервер MCP |
| 40/40 | Придатні до запуску приклади — examples, notebooks |
Використані вхідні дані
| example_dirs | examples, notebooks |
| has_mcp_signal | ні |
| api_schema_files | — |
Ключові факти
51зірок GitHub
8контриб'юторів
2 128комітів за останні 12 місяців
0днів від останнього пушу
100релізів
1бас-фактор
192відкритих issue
PyPIпакетних екосистем
Докладніше
OpenSSF Scorecard 5.0 / 10
5.0сукупно
Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).
| 10 | Binary-Artifacts | no binaries found in the repo |
| н/д | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| н/д | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 6 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 10 existing vulnerabilities detected |
Прямі залежності 22
| Реєстр | Пакет | Обмеження версії | Маніфест |
|---|---|---|---|
| PyPI | boto3 | >= 1.42.2 | pyproject.toml |
| PyPI | botocore | >= 1.42.2 | pyproject.toml |
| PyPI | awswrangler | >= 3.4.0 | pyproject.toml |
| PyPI | sagemaker | >= 3.6.0, < 3.13 | pyproject.toml |
| PyPI | sagemaker-core | >= 2.12.0, < 2.13 | pyproject.toml |
| PyPI | sagemaker-mlops | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-serve | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | sagemaker-train | >= 1.12.0, < 1.13 | pyproject.toml |
| PyPI | redis | >= 5.0.1 | pyproject.toml |
| PyPI | cryptography | >= 46.0.0 | pyproject.toml |
| PyPI | requests | >= 2.26.0 | pyproject.toml |
| PyPI | aiobotocore | >= 3.7.0 | pyproject.toml |
| PyPI | pandas | >= 2.2.1, < 3.0 | pyproject.toml |
| PyPI | scikit-learn | >= 1.5.2 | pyproject.toml |
| PyPI | xgboost | >= 3.0.3 | pyproject.toml |
| PyPI | joblib | >= 1.3.2 | pyproject.toml |
| PyPI | rdkit | >= 2026.3.1 | pyproject.toml |
| PyPI | mordredcommunity | >= 2.0.6 | pyproject.toml |
| PyPI | ipython | >= 8.37.0 | pyproject.toml |
| PyPI | pyreadline3 | — | pyproject.toml |
| PyPI | matplotlib | >= 3.9.2 | pyproject.toml |
| PyPI | networkx | >= 3.2 | pyproject.toml |
Усі залежності 295
Повний розв'язаний набір залежностей із графа залежностей GitHub: 35 прямих і 260 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.
| Реєстр | Пакет | Версія | Зв'язок |
|---|---|---|---|
| PyPI | aiobotocore | 3.7.0 | пряма |
| PyPI | awswrangler | — | пряма |
| PyPI | awswrangler | 3.16.1 | пряма |
| PyPI | boto3 | — | пряма |
| PyPI | boto3 | 1.43.0 | пряма |
| PyPI | botocore | — | пряма |
| PyPI | botocore | 1.43.0 | пряма |
| PyPI | cryptography | 48.0.1 | пряма |
| PyPI | ipython | 8.39.0 | пряма |
| PyPI | ipython | 9.14.1 | пряма |
| PyPI | joblib | — | пряма |
| PyPI | joblib | 1.5.3 | пряма |
| PyPI | matplotlib | 3.10.9 | пряма |
| PyPI | mordredcommunity | — | пряма |
| PyPI | mordredcommunity | 2.0.7 | пряма |
| PyPI | networkx | — | пряма |
| PyPI | networkx | 3.4.2 | пряма |
| PyPI | networkx | 3.6.1 | пряма |
| PyPI | pandas | — | пряма |
| PyPI | pandas | 2.3.3 | пряма |
| PyPI | pyreadline3 | 3.5.6 | пряма |
| PyPI | rdkit | — | пряма |
| PyPI | rdkit | 2026.3.3 | пряма |
| PyPI | redis | 8.0.0 | пряма |
| PyPI | requests | — | пряма |
| PyPI | requests | 2.34.2 | пряма |
| PyPI | sagemaker | 3.12.0 | пряма |
| PyPI | sagemaker-core | 2.12.0 | пряма |
| PyPI | sagemaker-mlops | 1.12.0 | пряма |
| PyPI | sagemaker-serve | 1.12.0 | пряма |
| PyPI | sagemaker-train | 1.12.0 | пряма |
| PyPI | scikit-learn | — | пряма |
| PyPI | scikit-learn | 1.7.2 | пряма |
| PyPI | scikit-learn | 1.9.0 | пряма |
| PyPI | xgboost | 3.2.0 | пряма |
| PyPI | aiohappyeyeballs | 2.6.2 | непряма |
| PyPI | aiohttp | 3.14.1 | непряма |
| PyPI | aioitertools | 0.13.0 | непряма |
| PyPI | aiosignal | 1.4.0 | непряма |
| PyPI | alembic | 1.18.4 | непряма |
| PyPI | annotated-doc | 0.0.4 | непряма |
| PyPI | annotated-types | 0.7.0 | непряма |
| PyPI | antlr4-python3-runtime | 4.9.3 | непряма |
| PyPI | anyio | 4.13.0 | непряма |
| PyPI | asgiref | — | непряма |
| PyPI | asttokens | 3.0.1 | непряма |
| PyPI | async-timeout | 5.0.1 | непряма |
| PyPI | attrs | 26.1.0 | непряма |
| PyPI | aws-cdk-asset-awscli-v1 | 2.2.282 | непряма |
| PyPI | aws-cdk-asset-node-proxy-agent-v6 | 2.1.2 | непряма |
| PyPI | aws-cdk-cloud-assembly-schema | 54.8.0 | непряма |
| PyPI | aws-cdk-lib | — | непряма |
| PyPI | aws-cdk-lib | 2.211.0 | непряма |
| PyPI | aws-cdk-lib | 2.261.0 | непряма |
| PyPI | babel | 2.18.0 | непряма |
| PyPI | backrefs | 7.0 | непряма |
| PyPI | bcrypt | 5.0.0 | непряма |
| PyPI | black | — | непряма |
| PyPI | black | 26.5.1 | непряма |
| PyPI | blinker | 1.9.0 | непряма |
| PyPI | brotli | 1.2.0 | непряма |
| PyPI | cachebox | 5.2.3 | непряма |
| PyPI | cachetools | 6.2.6 | непряма |
| PyPI | cattrs | 26.1.0 | непряма |
| PyPI | certifi | 2026.5.20 | непряма |
| PyPI | cffi | 2.0.0 | непряма |
| PyPI | charset-normalizer | 3.4.7 | непряма |
| PyPI | chemprop | — | непряма |
| PyPI | click | 8.4.1 | непряма |
| PyPI | cloudpickle | 3.1.2 | непряма |
| PyPI | colorama | 0.4.6 | непряма |
| PyPI | colorlog | 6.10.1 | непряма |
| PyPI | constructs | — | непряма |
| PyPI | constructs | 10.6.0 | непряма |
| PyPI | contourpy | 1.3.2 | непряма |
| PyPI | contourpy | 1.3.3 | непряма |
| PyPI | coverage | — | непряма |
| PyPI | coverage | 7.14.1 | непряма |
| PyPI | cuda-bindings | 13.3.1 | непряма |
| PyPI | cuda-pathfinder | 1.5.5 | непряма |
| PyPI | cuda-toolkit | 13.0.2 | непряма |
| PyPI | cycler | 0.12.1 | непряма |
| PyPI | dash | 4.2.0 | непряма |
| PyPI | dash-ag-grid | 35.2.0 | непряма |
| PyPI | dash-bootstrap-components | 2.0.4 | непряма |
| PyPI | databricks-sdk | 0.116.0 | непряма |
| PyPI | decorator | 5.3.1 | непряма |
| PyPI | deepdiff | 9.1.0 | непряма |
| PyPI | docker | 7.1.0 | непряма |
| PyPI | exceptiongroup | 1.3.1 | непряма |
| PyPI | execnet | 2.1.2 | непряма |
| PyPI | executing | 2.2.1 | непряма |
| PyPI | fastapi | — | непряма |
| PyPI | fastapi | 0.136.3 | непряма |
| PyPI | filelock | 3.29.3 | непряма |
| PyPI | flake8 | — | непряма |
| PyPI | flake8 | 7.3.0 | непряма |
| PyPI | flask | 3.1.3 | непряма |
| PyPI | flask-cors | 6.0.5 | непряма |
| PyPI | flatbuffers | 25.12.19 | непряма |
| PyPI | fonttools | 4.63.0 | непряма |
| PyPI | frozenlist | 1.8.0 | непряма |
| PyPI | fsspec | 2026.4.0 | непряма |
| PyPI | gevent | 26.5.0 | непряма |
| PyPI | geventhttpclient | 2.3.9 | непряма |
| PyPI | ghp-import | 2.1.0 | непряма |
| PyPI | gitdb | 4.0.12 | непряма |
| PyPI | gitpython | 3.1.50 | непряма |
| PyPI | google-auth | 2.53.0 | непряма |
| PyPI | graphene | 3.4.3 | непряма |
| PyPI | graphql-core | 3.2.11 | непряма |
| PyPI | graphql-relay | 3.2.0 | непряма |
| PyPI | greenlet | 3.3.2 | непряма |
| PyPI | griffelib | 2.1.0 | непряма |
| PyPI | gunicorn | 26.0.0 | непряма |
| PyPI | h11 | 0.16.0 | непряма |
| PyPI | huey | 3.0.1 | непряма |
| PyPI | idna | 3.18 | непряма |
| PyPI | importlib-metadata | 6.11.0 | непряма |
| PyPI | iniconfig | 2.3.0 | непряма |
| PyPI | invoke | 3.0.3 | непряма |
| PyPI | ipython-pygments-lexers | 1.1.1 | непряма |
| PyPI | itsdangerous | 2.2.0 | непряма |
| PyPI | janus | 2.0.0 | непряма |
| PyPI | jedi | 0.20.0 | непряма |
| PyPI | jinja2 | 3.1.6 | непряма |
| PyPI | jmespath | 1.1.0 | непряма |
| PyPI | jsii | 1.138.0 | непряма |
| PyPI | json5 | 0.14.0 | непряма |
| PyPI | jsonschema | 4.26.0 | непряма |
| PyPI | jsonschema-specifications | 2025.9.1 | непряма |
| PyPI | kiwisolver | 1.5.0 | непряма |
| PyPI | llvmlite | 0.47.0 | непряма |
| PyPI | mako | 1.3.12 | непряма |
| PyPI | markdown | 3.10.2 | непряма |
| PyPI | markdown-it-py | 4.2.0 | непряма |
| PyPI | markupsafe | 3.0.3 | непряма |
| PyPI | matplotlib-inline | 0.2.2 | непряма |
| PyPI | mccabe | 0.7.0 | непряма |
| PyPI | mdurl | 0.1.2 | непряма |
| PyPI | mergedeep | 1.3.4 | непряма |
| PyPI | mkdocs | 1.6.1 | непряма |
| PyPI | mkdocs-autorefs | 1.4.4 | непряма |
| PyPI | mkdocs-get-deps | 0.2.2 | непряма |
| PyPI | mkdocs-material | 9.7.7 | непряма |
| PyPI | mkdocs-material-extensions | 1.3.1 | непряма |
| PyPI | mkdocstrings | 1.0.6 | непряма |
| PyPI | mkdocstrings-python | 2.0.5 | непряма |
| PyPI | ml-dtypes | 0.5.4 | непряма |
| PyPI | mlflow | 3.13.0 | непряма |
| PyPI | mlflow-skinny | 3.13.0 | непряма |
| PyPI | mlflow-tracing | 3.13.0 | непряма |
| PyPI | mmh3 | 5.2.1 | непряма |
| PyPI | mock | 4.0.3 | непряма |
| PyPI | mpmath | 1.3.0 | непряма |
| PyPI | msgpack | 1.2.1 | непряма |
| PyPI | multidict | 6.7.1 | непряма |
| PyPI | mypy-extensions | 1.1.0 | непряма |
| PyPI | narwhals | 2.22.1 | непряма |
| PyPI | nest-asyncio | 1.6.0 | непряма |
| PyPI | numba | 0.65.1 | непряма |
| PyPI | numpy | 2.2.6 | непряма |
| PyPI | numpy | 2.4.6 | непряма |
| PyPI | nvidia-cublas | 13.1.1.3 | непряма |
| PyPI | nvidia-cuda-cupti | 13.0.85 | непряма |
| PyPI | nvidia-cuda-nvrtc | 13.0.88 | непряма |
| PyPI | nvidia-cuda-runtime | 13.0.96 | непряма |
| PyPI | nvidia-cudnn-cu13 | 9.20.0.48 | непряма |
| PyPI | nvidia-cufft | 12.0.0.61 | непряма |
| PyPI | nvidia-cufile | 1.15.1.6 | непряма |
| PyPI | nvidia-curand | 10.4.0.35 | непряма |
| PyPI | nvidia-cusolver | 12.0.4.66 | непряма |
| PyPI | nvidia-cusparse | 12.6.3.3 | непряма |
| PyPI | nvidia-cusparselt-cu13 | 0.8.1 | непряма |
| PyPI | nvidia-nccl-cu12 | 2.30.7 | непряма |
| PyPI | nvidia-nccl-cu13 | 2.29.7 | непряма |
| PyPI | nvidia-nvjitlink | 13.0.88 | непряма |
| PyPI | nvidia-nvshmem-cu13 | 3.4.5 | непряма |
| PyPI | nvidia-nvtx | 13.0.85 | непряма |
| PyPI | omegaconf | 2.3.0 | непряма |
| PyPI | onnx | 1.22.0 | непряма |
| PyPI | onnxruntime | 1.24.3 | непряма |
| PyPI | onnxruntime | 1.26.0 | непряма |
| PyPI | opentelemetry-api | 1.42.1 | непряма |
| PyPI | opentelemetry-proto | 1.42.1 | непряма |
| PyPI | opentelemetry-sdk | 1.42.1 | непряма |
| PyPI | opentelemetry-semantic-conventions | 0.63b1 | непряма |
| PyPI | optuna | 4.9.0 | непряма |
| PyPI | orderly-set | 5.5.0 | непряма |
| PyPI | packaging | 26.2 | непряма |
| PyPI | paginate | 0.5.7 | непряма |
| PyPI | paramiko | 5.0.0 | непряма |
| PyPI | parso | 0.8.7 | непряма |
| PyPI | pathspec | 1.1.1 | непряма |
| PyPI | pexpect | 4.9.0 | непряма |
| PyPI | pillow | 12.2.0 | непряма |
| PyPI | platformdirs | 4.10.0 | непряма |
| PyPI | plotly | 6.8.0 | непряма |
| PyPI | pluggy | 1.6.0 | непряма |
| PyPI | prettytable | 3.17.0 | непряма |
| PyPI | prompt-toolkit | 3.0.52 | непряма |
| PyPI | propcache | 0.5.2 | непряма |
| PyPI | protobuf | 6.33.6 | непряма |
| PyPI | psutil | 7.2.2 | непряма |
| PyPI | ptyprocess | 0.7.0 | непряма |
| PyPI | publication | 0.0.3 | непряма |
| PyPI | pure-eval | 0.2.3 | непряма |
| PyPI | pyarrow | 24.0.0 | непряма |
| PyPI | pyasn1 | 0.6.3 | непряма |
| PyPI | pyasn1-modules | 0.4.2 | непряма |
| PyPI | pycodestyle | 2.14.0 | непряма |
| PyPI | pycparser | 3.0 | непряма |
| PyPI | pydantic | 2.13.4 | непряма |
| PyPI | pydantic-core | 2.46.4 | непряма |
| PyPI | pyflakes | 3.4.0 | непряма |
| PyPI | pygments | 2.20.0 | непряма |
| PyPI | pyiceberg | 0.11.1 | непряма |
| PyPI | pymdown-extensions | 11.0.1 | непряма |
| PyPI | pynacl | 1.6.2 | непряма |
| PyPI | pynndescent | 0.6.0 | непряма |
| PyPI | pyparsing | 3.3.2 | непряма |
| PyPI | pyroaring | 1.1.0 | непряма |
| PyPI | pytest | — | непряма |
| PyPI | pytest | 9.0.3 | непряма |
| PyPI | pytest-cov | — | непряма |
| PyPI | pytest-cov | 7.1.0 | непряма |
| PyPI | pytest-sugar | — | непряма |
| PyPI | pytest-sugar | 1.1.1 | непряма |
| PyPI | pytest-xdist | 3.8.0 | непряма |
| PyPI | python-dateutil | 2.9.0.post0 | непряма |
| PyPI | python-dotenv | 1.2.2 | непряма |
| PyPI | python-rapidjson | 1.23 | непряма |
| PyPI | pytokens | 0.4.1 | непряма |
| PyPI | pytz | 2026.2 | непряма |
| PyPI | pywin32 | 312 | непряма |
| PyPI | pyyaml | 6.0.3 | непряма |
| PyPI | pyyaml-env-tag | 1.1 | непряма |
| PyPI | ray | 2.56.0 | непряма |
| PyPI | referencing | 0.37.0 | непряма |
| PyPI | retrying | 1.4.2 | непряма |
| PyPI | rich | 14.3.4 | непряма |
| PyPI | rpds-py | 0.30.0 | непряма |
| PyPI | rpds-py | 2026.5.1 | непряма |
| PyPI | s3fs | 2026.4.0 | непряма |
| PyPI | s3transfer | 0.17.1 | непряма |
| PyPI | sagemaker-mlflow | 0.4.0 | непряма |
| PyPI | sagemaker-schema-inference-artifacts | 0.0.5 | непряма |
| PyPI | schema | 0.7.8 | непряма |
| PyPI | scipy | 1.15.3 | непряма |
| PyPI | scipy | 1.17.1 | непряма |
| PyPI | setuptools | 81.0.0 | непряма |
| PyPI | shap | — | непряма |
| PyPI | six | 1.17.0 | непряма |
| PyPI | skops | 0.14.0 | непряма |
| PyPI | smdebug-rulesconfig | 1.0.1 | непряма |
| PyPI | smmap | 5.0.3 | непряма |
| PyPI | sqlalchemy | 2.0.50 | непряма |
| PyPI | sqlparse | 0.5.5 | непряма |
| PyPI | stack-data | 0.6.3 | непряма |
| PyPI | starlette | 1.3.1 | непряма |
| PyPI | strictyaml | 1.7.3 | непряма |
| PyPI | sympy | 1.14.0 | непряма |
| PyPI | tblib | 3.2.2 | непряма |
| PyPI | tenacity | 9.1.4 | непряма |
| PyPI | tensorboardx | 2.6.5 | непряма |
| PyPI | termcolor | 3.3.0 | непряма |
| PyPI | threadpoolctl | 3.6.0 | непряма |
| PyPI | tomli | 2.4.1 | непряма |
| PyPI | torch | — | непряма |
| PyPI | torch | 2.12.0 | непряма |
| PyPI | tqdm | — | непряма |
| PyPI | tqdm | 4.68.2 | непряма |
| PyPI | traitlets | 5.15.1 | непряма |
| PyPI | triton | 3.7.0 | непряма |
| PyPI | tritonclient | 2.69.0 | непряма |
| PyPI | typeguard | 2.13.3 | непряма |
| PyPI | typing-extensions | 4.15.0 | непряма |
| PyPI | typing-inspection | 0.4.2 | непряма |
| PyPI | tzdata | 2026.2 | непряма |
| PyPI | umap-learn | — | непряма |
| PyPI | umap-learn | 0.5.12 | непряма |
| PyPI | urllib3 | 2.7.0 | непряма |
| PyPI | uvicorn | — | непряма |
| PyPI | uvicorn | 0.49.0 | непряма |
| PyPI | waitress | 3.0.2 | непряма |
| PyPI | watchdog | 6.0.0 | непряма |
| PyPI | wcwidth | 0.8.1 | непряма |
| PyPI | werkzeug | 3.1.8 | непряма |
| PyPI | wrapt | 2.2.1 | непряма |
| PyPI | xgboost-cpu | — | непряма |
| PyPI | yarl | 1.24.2 | непряма |
| PyPI | zipp | 4.1.0 | непряма |
| PyPI | zope-event | 6.2 | непряма |
| PyPI | zope-interface | 8.5 | непряма |
| PyPI | zstandard | 0.25.0 | непряма |
Звіт у форматі JSON машиночитний
{
"data": {
"repo": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"is_fork": false,
"size_kb": 91631,
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"languages": {
"CSS": 62868,
"Shell": 29010,
"Python": 3687778,
"Makefile": 971,
"Batchfile": 874,
"Dockerfile": 12108,
"JavaScript": 46472,
"Jupyter Notebook": 81119
},
"pushed_at": "2026-07-18T17:24:31Z",
"created_at": "2022-12-06T17:41:31Z",
"owner_type": "Organization",
"updated_at": "2026-07-18T17:24:34Z",
"description": "Workbench: An easy to use Python API for creating and deploying AWS SageMaker Models",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://www.supercowpowers.com",
"name": "SuperCowPowers",
"type": "Organization",
"login": "SuperCowPowers",
"company": null,
"location": "United States of America",
"followers": 29,
"avatar_url": "https://avatars.githubusercontent.com/u/6900187?v=4",
"created_at": "2014-03-09T18:36:12Z",
"is_verified": null,
"public_repos": 13,
"account_age_days": 4513
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 100,
"commits_last_year": 2128,
"latest_release_at": "2026-07-18T17:24:11Z",
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 52,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 75,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "workbench",
"exists": true,
"license": null,
"keywords": [
"SageMaker",
"Machine Learning",
"AWS",
"Python",
"Utilities",
"Development Status :: 4 - Beta",
"Programming Language :: Python :: 3.10",
"Programming Language :: Python :: 3.11",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Topic :: Scientific/Engineering"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/workbench/",
"is_deprecated": false,
"latest_version": "0.8.409",
"repository_url": "https://github.com/SuperCowPowers/workbench",
"versions_count": 330,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 10144,
"first_published_at": "2014-07-08T00:59:42.285343Z",
"latest_published_at": "2026-07-18T17:24:07.930211Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 7,
"stars": 51,
"watchers": 2,
"open_issues_and_prs": 192
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples",
"notebooks"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"lambda_layers/requirements.txt",
"pyproject.toml",
"tests/requirements-dev.txt"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "boto3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "botocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.42.2"
},
{
"name": "awswrangler",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.4.0"
},
{
"name": "sagemaker",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.6.0, < 3.13"
},
{
"name": "sagemaker-core",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.12.0, < 2.13"
},
{
"name": "sagemaker-mlops",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-serve",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "sagemaker-train",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.12.0, < 1.13"
},
{
"name": "redis",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 5.0.1"
},
{
"name": "cryptography",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 46.0.0"
},
{
"name": "requests",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.26.0"
},
{
"name": "aiobotocore",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.7.0"
},
{
"name": "pandas",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.2.1, < 3.0"
},
{
"name": "scikit-learn",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.5.2"
},
{
"name": "xgboost",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.0.3"
},
{
"name": "joblib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 1.3.2"
},
{
"name": "rdkit",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2026.3.1"
},
{
"name": "mordredcommunity",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 2.0.6"
},
{
"name": "ipython",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 8.37.0"
},
{
"name": "pyreadline3",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": null
},
{
"name": "matplotlib",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.9.2"
},
{
"name": "networkx",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">= 3.2"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "aiobotocore",
"direct": true,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "awswrangler",
"direct": true,
"version": "3.16.1",
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "boto3",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "botocore",
"direct": true,
"version": "1.43.0",
"ecosystem": "pypi"
},
{
"name": "cryptography",
"direct": true,
"version": "48.0.1",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "8.39.0",
"ecosystem": "pypi"
},
{
"name": "ipython",
"direct": true,
"version": "9.14.1",
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "joblib",
"direct": true,
"version": "1.5.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib",
"direct": true,
"version": "3.10.9",
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "mordredcommunity",
"direct": true,
"version": "2.0.7",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.4.2",
"ecosystem": "pypi"
},
{
"name": "networkx",
"direct": true,
"version": "3.6.1",
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pandas",
"direct": true,
"version": "2.3.3",
"ecosystem": "pypi"
},
{
"name": "pyreadline3",
"direct": true,
"version": "3.5.6",
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "rdkit",
"direct": true,
"version": "2026.3.3",
"ecosystem": "pypi"
},
{
"name": "redis",
"direct": true,
"version": "8.0.0",
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "requests",
"direct": true,
"version": "2.34.2",
"ecosystem": "pypi"
},
{
"name": "sagemaker",
"direct": true,
"version": "3.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-core",
"direct": true,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlops",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-serve",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-train",
"direct": true,
"version": "1.12.0",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.7.2",
"ecosystem": "pypi"
},
{
"name": "scikit-learn",
"direct": true,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "xgboost",
"direct": true,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "aiohappyeyeballs",
"direct": false,
"version": "2.6.2",
"ecosystem": "pypi"
},
{
"name": "aiohttp",
"direct": false,
"version": "3.14.1",
"ecosystem": "pypi"
},
{
"name": "aioitertools",
"direct": false,
"version": "0.13.0",
"ecosystem": "pypi"
},
{
"name": "aiosignal",
"direct": false,
"version": "1.4.0",
"ecosystem": "pypi"
},
{
"name": "alembic",
"direct": false,
"version": "1.18.4",
"ecosystem": "pypi"
},
{
"name": "annotated-doc",
"direct": false,
"version": "0.0.4",
"ecosystem": "pypi"
},
{
"name": "annotated-types",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "antlr4-python3-runtime",
"direct": false,
"version": "4.9.3",
"ecosystem": "pypi"
},
{
"name": "anyio",
"direct": false,
"version": "4.13.0",
"ecosystem": "pypi"
},
{
"name": "asgiref",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "asttokens",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "async-timeout",
"direct": false,
"version": "5.0.1",
"ecosystem": "pypi"
},
{
"name": "attrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-awscli-v1",
"direct": false,
"version": "2.2.282",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-asset-node-proxy-agent-v6",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-cloud-assembly-schema",
"direct": false,
"version": "54.8.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.211.0",
"ecosystem": "pypi"
},
{
"name": "aws-cdk-lib",
"direct": false,
"version": "2.261.0",
"ecosystem": "pypi"
},
{
"name": "babel",
"direct": false,
"version": "2.18.0",
"ecosystem": "pypi"
},
{
"name": "backrefs",
"direct": false,
"version": "7.0",
"ecosystem": "pypi"
},
{
"name": "bcrypt",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "black",
"direct": false,
"version": "26.5.1",
"ecosystem": "pypi"
},
{
"name": "blinker",
"direct": false,
"version": "1.9.0",
"ecosystem": "pypi"
},
{
"name": "brotli",
"direct": false,
"version": "1.2.0",
"ecosystem": "pypi"
},
{
"name": "cachebox",
"direct": false,
"version": "5.2.3",
"ecosystem": "pypi"
},
{
"name": "cachetools",
"direct": false,
"version": "6.2.6",
"ecosystem": "pypi"
},
{
"name": "cattrs",
"direct": false,
"version": "26.1.0",
"ecosystem": "pypi"
},
{
"name": "certifi",
"direct": false,
"version": "2026.5.20",
"ecosystem": "pypi"
},
{
"name": "cffi",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "charset-normalizer",
"direct": false,
"version": "3.4.7",
"ecosystem": "pypi"
},
{
"name": "chemprop",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "click",
"direct": false,
"version": "8.4.1",
"ecosystem": "pypi"
},
{
"name": "cloudpickle",
"direct": false,
"version": "3.1.2",
"ecosystem": "pypi"
},
{
"name": "colorama",
"direct": false,
"version": "0.4.6",
"ecosystem": "pypi"
},
{
"name": "colorlog",
"direct": false,
"version": "6.10.1",
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "constructs",
"direct": false,
"version": "10.6.0",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.2",
"ecosystem": "pypi"
},
{
"name": "contourpy",
"direct": false,
"version": "1.3.3",
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "coverage",
"direct": false,
"version": "7.14.1",
"ecosystem": "pypi"
},
{
"name": "cuda-bindings",
"direct": false,
"version": "13.3.1",
"ecosystem": "pypi"
},
{
"name": "cuda-pathfinder",
"direct": false,
"version": "1.5.5",
"ecosystem": "pypi"
},
{
"name": "cuda-toolkit",
"direct": false,
"version": "13.0.2",
"ecosystem": "pypi"
},
{
"name": "cycler",
"direct": false,
"version": "0.12.1",
"ecosystem": "pypi"
},
{
"name": "dash",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-ag-grid",
"direct": false,
"version": "35.2.0",
"ecosystem": "pypi"
},
{
"name": "dash-bootstrap-components",
"direct": false,
"version": "2.0.4",
"ecosystem": "pypi"
},
{
"name": "databricks-sdk",
"direct": false,
"version": "0.116.0",
"ecosystem": "pypi"
},
{
"name": "decorator",
"direct": false,
"version": "5.3.1",
"ecosystem": "pypi"
},
{
"name": "deepdiff",
"direct": false,
"version": "9.1.0",
"ecosystem": "pypi"
},
{
"name": "docker",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "exceptiongroup",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "execnet",
"direct": false,
"version": "2.1.2",
"ecosystem": "pypi"
},
{
"name": "executing",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "fastapi",
"direct": false,
"version": "0.136.3",
"ecosystem": "pypi"
},
{
"name": "filelock",
"direct": false,
"version": "3.29.3",
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "flake8",
"direct": false,
"version": "7.3.0",
"ecosystem": "pypi"
},
{
"name": "flask",
"direct": false,
"version": "3.1.3",
"ecosystem": "pypi"
},
{
"name": "flask-cors",
"direct": false,
"version": "6.0.5",
"ecosystem": "pypi"
},
{
"name": "flatbuffers",
"direct": false,
"version": "25.12.19",
"ecosystem": "pypi"
},
{
"name": "fonttools",
"direct": false,
"version": "4.63.0",
"ecosystem": "pypi"
},
{
"name": "frozenlist",
"direct": false,
"version": "1.8.0",
"ecosystem": "pypi"
},
{
"name": "fsspec",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "gevent",
"direct": false,
"version": "26.5.0",
"ecosystem": "pypi"
},
{
"name": "geventhttpclient",
"direct": false,
"version": "2.3.9",
"ecosystem": "pypi"
},
{
"name": "ghp-import",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gitdb",
"direct": false,
"version": "4.0.12",
"ecosystem": "pypi"
},
{
"name": "gitpython",
"direct": false,
"version": "3.1.50",
"ecosystem": "pypi"
},
{
"name": "google-auth",
"direct": false,
"version": "2.53.0",
"ecosystem": "pypi"
},
{
"name": "graphene",
"direct": false,
"version": "3.4.3",
"ecosystem": "pypi"
},
{
"name": "graphql-core",
"direct": false,
"version": "3.2.11",
"ecosystem": "pypi"
},
{
"name": "graphql-relay",
"direct": false,
"version": "3.2.0",
"ecosystem": "pypi"
},
{
"name": "greenlet",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "griffelib",
"direct": false,
"version": "2.1.0",
"ecosystem": "pypi"
},
{
"name": "gunicorn",
"direct": false,
"version": "26.0.0",
"ecosystem": "pypi"
},
{
"name": "h11",
"direct": false,
"version": "0.16.0",
"ecosystem": "pypi"
},
{
"name": "huey",
"direct": false,
"version": "3.0.1",
"ecosystem": "pypi"
},
{
"name": "idna",
"direct": false,
"version": "3.18",
"ecosystem": "pypi"
},
{
"name": "importlib-metadata",
"direct": false,
"version": "6.11.0",
"ecosystem": "pypi"
},
{
"name": "iniconfig",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "invoke",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "ipython-pygments-lexers",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "itsdangerous",
"direct": false,
"version": "2.2.0",
"ecosystem": "pypi"
},
{
"name": "janus",
"direct": false,
"version": "2.0.0",
"ecosystem": "pypi"
},
{
"name": "jedi",
"direct": false,
"version": "0.20.0",
"ecosystem": "pypi"
},
{
"name": "jinja2",
"direct": false,
"version": "3.1.6",
"ecosystem": "pypi"
},
{
"name": "jmespath",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "jsii",
"direct": false,
"version": "1.138.0",
"ecosystem": "pypi"
},
{
"name": "json5",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema",
"direct": false,
"version": "4.26.0",
"ecosystem": "pypi"
},
{
"name": "jsonschema-specifications",
"direct": false,
"version": "2025.9.1",
"ecosystem": "pypi"
},
{
"name": "kiwisolver",
"direct": false,
"version": "1.5.0",
"ecosystem": "pypi"
},
{
"name": "llvmlite",
"direct": false,
"version": "0.47.0",
"ecosystem": "pypi"
},
{
"name": "mako",
"direct": false,
"version": "1.3.12",
"ecosystem": "pypi"
},
{
"name": "markdown",
"direct": false,
"version": "3.10.2",
"ecosystem": "pypi"
},
{
"name": "markdown-it-py",
"direct": false,
"version": "4.2.0",
"ecosystem": "pypi"
},
{
"name": "markupsafe",
"direct": false,
"version": "3.0.3",
"ecosystem": "pypi"
},
{
"name": "matplotlib-inline",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mccabe",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "mdurl",
"direct": false,
"version": "0.1.2",
"ecosystem": "pypi"
},
{
"name": "mergedeep",
"direct": false,
"version": "1.3.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs",
"direct": false,
"version": "1.6.1",
"ecosystem": "pypi"
},
{
"name": "mkdocs-autorefs",
"direct": false,
"version": "1.4.4",
"ecosystem": "pypi"
},
{
"name": "mkdocs-get-deps",
"direct": false,
"version": "0.2.2",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material",
"direct": false,
"version": "9.7.7",
"ecosystem": "pypi"
},
{
"name": "mkdocs-material-extensions",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings",
"direct": false,
"version": "1.0.6",
"ecosystem": "pypi"
},
{
"name": "mkdocstrings-python",
"direct": false,
"version": "2.0.5",
"ecosystem": "pypi"
},
{
"name": "ml-dtypes",
"direct": false,
"version": "0.5.4",
"ecosystem": "pypi"
},
{
"name": "mlflow",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-skinny",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mlflow-tracing",
"direct": false,
"version": "3.13.0",
"ecosystem": "pypi"
},
{
"name": "mmh3",
"direct": false,
"version": "5.2.1",
"ecosystem": "pypi"
},
{
"name": "mock",
"direct": false,
"version": "4.0.3",
"ecosystem": "pypi"
},
{
"name": "mpmath",
"direct": false,
"version": "1.3.0",
"ecosystem": "pypi"
},
{
"name": "msgpack",
"direct": false,
"version": "1.2.1",
"ecosystem": "pypi"
},
{
"name": "multidict",
"direct": false,
"version": "6.7.1",
"ecosystem": "pypi"
},
{
"name": "mypy-extensions",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "narwhals",
"direct": false,
"version": "2.22.1",
"ecosystem": "pypi"
},
{
"name": "nest-asyncio",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "numba",
"direct": false,
"version": "0.65.1",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.2.6",
"ecosystem": "pypi"
},
{
"name": "numpy",
"direct": false,
"version": "2.4.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-cublas",
"direct": false,
"version": "13.1.1.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-cupti",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-nvrtc",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-cuda-runtime",
"direct": false,
"version": "13.0.96",
"ecosystem": "pypi"
},
{
"name": "nvidia-cudnn-cu13",
"direct": false,
"version": "9.20.0.48",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufft",
"direct": false,
"version": "12.0.0.61",
"ecosystem": "pypi"
},
{
"name": "nvidia-cufile",
"direct": false,
"version": "1.15.1.6",
"ecosystem": "pypi"
},
{
"name": "nvidia-curand",
"direct": false,
"version": "10.4.0.35",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusolver",
"direct": false,
"version": "12.0.4.66",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparse",
"direct": false,
"version": "12.6.3.3",
"ecosystem": "pypi"
},
{
"name": "nvidia-cusparselt-cu13",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu12",
"direct": false,
"version": "2.30.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nccl-cu13",
"direct": false,
"version": "2.29.7",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvjitlink",
"direct": false,
"version": "13.0.88",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvshmem-cu13",
"direct": false,
"version": "3.4.5",
"ecosystem": "pypi"
},
{
"name": "nvidia-nvtx",
"direct": false,
"version": "13.0.85",
"ecosystem": "pypi"
},
{
"name": "omegaconf",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "onnx",
"direct": false,
"version": "1.22.0",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.24.3",
"ecosystem": "pypi"
},
{
"name": "onnxruntime",
"direct": false,
"version": "1.26.0",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-api",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-proto",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-sdk",
"direct": false,
"version": "1.42.1",
"ecosystem": "pypi"
},
{
"name": "opentelemetry-semantic-conventions",
"direct": false,
"version": "0.63b1",
"ecosystem": "pypi"
},
{
"name": "optuna",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "orderly-set",
"direct": false,
"version": "5.5.0",
"ecosystem": "pypi"
},
{
"name": "packaging",
"direct": false,
"version": "26.2",
"ecosystem": "pypi"
},
{
"name": "paginate",
"direct": false,
"version": "0.5.7",
"ecosystem": "pypi"
},
{
"name": "paramiko",
"direct": false,
"version": "5.0.0",
"ecosystem": "pypi"
},
{
"name": "parso",
"direct": false,
"version": "0.8.7",
"ecosystem": "pypi"
},
{
"name": "pathspec",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pexpect",
"direct": false,
"version": "4.9.0",
"ecosystem": "pypi"
},
{
"name": "pillow",
"direct": false,
"version": "12.2.0",
"ecosystem": "pypi"
},
{
"name": "platformdirs",
"direct": false,
"version": "4.10.0",
"ecosystem": "pypi"
},
{
"name": "plotly",
"direct": false,
"version": "6.8.0",
"ecosystem": "pypi"
},
{
"name": "pluggy",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "prettytable",
"direct": false,
"version": "3.17.0",
"ecosystem": "pypi"
},
{
"name": "prompt-toolkit",
"direct": false,
"version": "3.0.52",
"ecosystem": "pypi"
},
{
"name": "propcache",
"direct": false,
"version": "0.5.2",
"ecosystem": "pypi"
},
{
"name": "protobuf",
"direct": false,
"version": "6.33.6",
"ecosystem": "pypi"
},
{
"name": "psutil",
"direct": false,
"version": "7.2.2",
"ecosystem": "pypi"
},
{
"name": "ptyprocess",
"direct": false,
"version": "0.7.0",
"ecosystem": "pypi"
},
{
"name": "publication",
"direct": false,
"version": "0.0.3",
"ecosystem": "pypi"
},
{
"name": "pure-eval",
"direct": false,
"version": "0.2.3",
"ecosystem": "pypi"
},
{
"name": "pyarrow",
"direct": false,
"version": "24.0.0",
"ecosystem": "pypi"
},
{
"name": "pyasn1",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "pyasn1-modules",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "pycodestyle",
"direct": false,
"version": "2.14.0",
"ecosystem": "pypi"
},
{
"name": "pycparser",
"direct": false,
"version": "3.0",
"ecosystem": "pypi"
},
{
"name": "pydantic",
"direct": false,
"version": "2.13.4",
"ecosystem": "pypi"
},
{
"name": "pydantic-core",
"direct": false,
"version": "2.46.4",
"ecosystem": "pypi"
},
{
"name": "pyflakes",
"direct": false,
"version": "3.4.0",
"ecosystem": "pypi"
},
{
"name": "pygments",
"direct": false,
"version": "2.20.0",
"ecosystem": "pypi"
},
{
"name": "pyiceberg",
"direct": false,
"version": "0.11.1",
"ecosystem": "pypi"
},
{
"name": "pymdown-extensions",
"direct": false,
"version": "11.0.1",
"ecosystem": "pypi"
},
{
"name": "pynacl",
"direct": false,
"version": "1.6.2",
"ecosystem": "pypi"
},
{
"name": "pynndescent",
"direct": false,
"version": "0.6.0",
"ecosystem": "pypi"
},
{
"name": "pyparsing",
"direct": false,
"version": "3.3.2",
"ecosystem": "pypi"
},
{
"name": "pyroaring",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": "9.0.3",
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-cov",
"direct": false,
"version": "7.1.0",
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-sugar",
"direct": false,
"version": "1.1.1",
"ecosystem": "pypi"
},
{
"name": "pytest-xdist",
"direct": false,
"version": "3.8.0",
"ecosystem": "pypi"
},
{
"name": "python-dateutil",
"direct": false,
"version": "2.9.0.post0",
"ecosystem": "pypi"
},
{
"name": "python-dotenv",
"direct": false,
"version": "1.2.2",
"ecosystem": "pypi"
},
{
"name": "python-rapidjson",
"direct": false,
"version": "1.23",
"ecosystem": "pypi"
},
{
"name": "pytokens",
"direct": false,
"version": "0.4.1",
"ecosystem": "pypi"
},
{
"name": "pytz",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "pywin32",
"direct": false,
"version": "312",
"ecosystem": "pypi"
},
{
"name": "pyyaml",
"direct": false,
"version": "6.0.3",
"ecosystem": "pypi"
},
{
"name": "pyyaml-env-tag",
"direct": false,
"version": "1.1",
"ecosystem": "pypi"
},
{
"name": "ray",
"direct": false,
"version": "2.56.0",
"ecosystem": "pypi"
},
{
"name": "referencing",
"direct": false,
"version": "0.37.0",
"ecosystem": "pypi"
},
{
"name": "retrying",
"direct": false,
"version": "1.4.2",
"ecosystem": "pypi"
},
{
"name": "rich",
"direct": false,
"version": "14.3.4",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "0.30.0",
"ecosystem": "pypi"
},
{
"name": "rpds-py",
"direct": false,
"version": "2026.5.1",
"ecosystem": "pypi"
},
{
"name": "s3fs",
"direct": false,
"version": "2026.4.0",
"ecosystem": "pypi"
},
{
"name": "s3transfer",
"direct": false,
"version": "0.17.1",
"ecosystem": "pypi"
},
{
"name": "sagemaker-mlflow",
"direct": false,
"version": "0.4.0",
"ecosystem": "pypi"
},
{
"name": "sagemaker-schema-inference-artifacts",
"direct": false,
"version": "0.0.5",
"ecosystem": "pypi"
},
{
"name": "schema",
"direct": false,
"version": "0.7.8",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.15.3",
"ecosystem": "pypi"
},
{
"name": "scipy",
"direct": false,
"version": "1.17.1",
"ecosystem": "pypi"
},
{
"name": "setuptools",
"direct": false,
"version": "81.0.0",
"ecosystem": "pypi"
},
{
"name": "shap",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "six",
"direct": false,
"version": "1.17.0",
"ecosystem": "pypi"
},
{
"name": "skops",
"direct": false,
"version": "0.14.0",
"ecosystem": "pypi"
},
{
"name": "smdebug-rulesconfig",
"direct": false,
"version": "1.0.1",
"ecosystem": "pypi"
},
{
"name": "smmap",
"direct": false,
"version": "5.0.3",
"ecosystem": "pypi"
},
{
"name": "sqlalchemy",
"direct": false,
"version": "2.0.50",
"ecosystem": "pypi"
},
{
"name": "sqlparse",
"direct": false,
"version": "0.5.5",
"ecosystem": "pypi"
},
{
"name": "stack-data",
"direct": false,
"version": "0.6.3",
"ecosystem": "pypi"
},
{
"name": "starlette",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "strictyaml",
"direct": false,
"version": "1.7.3",
"ecosystem": "pypi"
},
{
"name": "sympy",
"direct": false,
"version": "1.14.0",
"ecosystem": "pypi"
},
{
"name": "tblib",
"direct": false,
"version": "3.2.2",
"ecosystem": "pypi"
},
{
"name": "tenacity",
"direct": false,
"version": "9.1.4",
"ecosystem": "pypi"
},
{
"name": "tensorboardx",
"direct": false,
"version": "2.6.5",
"ecosystem": "pypi"
},
{
"name": "termcolor",
"direct": false,
"version": "3.3.0",
"ecosystem": "pypi"
},
{
"name": "threadpoolctl",
"direct": false,
"version": "3.6.0",
"ecosystem": "pypi"
},
{
"name": "tomli",
"direct": false,
"version": "2.4.1",
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "torch",
"direct": false,
"version": "2.12.0",
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "tqdm",
"direct": false,
"version": "4.68.2",
"ecosystem": "pypi"
},
{
"name": "traitlets",
"direct": false,
"version": "5.15.1",
"ecosystem": "pypi"
},
{
"name": "triton",
"direct": false,
"version": "3.7.0",
"ecosystem": "pypi"
},
{
"name": "tritonclient",
"direct": false,
"version": "2.69.0",
"ecosystem": "pypi"
},
{
"name": "typeguard",
"direct": false,
"version": "2.13.3",
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": false,
"version": "4.15.0",
"ecosystem": "pypi"
},
{
"name": "typing-inspection",
"direct": false,
"version": "0.4.2",
"ecosystem": "pypi"
},
{
"name": "tzdata",
"direct": false,
"version": "2026.2",
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "umap-learn",
"direct": false,
"version": "0.5.12",
"ecosystem": "pypi"
},
{
"name": "urllib3",
"direct": false,
"version": "2.7.0",
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "uvicorn",
"direct": false,
"version": "0.49.0",
"ecosystem": "pypi"
},
{
"name": "waitress",
"direct": false,
"version": "3.0.2",
"ecosystem": "pypi"
},
{
"name": "watchdog",
"direct": false,
"version": "6.0.0",
"ecosystem": "pypi"
},
{
"name": "wcwidth",
"direct": false,
"version": "0.8.1",
"ecosystem": "pypi"
},
{
"name": "werkzeug",
"direct": false,
"version": "3.1.8",
"ecosystem": "pypi"
},
{
"name": "wrapt",
"direct": false,
"version": "2.2.1",
"ecosystem": "pypi"
},
{
"name": "xgboost-cpu",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "yarl",
"direct": false,
"version": "1.24.2",
"ecosystem": "pypi"
},
{
"name": "zipp",
"direct": false,
"version": "4.1.0",
"ecosystem": "pypi"
},
{
"name": "zope-event",
"direct": false,
"version": "6.2",
"ecosystem": "pypi"
},
{
"name": "zope-interface",
"direct": false,
"version": "8.5",
"ecosystem": "pypi"
},
{
"name": "zstandard",
"direct": false,
"version": "0.25.0",
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 295,
"direct_count": 35,
"indirect_count": 260
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 81,
"open_issues": 192,
"closed_ratio": 0.605,
"closed_issues": 294,
"closed_unmerged_prs": 31
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "brifordwylie",
"commits": 7193,
"avatar_url": "https://avatars.githubusercontent.com/u/4806709?u=4621f8834a58a072c0487a11c1a464ba79001d85&v=4"
},
{
"type": "User",
"login": "ScottKolmarWFI",
"commits": 47,
"avatar_url": "https://avatars.githubusercontent.com/u/103940733?u=66d82044a9f6ec5a505b6b5dad879448881f2e78&v=4"
},
{
"type": "User",
"login": "giupb",
"commits": 32,
"avatar_url": "https://avatars.githubusercontent.com/u/52609794?u=7e31f70e3b071aecc0ca8da0971ed6e7e05a1fdf&v=4"
},
{
"type": "User",
"login": "luiztauffer",
"commits": 17,
"avatar_url": "https://avatars.githubusercontent.com/u/24541631?u=982d8cef4df0c59e59ce14dc54909c10dded7905&v=4"
},
{
"type": "User",
"login": "sdidier-dev",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/73602526?u=c6239ee652448f997bfd774484b5163faa2d691c&v=4"
},
{
"type": "User",
"login": "andrew-huynh",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/u/86267299?u=e6337b661122f0d3838a6ea2746649992a30e3a1&v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 2,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
},
{
"type": "User",
"login": "keilogic",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/189083319?v=4"
}
],
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"aws-tests.yml",
"deploy-docs.yml",
"endpoint-import-smoke.yml",
"gitleaks.yml",
"lockfile-drift.yml",
"publish.yml",
"python-lint.yml"
],
"has_docs_dir": true,
"linter_configs": [
".flake8",
"tox.ini"
],
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"security_signals": {
"lockfiles": [
"uv.lock"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 6 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 0,
"reason": "10 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "fc6c71b64a7b3506b6a1b4d5feac6fbc5eb225fb",
"ran_at": "2026-07-18T17:24:45Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": true,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/SuperCowPowers/workbench",
"host": "github.com",
"name": "workbench",
"owner": "SuperCowPowers"
},
"metrics": {
"overall": {
"key": "overall",
"band": "good",
"name": "Overall health",
"note": null,
"notes": [],
"value": 72,
"inputs": {
"security": 50,
"vitality": 96,
"community": 57,
"governance": 58,
"engineering": 95
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 96,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "excellent",
"name": "Development activity",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"commits_last_year": 2128,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 52
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "52/52 weeks with commits",
"points": 36,
"status": "met",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 52
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "2128 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 2128
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 100,
"latest_release_tag": "v0.8.409",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 1.1
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~1.1 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 1.1
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 57,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "at_risk",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 34,
"inputs": {
"forks": 7,
"stars": 51,
"watchers": 2,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "51 stars",
"points": 27.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 51
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "7 forks",
"points": 6.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 7
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "2 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 2
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 77,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 67,
"inputs": {
"packages": [
"workbench"
],
"dependents": null,
"ecosystems": "pypi",
"total_downloads": null,
"monthly_downloads": 10144
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "10,144 downloads/month across pypi",
"points": 53.4,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 10144,
"ecosystems": "pypi"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 58,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "at_risk",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 30,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 8,
"top_contributor_share": 0.986
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.3,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "8 contributors",
"points": 10.8,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 8
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"merged_prs": 81,
"open_issues": 192,
"closed_issues": 294,
"issue_closed_ratio": 0.605,
"closed_unmerged_prs": 31
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "60% of issues closed",
"points": 28.3,
"status": "partial",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 60
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "81/112 decided PRs merged",
"points": 27.7,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 81,
"decided": 112
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 61,
"inputs": {
"followers": 29,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "SuperCowPowers",
"public_repos": 13,
"account_age_days": 4513
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "29 followers of SuperCowPowers",
"points": 10.6,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 29,
"login": "SuperCowPowers"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "13 public repos, account ~12 yr old",
"points": 20.3,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 13
}
},
{
"code": "account_age_years",
"params": {
"years": 12
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"workbench"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "330 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 330
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "excellent",
"name": "Engineering Quality",
"value": 95,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "excellent",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "7 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 7
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": ".flake8, tox.ini",
"points": 16,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 9.6,
"status": "met",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "excellent",
"name": "Documentation",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"topics": [
"aws",
"big-data",
"machine-learning",
"python",
"spark",
"data-engineering",
"pandas"
],
"has_wiki": true,
"homepage": "https://www.supercowpowers.com",
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://www.supercowpowers.com",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "7 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 7
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 50,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection, CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection",
"ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 6 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 3 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "10 existing vulnerabilities detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 3
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 44,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 73,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"uv.lock"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"Makefile"
],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": ".flake8, tox.ini",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".flake8, tox.ini"
}
}
],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 55,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 70242,
"source_files_sampled": 637,
"oversized_source_files": 4
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "4/637 source files over 60KB",
"points": 54.7,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 637,
"oversized": 4
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples",
"notebooks"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples, notebooks",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples, notebooks"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-18T17:25:10.029741Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/s/SuperCowPowers/workbench.svg",
"full_name": "SuperCowPowers/workbench",
"license_state": "standard",
"license_spdx": "MIT"
}Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.
Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.14.0 — повна методологія · вікі метрик.
Як окремий результат виглядає на тлі всього реєстру: сукупна статистика — PyPI.