Registro público
Informe de salud del softwareesquema 0.15.0 · métricas 1.13.0 · 2026-07-19 13:24 UTC

KLR-Pattern / nexusx

“A declarative SQLModel-based data assembly framework”

PythonMIT★ 7 estrellas⑂ 4 forksdesde mar 2026Ver en GitHub ↗

KLR-Pattern/nexusx tiene un índice de salud de 55 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (82/100) y la más baja, Security (31/100). Se actualizó por última vez hoy. Una sola persona concentra la mayor parte del trabajo reciente.

55
global / 100
Moderado

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

55
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

KLR PatternOrganización
1 seguidor3 repositorios públicosdesde jun 2026

Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
PyPInexusxapunta a otro repositorio; no se puntúa3.7.0272742hace 0 díasfastapigraphqlsqlalchemysqlmodel

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

82Bueno · 22% del índice global
Cómo se puntúa
36/36Recencia de push — último push hace 0 días
12.5/36Cadencia de commits — 18/52 semanas con commits
18/18Volumen de commits — 416 commits en el último año
10/10OpenSSF Scorecard: Maintained — 30 commit(s) and 30 issue activity found in the last 90 days -- score normalized to 10
Datos de entrada utilizados
commits_last_year416
human_commit_share
days_since_last_push0
active_weeks_last_year18
Cómo se puntúa
27/27Publica versiones — 69 versiones publicadas
36/36Recencia de las versiones — última versión hace 0 días
27/27Cadencia de publicación — una versión cada ~2 días
0/10OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases.
Datos de entrada utilizados
releases_count69
latest_release_tagv3.7.0
releases_from_tagsno
days_since_latest_release0
mean_days_between_releases2

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

32En riesgo · 18% del índice global
Cómo se puntúa
12.6/60Estrellas — 7 estrellas
4/25Forks — 4 forks
0/15Observadores — 0 observadores
Datos de entrada utilizados
forks4
stars7
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Cómo se puntúa
22.5/22.5README
22.5/22.5Licencia — licencia reconocida (MIT)
0/18Guía CONTRIBUTING
0/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributingno
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

42En riesgo · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
0.2/22.5Distribución de commits — el principal contribuyente firma el 99% de los commits
2.7/13.5Amplitud de contribuyentes — 2 contribuyentes
3/10OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3
Datos de entrada utilizados
bus_factor1
contributors_sampled2
top_contributor_share0,99
Cómo se puntúa
43.2/46.8Resolución de issues — 92% de issues cerradas
34.3/38.3Aceptación de PR — 60/67 PR decididos fusionados
0/15OpenSSF Scorecard: Code-Review — Found 0/18 approved changesets -- score normalized to 0
Datos de entrada utilizados
merged_prs60
open_issues3
closed_issues37
issue_closed_ratio0,925
closed_unmerged_prs7
Cómo se puntúa
30/30Respaldo de la propiedad — propiedad de una organización
0/20Dominio verificado
2.2/25Alcance del propietario — 1 seguidores de KLR-Pattern
4.6/25Trayectoria — 3 repos públicos, cuenta de ~0 años
Datos de entrada utilizados
followers1
owner_typeOrganization
is_verified
owner_loginKLR-Pattern
public_repos3
account_age_days46

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

81Bueno · 20% del índice global
Cómo se puntúa
24/24Flujos de trabajo de CI — 4 flujo(s) de trabajo
24/24Pruebas presentes
0/16Configuración de linter
0/9.6Hooks de pre-commit
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 8 out of 8 merged PRs checked by a CI test -- score normalized to 10
Datos de entrada utilizados
has_ci
has_tests
has_editorconfigno
has_linter_configno
has_precommit_configno

Documentación

100Excelente
Cómo se puntúa
30/30README
25/25Directorio de documentación
15/15Sitio de documentación / página del proyecto — https://klr-pattern.github.io/nexusx/
10/10Descripción del repositorio
10/10Topics — 5 topics
10/10Wiki
Datos de entrada utilizados
topicsgraphql, mcp, sqlmodel, ai, autobuild
has_wiki
homepagehttps://klr-pattern.github.io/nexusx/
has_readme
has_docs_dir
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

31En riesgo · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
2.5/2.5CI-Tests — 8 out of 8 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/18 approved changesets -- score normalized to 0
0.8/2.5Contributors — project has 1 contributing companies or organizations -- score normalized to 3
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Licencia — license file detected
7.5/7.5Maintained — 30 commit(s) and 30 issue activity found in the last 90 days -- score normalized to 10
0/5Packaging — sin datos
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — Project has not signed or included provenance with any releases.
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
0/7.5Vulnerabilities — 24 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated17
scorecard_versionv5.5.0
checks_inconclusive1
scorecard_aggregate3,1
Excluidos de la puntuación (sin datos o no aplicable): packaging. Los pesos restantes se han renormalizado.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

57Moderado · 0% del índice global
Cómo se puntúa
45/45Instrucciones para agentes — CLAUDE.md
15/15Documentación legible por máquinas (llms.txt) — llms.txt presente
0/40Historial de commits legible — sin datos
Datos de entrada utilizados
has_llms_txt
legible_history_share
agent_instruction_filesCLAUDE.md
agent_instruction_max_bytes9103
Excluidos de la puntuación (sin datos o no aplicable): Historial de commits legible. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/18Arranque con un solo comando
22/22Pruebas automatizadas
0/11Configuración de lint / formato
0/11Verificación estática de tipos
10/10Entorno reproducible — lockfile
0/10Práctica demostrada con agentes — sin datos
0/8Mantenimiento automatizado — sin datos
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Datos de entrada utilizados
has_nixno
has_tests
lockfilesuv.lock
has_dockerfileno
typed_languageno
bootstrap_files
has_devcontainerno
has_linter_configno
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Excluidos de la puntuación (sin datos o no aplicable): Práctica demostrada con agentes, Mantenimiento automatizado. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/45Código verificable por tipos — Python sin configuración de verificación de tipos
54.5/55Tamaños de archivo manejables — 2/232 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languagePython
largest_source_bytes502.974
source_files_sampled232
oversized_source_files2
Cómo se puntúa
0/40Esquema de API (OpenAPI/GraphQL/proto)
20/20Servidor MCP
0/40Ejemplos ejecutables
Datos de entrada utilizados
example_dirs
has_mcp_signal
api_schema_files

Datos clave

7estrellas de GitHub
2contribuidores
416commits en los últimos 12 meses
0días desde el último push
69versiones publicadas
1factor bus
3issues abiertas
PyPIecosistemas de paquetes

Advertencias de recopilación de datos

  • pypi package 'nexusx' points at a different repository (https://github.com/allmonday/nexusx); excluded from ecosystem scoring
  • GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

Más detalle

OpenSSF Scorecard 3.1 / 10
3.1agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-19 13:23 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
10CI-Tests8 out of 8 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/18 approved changesets -- score normalized to 0
3Contributorsproject has 1 contributing companies or organizations -- score normalized to 3
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
10Maintained30 commit(s) and 30 issue activity found in the last 90 days -- score normalized to 10
n/dPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
0Signed-ReleasesProject has not signed or included provenance with any releases.
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
0Vulnerabilities24 existing vulnerabilities detected
Dependencias directas 6
RegistroPaqueteRestricción de versiónManifiesto
PyPIsqlmodel>=0.0.14pyproject.toml
PyPIpydantic>=2.0pyproject.toml
PyPIgraphql-core>=3.2.0pyproject.toml
PyPIfastapi>=0.135.1pyproject.toml
PyPIaiodataloader>=0.4.3pyproject.toml
PyPIjinja2>=3.0pyproject.toml
Todas las dependencias no recopilado

No fue posible recopilar el conjunto de dependencias resuelto para este informe: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [
        "graphql",
        "mcp",
        "sqlmodel",
        "ai",
        "autobuild"
      ],
      "is_fork": false,
      "size_kb": 4464,
      "has_wiki": true,
      "homepage": "https://klr-pattern.github.io/nexusx/",
      "languages": {
        "CSS": 1937,
        "HTML": 61402,
        "Jinja": 2673,
        "Shell": 61907,
        "Python": 1610692,
        "JavaScript": 127282,
        "PowerShell": 7706
      },
      "pushed_at": "2026-07-19T13:19:16Z",
      "created_at": "2026-03-05T01:08:23Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-19T13:19:20Z",
      "description": "“A declarative SQLModel-based data assembly framework”",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "master",
      "license_spdx_raw": "MIT",
      "primary_language": "Python",
      "significant_languages": [
        "Python"
      ]
    },
    "owner": {
      "blog": null,
      "name": "KLR Pattern",
      "type": "Organization",
      "login": "KLR-Pattern",
      "company": null,
      "location": "China",
      "followers": 1,
      "avatar_url": "https://avatars.githubusercontent.com/u/290169856?v=4",
      "created_at": "2026-06-02T21:27:17Z",
      "is_verified": null,
      "public_repos": 3,
      "account_age_days": 46
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases_count": 69,
      "commits_last_year": 416,
      "latest_release_at": "2026-07-19T13:19:35Z",
      "latest_release_tag": "v3.7.0",
      "releases_from_tags": false,
      "days_since_last_push": 0,
      "active_weeks_last_year": 18,
      "days_since_latest_release": 0,
      "mean_days_between_releases": 2
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "nexusx",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "fastapi",
            "graphql",
            "sqlalchemy",
            "sqlmodel",
            "Development Status :: 3 - Alpha",
            "Intended Audience :: Developers",
            "License :: OSI Approved :: MIT License",
            "Programming Language :: Python :: 3",
            "Programming Language :: Python :: 3.10",
            "Programming Language :: Python :: 3.11",
            "Programming Language :: Python :: 3.12"
          ],
          "ecosystem": "pypi",
          "matches_repo": false,
          "registry_url": "https://pypi.org/project/nexusx/",
          "is_deprecated": false,
          "latest_version": "3.7.0",
          "repository_url": "https://github.com/allmonday/nexusx",
          "versions_count": 42,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": 2727,
          "first_published_at": "2026-05-21T00:07:22.860639Z",
          "latest_published_at": "2026-07-19T13:19:28.503327Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 0
        }
      ]
    },
    "popularity": {
      "forks": 4,
      "stars": 7,
      "watchers": 0,
      "open_issues_and_prs": 7
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": true,
      "has_dockerfile": false,
      "has_mcp_signal": true,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "largest_source_bytes": 502974,
      "source_files_sampled": 232,
      "oversized_source_files": 2,
      "agent_instruction_files": [
        "CLAUDE.md"
      ],
      "agent_instruction_max_bytes": 9103
    },
    "dependencies": {
      "manifests": [
        "pyproject.toml"
      ],
      "ecosystems": [
        "pypi"
      ],
      "dependencies": [
        {
          "name": "sqlmodel",
          "manifest": "pyproject.toml",
          "ecosystem": "pypi",
          "version_constraint": ">=0.0.14"
        },
        {
          "name": "pydantic",
          "manifest": "pyproject.toml",
          "ecosystem": "pypi",
          "version_constraint": ">=2.0"
        },
        {
          "name": "graphql-core",
          "manifest": "pyproject.toml",
          "ecosystem": "pypi",
          "version_constraint": ">=3.2.0"
        },
        {
          "name": "fastapi",
          "manifest": "pyproject.toml",
          "ecosystem": "pypi",
          "version_constraint": ">=0.135.1"
        },
        {
          "name": "aiodataloader",
          "manifest": "pyproject.toml",
          "ecosystem": "pypi",
          "version_constraint": ">=0.4.3"
        },
        {
          "name": "jinja2",
          "manifest": "pyproject.toml",
          "ecosystem": "pypi",
          "version_constraint": ">=3.0"
        }
      ],
      "all_dependencies": {
        "error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
        "source": null,
        "packages": [],
        "collected": false,
        "truncated": false,
        "total_count": null,
        "direct_count": null,
        "indirect_count": null
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 4,
        "merged_prs": 60,
        "open_issues": 3,
        "closed_ratio": 0.925,
        "closed_issues": 37,
        "closed_unmerged_prs": 7
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "allmonday",
          "commits": 417,
          "avatar_url": "https://avatars.githubusercontent.com/u/2917822?v=4"
        },
        {
          "type": "User",
          "login": "NexusRJ",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/7571325?v=4"
        }
      ],
      "contributors_sampled": 2,
      "top_contributor_share": 0.99
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "ci-skip.yml",
        "ci.yml",
        "gh-pages.yml",
        "publish.yml"
      ],
      "has_docs_dir": true,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "uv.lock"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/18 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 3,
            "reason": "project has 1 contributing companies or organizations -- score normalized to 3",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 10,
            "reason": "30 commit(s) and 30 issue activity found in the last 90 days -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": 0,
            "reason": "Project has not signed or included provenance with any releases.",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 0,
            "reason": "24 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "04b27c9924844153a9e6251cd15bb7497d374efb",
        "ran_at": "2026-07-19T13:23:53Z",
        "aggregate_score": 3.1,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/KLR-Pattern/nexusx",
    "host": "github.com",
    "name": "nexusx",
    "owner": "KLR-Pattern"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 55,
      "inputs": {
        "security": 31,
        "vitality": 82,
        "community": 32,
        "governance": 42,
        "engineering": 81
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 82,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "good",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 76,
            "inputs": {
              "commits_last_year": 416,
              "human_commit_share": null,
              "days_since_last_push": 0,
              "active_weeks_last_year": 18
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "18/52 weeks with commits",
                "points": 12.5,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 18
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "416 commits in the last year",
                "points": 18,
                "status": "met",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 416
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "30 commit(s) and 30 issue activity found in the last 90 days -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": null,
            "notes": [],
            "value": 90,
            "inputs": {
              "releases_count": 69,
              "latest_release_tag": "v3.7.0",
              "releases_from_tags": false,
              "days_since_latest_release": 0,
              "mean_days_between_releases": 2
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "69 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 69
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~2 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 2
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "Project has not signed or included provenance with any releases.",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 32,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 17,
            "inputs": {
              "forks": 4,
              "stars": 7,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "7 stars",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 7
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "4 forks",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 42,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 15,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 2,
              "top_contributor_share": 0.99
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 99% of commits",
                "points": 0.2,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 99
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "2 contributors",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 1 contributing companies or organizations -- score normalized to 3",
                "points": 3,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "good",
            "name": "Issue & PR responsiveness",
            "note": null,
            "notes": [],
            "value": 78,
            "inputs": {
              "merged_prs": 60,
              "open_issues": 3,
              "closed_issues": 37,
              "issue_closed_ratio": 0.925,
              "closed_unmerged_prs": 7
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "92% of issues closed",
                "points": 43.2,
                "status": "partial",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 92
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "60/67 decided PRs merged",
                "points": 34.3,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 60,
                      "decided": 67
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/18 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "at_risk",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 37,
            "inputs": {
              "followers": 1,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "KLR-Pattern",
              "public_repos": 3,
              "account_age_days": 46
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "1 followers of KLR-Pattern",
                "points": 2.2,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 1,
                      "login": "KLR-Pattern"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "3 public repos, account ~0 yr old",
                "points": 4.6,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 3
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 0
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "good",
        "name": "Engineering Quality",
        "value": 81,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "moderate",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "4 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "excellent",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "topics": [
                "graphql",
                "mcp",
                "sqlmodel",
                "ai",
                "autobuild"
              ],
              "has_wiki": true,
              "homepage": "https://klr-pattern.github.io/nexusx/",
              "has_readme": true,
              "has_docs_dir": true,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 25,
                "status": "met",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": "https://klr-pattern.github.io/nexusx/",
                "points": 15,
                "status": "met",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "5 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 31,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 31,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 17,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 1,
              "scorecard_aggregate": 3.1
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "8 out of 8 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/18 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 1 contributing companies or organizations -- score normalized to 3",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "30 commit(s) and 30 issue activity found in the last 90 days -- score normalized to 10",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "Project has not signed or included provenance with any releases.",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "24 existing vulnerabilities detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 3
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 57,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "excellent",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "has_llms_txt": true,
              "legible_history_share": null,
              "agent_instruction_files": [
                "CLAUDE.md"
              ],
              "agent_instruction_max_bytes": 9103
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "CLAUDE.md",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "CLAUDE.md"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": "llms.txt present",
                "points": 15,
                "status": "met",
                "details": [
                  {
                    "code": "llms_txt_present",
                    "params": {}
                  }
                ],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 39,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [
                "uv.lock"
              ],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 54,
            "inputs": {
              "primary_language": "Python",
              "largest_source_bytes": 502974,
              "source_files_sampled": 232,
              "oversized_source_files": 2
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "Python without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "Python"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "2/232 source files over 60KB",
                "points": 54.5,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 232,
                      "oversized": 2
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          },
          {
            "key": "ai_interfaces",
            "band": "critical",
            "name": "Machine-readable interfaces",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "example_dirs": [],
              "has_mcp_signal": true,
              "api_schema_files": []
            },
            "components": [
              {
                "key": "api_schema_openapi_graphql_proto",
                "name": "API schema (OpenAPI/GraphQL/proto)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 40
              },
              {
                "key": "mcp_server",
                "name": "MCP server",
                "detail": null,
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              },
              {
                "key": "runnable_examples",
                "name": "Runnable examples",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 40
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "pypi package 'nexusx' points at a different repository (https://github.com/allmonday/nexusx); excluded from ecosystem scoring",
    "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-19T13:24:04.253330Z",
  "schema_version": "0.15.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/k/KLR-Pattern/nexusx.svg",
  "full_name": "KLR-Pattern/nexusx",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.15.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasPyPI.