📦 Modern strongly typed Python library for managing system dependencies with package managers like apt, brew, pip, npm, etc.
ArchiveBox/abxpkg tiene un índice de salud de 66 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Engineering Quality (91/100) y la más baja, Community & Adoption (36/100). Se actualizó por última vez hoy. Una sola persona concentra la mayor parte del trabajo reciente.
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| PyPI | abxpkg | 1.11.246 | - | 268 | hace 0 días | ansibleaptbrewcargodependenciesdevopsdockergemnixpackagemanagerpippydanticpyinfrasystem |
¿Está vivo el proyecto: se escribe código y se publican versiones?
| 36/36 | Recencia de push — último push hace 0 días |
| 11.8/36 | Cadencia de commits — 17/52 semanas con commits |
| 18/18 | Volumen de commits — 707 commits en el último año |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 707 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 17 |
| 27/27 | Publica versiones — 62 versiones publicadas |
| 36/36 | Recencia de las versiones — última versión hace 0 días |
| 27/27 | Cadencia de publicación — una versión cada ~2,7 días |
| 0/10 | OpenSSF Scorecard: Signed-Releases — sin datos |
| releases_count | 62 |
| latest_release_tag | v1.11.246 |
| releases_from_tags | no |
| days_since_latest_release | 0 |
| mean_days_between_releases | 2,7 |
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
| 23.2/60 | Estrellas — 28 estrellas |
| 0/25 | Forks — 1 forks |
| 0/15 | Observadores — 1 observadores |
| forks | 1 |
| stars | 28 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Licencia — licencia reconocida (MIT) |
| 0/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 0/6.3 | Plantilla de PR |
| has_readme | sí |
| has_license | sí |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 3.2/22.5 | Distribución de commits — el principal contribuyente firma el 86% de los commits |
| 5.4/13.5 | Amplitud de contribuyentes — 4 contribuyentes |
| 10/10 | OpenSSF Scorecard: Contributors — project has 10 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 4 |
| top_contributor_share | 0,858 |
| 0/46.8 | Resolución de issues — sin issues o sin datos |
| 28.1/38.3 | Aceptación de PR — 25/34 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 25 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 9 |
| 30/30 | Respaldo de la propiedad — propiedad de una organización |
| 0/20 | Dominio verificado |
| 19.4/25 | Alcance del propietario — 496 seguidores de ArchiveBox |
| 21.3/25 | Trayectoria — 23 repos públicos, cuenta de ~5 años |
| followers | 496 |
| owner_type | Organization |
| is_verified | — |
| owner_login | ArchiveBox |
| public_repos | 23 |
| account_age_days | 2063 |
| 25/25 | Publicado y resoluble — 1 paquete(s) en pypi |
| 35/35 | Recencia de publicación — última publicación hace 0 días |
| 20/20 | Historial de versiones — 268 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
| packages | abxpkg |
| ecosystems | pypi |
| any_deprecated | no |
| min_days_since_publish | 0 |
¿Existen unas prácticas mínimas de ingeniería y documentación?
| 24/24 | Flujos de trabajo de CI — 3 flujo(s) de trabajo |
| 24/24 | Pruebas presentes |
| 16/16 | Configuración de linter |
| 9.6/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — sin datos |
| has_ci | sí |
| has_tests | sí |
| has_editorconfig | no |
| has_linter_config | sí |
| has_precommit_config | sí |
| 30/30 | README |
| 25/25 | Directorio de documentación |
| 15/15 | Sitio de documentación / página del proyecto — http://abxpkg.archivebox.io |
| 10/10 | Descripción del repositorio |
| 10/10 | Topics — 20 topics |
| 0/10 | Wiki |
| topics | apt, brew, dependencies, dependencies-checking, dependency-manager, django, npm, package-managers, packages, pip, pydantic, python, dpkg, js, docker, pnpm, uv, package-manager, gem, nix |
| has_wiki | no |
| homepage | http://abxpkg.archivebox.io |
| has_readme | sí |
| has_docs_dir | sí |
| has_description | sí |
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — sin datos |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 10 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Licencia — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — sin datos |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — sin datos |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 15 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 3 |
| scorecard_aggregate | 5 |
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
| 45/45 | Instrucciones para agentes — AGENTS.md |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 0/40 | Historial de commits legible — sin datos |
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | AGENTS.md |
| agent_instruction_max_bytes | 2411 |
| 0/18 | Arranque con un solo comando |
| 22/22 | Pruebas automatizadas |
| 11/11 | Configuración de lint / formato |
| 0/11 | Verificación estática de tipos |
| 0/10 | Entorno reproducible |
| 0/10 | Práctica demostrada con agentes — sin datos |
| 0/8 | Mantenimiento automatizado — sin datos |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | no |
| has_tests | sí |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | sí |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 0/45 | Código verificable por tipos — Python sin configuración de verificación de tipos |
| 53.1/55 | Tamaños de archivo manejables — 3/85 archivos fuente de más de 60 KB |
| primary_language | Python |
| largest_source_bytes | 144.896 |
| source_files_sampled | 85 |
| oversized_source_files | 3 |
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/d | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 10 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| n/d | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/d | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registro | Paquete | Restricción de versión | Manifiesto |
|---|---|---|---|
| PyPI | pip | >=26.0.1 | pyproject.toml |
| PyPI | typing-extensions | >=4.15.0 | pyproject.toml |
| PyPI | platformdirs | >=4.9.2 | pyproject.toml |
| PyPI | pydantic | >=2.12.5 | pyproject.toml |
| PyPI | rich-click | >=1.9.7 | pyproject.toml |
Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 5 paquetes directos y 19 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.
| Registro | Paquete | Versión | Relación |
|---|---|---|---|
| PyPI | pip | — | directa |
| PyPI | platformdirs | — | directa |
| PyPI | pydantic | — | directa |
| PyPI | rich-click | — | directa |
| PyPI | typing-extensions | — | directa |
| PyPI | abxbus | — | indirecta |
| PyPI | ansible | — | indirecta |
| PyPI | ansible-core | — | indirecta |
| PyPI | ansible-runner | — | indirecta |
| PyPI | django | — | indirecta |
| PyPI | django-admin-data-views | — | indirecta |
| PyPI | django-jsonform | — | indirecta |
| PyPI | django-pydantic-field | — | indirecta |
| PyPI | django-stubs | — | indirecta |
| PyPI | mypy | — | indirecta |
| PyPI | prek | — | indirecta |
| PyPI | pyinfra | — | indirecta |
| PyPI | pytest | — | indirecta |
| PyPI | pytest-asyncio | — | indirecta |
| PyPI | pytest-codeblocks | — | indirecta |
| PyPI | pytest-github-actions-annotate-failures | — | indirecta |
| PyPI | rich | — | indirecta |
| PyPI | ruff | — | indirecta |
| PyPI | ty | — | indirecta |
{
"data": {
"repo": {
"topics": [
"apt",
"brew",
"dependencies",
"dependencies-checking",
"dependency-manager",
"django",
"npm",
"package-managers",
"packages",
"pip",
"pydantic",
"python",
"dpkg",
"js",
"docker",
"pnpm",
"uv",
"package-manager",
"gem",
"nix"
],
"is_fork": false,
"size_kb": 3015,
"has_wiki": false,
"homepage": "http://abxpkg.archivebox.io",
"languages": {
"Shell": 17528,
"Python": 1366438,
"JavaScript": 10921
},
"pushed_at": "2026-07-18T23:09:46Z",
"created_at": "2024-05-18T08:48:10Z",
"owner_type": "Organization",
"updated_at": "2026-07-18T23:09:34Z",
"description": "📦 Modern strongly typed Python library for managing system dependencies with package managers like apt, brew, pip, npm, etc.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://docs.archivebox.io",
"name": "ArchiveBox",
"type": "Organization",
"login": "ArchiveBox",
"company": null,
"location": null,
"followers": 496,
"avatar_url": "https://avatars.githubusercontent.com/u/74894248?v=4",
"created_at": "2020-11-23T06:27:19Z",
"is_verified": null,
"public_repos": 23,
"account_age_days": 2063
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 62,
"commits_last_year": 707,
"latest_release_at": "2026-07-18T23:09:46Z",
"latest_release_tag": "v1.11.246",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 17,
"days_since_latest_release": 0,
"mean_days_between_releases": 2.7
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 50,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "abxpkg",
"exists": true,
"license": "MIT",
"keywords": [
"ansible",
"apt",
"brew",
"cargo",
"dependencies",
"devops",
"docker",
"gem",
"nix",
"packagemanager",
"pip",
"pydantic",
"pyinfra",
"system",
"Environment :: Web Environment",
"Framework :: Django",
"Framework :: Django :: 4.0",
"Framework :: Django :: 5.0",
"Framework :: Django :: 6.0",
"Intended Audience :: Developers",
"Natural Language :: English",
"Programming Language :: Python",
"Programming Language :: Python :: 3",
"Programming Language :: Python :: 3 :: Only",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Programming Language :: Python :: 3.14"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/abxpkg/",
"is_deprecated": false,
"latest_version": "1.11.246",
"repository_url": "https://github.com/ArchiveBox/abxpkg",
"versions_count": 268,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": null,
"first_published_at": "2026-04-13T03:02:52.760681Z",
"latest_published_at": "2026-07-18T23:09:33.824026Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 1,
"stars": 28,
"watchers": 1,
"open_issues_and_prs": 2
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"largest_source_bytes": 144896,
"source_files_sampled": 85,
"oversized_source_files": 3,
"agent_instruction_files": [
"AGENTS.md"
],
"agent_instruction_max_bytes": 2411
},
"dependencies": {
"manifests": [
"pyproject.toml"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "pip",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">=26.0.1"
},
{
"name": "typing-extensions",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">=4.15.0"
},
{
"name": "platformdirs",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">=4.9.2"
},
{
"name": "pydantic",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">=2.12.5"
},
{
"name": "rich-click",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">=1.9.7"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "pip",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "platformdirs",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pydantic",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "rich-click",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": true,
"version": null,
"ecosystem": "pypi"
},
{
"name": "abxbus",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "ansible",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "ansible-core",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "ansible-runner",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "django",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "django-admin-data-views",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "django-jsonform",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "django-pydantic-field",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "django-stubs",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "mypy",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "prek",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pyinfra",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-asyncio",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-codeblocks",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "pytest-github-actions-annotate-failures",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "rich",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "ruff",
"direct": false,
"version": null,
"ecosystem": "pypi"
},
{
"name": "ty",
"direct": false,
"version": null,
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 24,
"direct_count": 5,
"indirect_count": 19
}
},
"maintainership": {
"issues": {
"open_prs": 2,
"merged_prs": 25,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 9
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "pirate",
"commits": 921,
"avatar_url": "https://avatars.githubusercontent.com/u/511499?v=4"
},
{
"type": "User",
"login": "claude",
"commits": 127,
"avatar_url": "https://avatars.githubusercontent.com/u/81847?v=4"
},
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 23,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 3,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
}
],
"contributors_sampled": 4,
"top_contributor_share": 0.858
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"deploy-pages.yml",
"release.yml",
"tests.yml"
],
"has_docs_dir": true,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 10 contributing companies or organizations",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "ce2a12dea3f7920beab14bac2728b5ba9bcad9dd",
"ran_at": "2026-07-18T23:32:12Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/ArchiveBox/abxpkg",
"host": "github.com",
"name": "abxpkg",
"owner": "ArchiveBox"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 66,
"inputs": {
"security": 50,
"vitality": 86,
"community": 36,
"governance": 59,
"engineering": 91
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "excellent",
"name": "Vitality",
"value": 86,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "good",
"name": "Development activity",
"note": null,
"notes": [],
"value": 76,
"inputs": {
"commits_last_year": 707,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 17
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "17/52 weeks with commits",
"points": 11.8,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 17
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "707 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 707
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 100,
"inputs": {
"releases_count": 62,
"latest_release_tag": "v1.11.246",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 2.7
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "62 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 62
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~2.7 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 2.7
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "no_commit_sample",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 36,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 23,
"inputs": {
"forks": 1,
"stars": 28,
"watchers": 1,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "28 stars",
"points": 23.2,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 28
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "1 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 1
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "1 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 1
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 59,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 28,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 4,
"top_contributor_share": 0.858
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 86% of commits",
"points": 3.2,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 86
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "4 contributors",
"points": 5.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 4
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 10 contributing companies or organizations",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "moderate",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 53,
"inputs": {
"merged_prs": 25,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 9
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "25/34 decided PRs merged",
"points": 28.1,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 25,
"decided": 34
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "good",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 71,
"inputs": {
"followers": 496,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "ArchiveBox",
"public_repos": 23,
"account_age_days": 2063
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "496 followers of ArchiveBox",
"points": 19.4,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 496,
"login": "ArchiveBox"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "23 public repos, account ~5 yr old",
"points": 21.3,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 23
}
},
{
"code": "account_age_years",
"params": {
"years": 5
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"abxpkg"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "268 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 268
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "excellent",
"name": "Engineering Quality",
"value": 91,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "excellent",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 92,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": true,
"has_precommit_config": true
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "3 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 3
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 16,
"status": "met",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 9.6,
"status": "met",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "excellent",
"name": "Documentation",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"topics": [
"apt",
"brew",
"dependencies",
"dependencies-checking",
"dependency-manager",
"django",
"npm",
"package-managers",
"packages",
"pip",
"pydantic",
"python",
"dpkg",
"js",
"docker",
"pnpm",
"uv",
"package-manager",
"gem",
"nix"
],
"has_wiki": false,
"homepage": "http://abxpkg.archivebox.io",
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "http://abxpkg.archivebox.io",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "20 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 20
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 50,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"packaging",
"signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 15,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 3,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 10 contributing companies or organizations",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 1
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 55,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "good",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 75,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [
"AGENTS.md"
],
"agent_instruction_max_bytes": 2411
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "AGENTS.md",
"points": 45,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "AGENTS.md"
}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "at_risk",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice",
"automated_maintenance"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 40,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": true,
"typecheck_configs": [],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": null
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 11,
"status": "met",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 53,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 144896,
"source_files_sampled": 85,
"oversized_source_files": 3
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "3/85 source files over 60KB",
"points": 53.1,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 85,
"oversized": 3
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-18T23:32:17.978647Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/a/ArchiveBox/abxpkg.svg",
"full_name": "ArchiveBox/abxpkg",
"license_state": "standard",
"license_spdx": "MIT"
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.14.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — PyPI.