Öffentliches Register
Software-GesundheitsberichtSchema 0.16.0 · Metriken 1.13.0 · 2026-07-20 19:15 UTC

blockshiftnetwork / chat-markdown-converter

Convert AI-generated Markdown to WhatsApp, Telegram, Discord, Slack and Instagram compatible formats using an Intermediate Representation (IR) in PHP.

PHPMIT★ 12 Sterne⑂ 0 Forksseit Feb. 2026Auf GitHub ansehen ↗

blockshiftnetwork/chat-markdown-converter erreicht einen Gesundheitsindex von 55 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Vitality (73/100) ab, am schwächsten bei AI Readiness (26/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.

55
gesamt / 100
Mittel

Software-Gesundheitsindex

Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.

55
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
VitalitätCommunity &VerbreitungNachhaltigkeit &GovernanceEngineering-QualitätSicherheitAI Readiness

Bewertungsprofil

Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.

Eigentümerschaft

Blockshift NetworkOrganisation
2 Follower29 öffentliche Reposseit Aug. 2018

Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.

Paket-Ökosysteme

RegistryPaketVersionDownloads / MonatVersionenZuletzt veröffentlichtTags
Packagistblockshiftnetwork/chat-markdown-converterv0.0.44.6764vor 26 Tagenphpmarkdownchatlaravelinstagramwhatsappslackaitelegramdiscordchatgptllmblockshiftnetworkchat-markdown-converter

Metriken nach Kategorie

Vitalität

Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?

73Gut · 22 % des Gesamtindex
Wie die Bewertung erfolgt
36/36Push-Aktualität — letzter Push vor 0 Tagen
2.8/36Commit-Rhythmus — 4/52 Wochen mit Commits
13.3/18Commit-Volumen — 29 Commits im letzten Jahr
8/10OpenSSF Scorecard: Maintained — 10 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 8
Verwendete Eingangsdaten
commits_last_year29
human_commit_share
days_since_last_push0
active_weeks_last_year4
Wie die Bewertung erfolgt
27/27Liefert Releases aus — 4 Releases veröffentlicht
36/36Release-Aktualität — letztes Release vor 26 Tagen
19.8/27Release-Rhythmus — ein Release etwa alle 46,9 Tage
0/10OpenSSF Scorecard: Signed-Releases — keine Daten
Verwendete Eingangsdaten
releases_count4
latest_release_tagv0.0.4
releases_from_tagsnein
days_since_latest_release26
mean_days_between_releases46,9
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.

Community & Verbreitung

Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?

37Gefährdet · 18 % des Gesamtindex
Wie die Bewertung erfolgt
16.9/60Stars — 12 Stars
0/25Forks — 0 Forks
0/15Watcher — 0 Watcher
Verwendete Eingangsdaten
forks0
stars12
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Wie die Bewertung erfolgt
22.5/22.5README
22.5/22.5Lizenz — anerkannte Lizenz (MIT)
0/18CONTRIBUTING-Leitfaden
0/13.5Verhaltenskodex
0/7.2Issue-Vorlage
0/6.3PR-Vorlage
Verwendete Eingangsdaten
has_readmeja
has_licenseja
has_contributingnein
has_issue_templatenein
has_code_of_conductnein
has_pull_request_templatenein
Wie die Bewertung erfolgt
48.9/80Downloads pro Monat — 4.676 Downloads/Monat über packagist
0/20Abhängige in der Registry — 0 Pakete hängen davon ab
Verwendete Eingangsdaten
packagesblockshiftnetwork/chat-markdown-converter
dependents0
ecosystemspackagist
total_downloads10.725
monthly_downloads4.676

Nachhaltigkeit & Governance

Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?

54Mittel · 24 % des Gesamtindex
Wie die Bewertung erfolgt
9/54Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab
2.2/22.5Commit-Verteilung — wichtigste beitragende Person verfasste 90 % der Commits
2.7/13.5Breite der Beitragenden — 2 Beitragende
6/10OpenSSF Scorecard: Contributors — project has 2 contributing companies or organizations -- score normalized to 6
Verwendete Eingangsdaten
bus_factor1
contributors_sampled2
top_contributor_share0,9
Wie die Bewertung erfolgt
0/46.8Issue-Lösungsquote — keine Issues oder keine Daten
33.5/38.3PR-Annahme — 7/8 entschiedene PRs gemergt
0/15OpenSSF Scorecard: Code-Review — Found 0/27 approved changesets -- score normalized to 0
Verwendete Eingangsdaten
merged_prs7
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs1
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Issue-Lösungsquote. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
30/30Organisatorische Trägerschaft — im Besitz einer Organisation
0/20Verifizierte Domain
3.4/25Reichweite des Inhabers — 2 Follower von blockshiftnetwork
22.8/25Kontohistorie — 29 öffentliche Repos, Kontoalter ca. 7 Jahre
Verwendete Eingangsdaten
followers2
owner_typeOrganization
is_verified
owner_loginblockshiftnetwork
public_repos29
account_age_days2.904

Paketpflege

92Exzellent
Wie die Bewertung erfolgt
25/25Veröffentlicht & auflösbar — 1 Paket(e) auf packagist
35/35Veröffentlichungsaktualität — letzte Veröffentlichung vor 26 Tagen
12/20Versionshistorie — 4 veröffentlichte Versionen
20/20Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen
Verwendete Eingangsdaten
packagesblockshiftnetwork/chat-markdown-converter
ecosystemspackagist
any_deprecatednein
min_days_since_publish26

Engineering-Qualität

Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?

58Mittel · 20 % des Gesamtindex
Wie die Bewertung erfolgt
24/24CI-Workflows — 4 Workflow(s)
24/24Tests vorhanden
0/16Linter-Konfiguration
0/9.6Pre-Commit-Hooks
6.4/6.4.editorconfig
10/20OpenSSF Scorecard: CI-Tests — 4 out of 7 merged PRs checked by a CI test -- score normalized to 5
Verwendete Eingangsdaten
has_cija
has_testsja
has_editorconfigja
has_linter_confignein
has_precommit_confignein
Wie die Bewertung erfolgt
30/30README
0/25Dokumentationsverzeichnis
0/15Dokumentations-/Homepage-Site
10/10Repository-Beschreibung
10/10Topics — 15 Topics
0/10Wiki
Verwendete Eingangsdaten
topicsai, ai-agents, anthropic, chatgpt, gemini, package, php, slack, telegram, whatsapp, discord, instagram, laravel, llm, markdown
has_wikinein
homepage
has_readmeja
has_docs_dirnein
has_descriptionja

Sicherheit

Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?

48Gefährdet · 16 % des Gesamtindex

Sicherheitslage

48Gefährdet
Wie die Bewertung erfolgt
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
1.2/2.5CI-Tests — 4 out of 7 merged PRs checked by a CI test -- score normalized to 5
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/27 approved changesets -- score normalized to 0
1.5/2.5Contributors — project has 2 contributing companies or organizations -- score normalized to 6
0/10Dangerous-Workflow — keine Daten
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Lizenz — license file detected
6/7.5Maintained — 10 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 8
0/5Packaging — keine Daten
0/5Pinned-Dependencies — keine Daten
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — keine Daten
0/7.5Token-Permissions — keine Daten
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Verwendete Eingangsdaten
sourceopenssf_scorecard
checks_evaluated13
scorecard_versionv5.5.0
checks_inconclusive5
scorecard_aggregate4,8
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Die verbleibenden Gewichte wurden renormalisiert.

AI Readiness

Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.

26Kritisch · 0 % des Gesamtindex
Wie die Bewertung erfolgt
0/45Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln
0/15Maschinenlesbare Doku (llms.txt)
0/40Lesbare Commit-Historie — keine Daten
Verwendete Eingangsdaten
has_llms_txtnein
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Lesbare Commit-Historie. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
0/18Bootstrap mit einem Befehl
22/22Automatisierte Tests
0/11Lint-/Format-Konfiguration
0/11Statische Typprüfung
0/10Reproduzierbare Umgebung
0/10Belegte Agentenpraxis — keine Daten
5/8Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet
0/10OpenSSF Scorecard: Pinned-Dependencies — keine Daten
Verwendete Eingangsdaten
has_nixnein
has_testsja
lockfiles
has_dockerfilenein
typed_languagenein
bootstrap_files
has_devcontainernein
has_linter_confignein
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share0
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Belegte Agentenpraxis, OpenSSF Scorecard: Pinned-Dependencies. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
0/45Typprüfbarer Code — PHP ohne Typprüfungs-Konfiguration
55/55Handhabbare Dateigrößen — 0/39 Quelldateien über 60 KB
Verwendete Eingangsdaten
primary_languagePHP
largest_source_bytes16.621
source_files_sampled39
oversized_source_files0

Eckdaten

12GitHub-Sterne
2Mitwirkende
29Commits, letzte 12 Monate
0Tage seit letztem Push
4Releases
1Bus-Faktor
0offene Issues
PackagistPaket-Ökosysteme

Warnungen zur Datenerhebung

  • GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

Weitere Details

OpenSSF Scorecard 4.8 / 10
4.8Gesamtwert

Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).Scorecard v5.5.0 · 2026-07-20 19:14 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
5CI-Tests4 out of 7 merged PRs checked by a CI test -- score normalized to 5
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/27 approved changesets -- score normalized to 0
6Contributorsproject has 2 contributing companies or organizations -- score normalized to 6
k. A.Dangerous-Workflowno workflows found
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
8Maintained10 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 8
k. A.Packagingpackaging workflow not detected
k. A.Pinned-Dependenciesno dependencies found
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
k. A.Signed-Releasesno releases found
k. A.Token-PermissionsNo tokens found
10Vulnerabilities0 existing vulnerabilities detected
Alle Abhängigkeiten nicht erhoben

Der aufgelöste Abhängigkeitssatz konnte für diesen Bericht nicht erhoben werden: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

JSON-Rohbericht maschinenlesbar
{
  "data": {
    "repo": {
      "topics": [
        "ai",
        "ai-agents",
        "anthropic",
        "chatgpt",
        "gemini",
        "package",
        "php",
        "slack",
        "telegram",
        "whatsapp",
        "discord",
        "instagram",
        "laravel",
        "llm",
        "markdown"
      ],
      "is_fork": false,
      "size_kb": 1267,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "PHP": 112558
      },
      "pushed_at": "2026-07-20T12:51:48Z",
      "created_at": "2026-02-02T02:48:00Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-20T12:52:17Z",
      "description": "Convert AI-generated Markdown to WhatsApp, Telegram, Discord, Slack and Instagram compatible formats using an Intermediate Representation (IR) in PHP.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "PHP",
      "significant_languages": [
        "PHP"
      ]
    },
    "owner": {
      "blog": "https://blockshift.us",
      "name": "Blockshift Network",
      "type": "Organization",
      "login": "blockshiftnetwork",
      "company": null,
      "location": "Venezuela",
      "followers": 2,
      "avatar_url": "https://avatars.githubusercontent.com/u/42183424?v=4",
      "created_at": "2018-08-07T16:33:28Z",
      "is_verified": null,
      "public_repos": 29,
      "account_age_days": 2904
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases_count": 4,
      "commits_last_year": 29,
      "latest_release_at": "2026-06-23T21:16:54Z",
      "latest_release_tag": "v0.0.4",
      "releases_from_tags": false,
      "days_since_last_push": 0,
      "active_weeks_last_year": 4,
      "days_since_latest_release": 26,
      "mean_days_between_releases": 46.9
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "blockshiftnetwork/chat-markdown-converter",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "php",
            "markdown",
            "chat",
            "laravel",
            "instagram",
            "whatsapp",
            "slack",
            "ai",
            "telegram",
            "discord",
            "ChatGpt",
            "llm",
            "BlockshiftNetwork",
            "chat-markdown-converter"
          ],
          "ecosystem": "packagist",
          "matches_repo": true,
          "registry_url": "https://packagist.org/packages/blockshiftnetwork/chat-markdown-converter",
          "is_deprecated": false,
          "latest_version": "v0.0.4",
          "repository_url": "https://github.com/blockshiftnetwork/chat-markdown-converter",
          "versions_count": 4,
          "total_downloads": 10725,
          "dependents_count": 0,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": 4676,
          "first_published_at": null,
          "latest_published_at": "2026-06-23T21:16:46Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 26
        }
      ]
    },
    "popularity": {
      "forks": 0,
      "stars": 12,
      "watchers": 0,
      "open_issues_and_prs": 0
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "largest_source_bytes": 16621,
      "source_files_sampled": 39,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "composer.json"
      ],
      "advisories": {
        "error": null,
        "scope": null,
        "source": null,
        "findings": [],
        "collected": false,
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "packagist"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
        "source": null,
        "packages": [],
        "collected": false,
        "truncated": false,
        "total_count": null,
        "direct_count": null,
        "indirect_count": null
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 7,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 1
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "AlexR1712",
          "commits": 27,
          "avatar_url": "https://avatars.githubusercontent.com/u/8460736?v=4"
        },
        {
          "type": "Bot",
          "login": "dependabot[bot]",
          "commits": 3,
          "avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
        }
      ],
      "contributors_sampled": 2,
      "top_contributor_share": 0.9
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "dependabot-auto-merge.yml",
        "fix-php-code-style-issues.yml",
        "run-tests.yml",
        "update-changelog.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": true,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 5,
            "reason": "4 out of 7 merged PRs checked by a CI test -- score normalized to 5",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/27 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 6,
            "reason": "project has 2 contributing companies or organizations -- score normalized to 6",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": null,
            "reason": "no workflows found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 8,
            "reason": "10 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 8",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": null,
            "reason": "no dependencies found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": null,
            "reason": "No tokens found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "e69814f98816a591f9e76ca4d9bdde2539f98ad4",
        "ran_at": "2026-07-20T19:14:56Z",
        "aggregate_score": 4.8,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": true
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/blockshiftnetwork/chat-markdown-converter",
    "host": "github.com",
    "name": "chat-markdown-converter",
    "owner": "blockshiftnetwork"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 55,
      "inputs": {
        "security": 48,
        "vitality": 73,
        "community": 37,
        "governance": 54,
        "engineering": 58
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 73,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 60,
            "inputs": {
              "commits_last_year": 29,
              "human_commit_share": null,
              "days_since_last_push": 0,
              "active_weeks_last_year": 4
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "4/52 weeks with commits",
                "points": 2.8,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "29 commits in the last year",
                "points": 13.3,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 29
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "10 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 8",
                "points": 8,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 92,
            "inputs": {
              "releases_count": 4,
              "latest_release_tag": "v0.0.4",
              "releases_from_tags": false,
              "days_since_latest_release": 26,
              "mean_days_between_releases": 46.9
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "4 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 26 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 26
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~46.9 days",
                "points": 19.8,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 46.9
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 37,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 17,
            "inputs": {
              "forks": 0,
              "stars": 12,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "12 stars",
                "points": 16.9,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 12
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "0 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "at_risk",
            "name": "Ecosystem adoption (downloads)",
            "note": null,
            "notes": [],
            "value": 49,
            "inputs": {
              "packages": [
                "blockshiftnetwork/chat-markdown-converter"
              ],
              "dependents": 0,
              "ecosystems": "packagist",
              "total_downloads": 10725,
              "monthly_downloads": 4676
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "4,676 downloads/month across packagist",
                "points": 48.9,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 4676,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "0 packages depend on it",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "registry_dependents",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 54,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 2,
              "top_contributor_share": 0.9
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 90% of commits",
                "points": 2.2,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 90
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "2 contributors",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 2 contributing companies or organizations -- score normalized to 6",
                "points": 6,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "moderate",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 63,
            "inputs": {
              "merged_prs": 7,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 1
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "7/8 decided PRs merged",
                "points": 33.5,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 7,
                      "decided": 8
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/27 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 56,
            "inputs": {
              "followers": 2,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "blockshiftnetwork",
              "public_repos": 29,
              "account_age_days": 2904
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "2 followers of blockshiftnetwork",
                "points": 3.4,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 2,
                      "login": "blockshiftnetwork"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "29 public repos, account ~7 yr old",
                "points": 22.8,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 29
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 7
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 92,
            "inputs": {
              "packages": [
                "blockshiftnetwork/chat-markdown-converter"
              ],
              "ecosystems": "packagist",
              "any_deprecated": false,
              "min_days_since_publish": 26
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on packagist",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 26 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 26
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "4 published versions",
                "points": 12,
                "status": "partial",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "moderate",
        "name": "Engineering Quality",
        "value": 58,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "moderate",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 64,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": true,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "4 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 6.4,
                "status": "met",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "4 out of 7 merged PRs checked by a CI test -- score normalized to 5",
                "points": 10,
                "status": "partial",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "ai",
                "ai-agents",
                "anthropic",
                "chatgpt",
                "gemini",
                "package",
                "php",
                "slack",
                "telegram",
                "whatsapp",
                "discord",
                "instagram",
                "laravel",
                "llm",
                "markdown"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "15 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 15
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 48,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "dangerous_workflow",
                    "packaging",
                    "pinned_dependencies",
                    "signed_releases",
                    "token_permissions"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 48,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 13,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 5,
              "scorecard_aggregate": 4.8
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "4 out of 7 merged PRs checked by a CI test -- score normalized to 5",
                "points": 1.2,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/27 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 2 contributing companies or organizations -- score normalized to 6",
                "points": 1.5,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no workflows found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "10 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 8",
                "points": 6,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "No tokens found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 2
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 26,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "openssf_scorecard_pinned_dependencies"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 34,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "dependency automation configured, none observed in the sampled commits",
                "points": 5,
                "status": "partial",
                "details": [
                  {
                    "code": "dependency_bot_config_only",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "primary_language": "PHP",
              "largest_source_bytes": 16621,
              "source_files_sampled": 39,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "PHP without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "PHP"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/39 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 39,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-20T19:15:05.831027Z",
  "schema_version": "0.16.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/b/blockshiftnetwork/chat-markdown-converter.svg",
  "full_name": "blockshiftnetwork/chat-markdown-converter",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.

Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.16.0 — vollständige Methodik · Metriken-Wiki.

Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte StatistikenPackagist.