Python SDK for astrology, Vedic kundli, tarot, numerology, horoscope, I Ching, biorhythm and more. One multi domain API key, sync and async. AI agent and MCP ready.
RoxyAPI/sdk-python holds a health index of 59 out of 100, placing it in the Moderate band. It scores highest on Vitality (80/100) and lowest on Community & Adoption (27/100). It was last updated today. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| PyPI | roxy-sdk | 0.1.45 | - | 45 | 0 days ago | astrologyvedictarotnumerologyhoroscopekundlibirth-chartnatal-chartichingcrystalsangel-numbersdreamsbiorhythmspiritualapisdkasyncfastapiai-agentmcpllm |
Is the project alive — is code being written and are releases shipping?
| 36/36 | Push recency — last push 0 days ago |
| 10.4/36 | Commit cadence — 15/52 weeks with commits |
| 17.4/18 | Commit volume — 85 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 85 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 15 |
| 27/27 | Ships releases — 35 releases published |
| 36/36 | Release recency — latest release 0 days ago |
| 27/27 | Release cadence — a release every ~2.3 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 35 |
| latest_release_tag | v0.1.45 |
| releases_from_tags | no |
| days_since_latest_release | 0 |
| mean_days_between_releases | 2.3 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 0/60 | Stars — 0 stars |
| 0/25 | Forks — 1 forks |
| 0/15 | Watchers — 0 watchers |
| forks | 1 |
| stars | 0 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 6.3/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | yes |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 10.7/22.5 | Commit distribution — top contributor authored 52% of commits |
| 4.1/13.5 | Contributor breadth — 3 contributors |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0.523 |
| 0/46.8 | Issue resolution — no issues or no data |
| 23.9/38.3 | PR acceptance — 5/8 decided PRs merged |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/26 approved changesets -- score normalized to 0 |
| merged_prs | 5 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 3 |
| 30/30 | Ownership backing — organization-owned |
| 0/20 | Verified domain |
| 6.5/25 | Owner reach — 7 followers of RoxyAPI |
| 14.9/25 | Track record — 36 public repos, account ~1 yr old |
| followers | 7 |
| owner_type | Organization |
| is_verified | — |
| owner_login | RoxyAPI |
| public_repos | 36 |
| account_age_days | 634 |
| 25/25 | Published & resolvable — 1 package(s) on pypi |
| 35/35 | Publish recency — latest publish 0 days ago |
| 20/20 | Version history — 45 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | roxy-sdk |
| ecosystems | pypi |
| any_deprecated | no |
| min_days_since_publish | 0 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 2 workflow(s) |
| 24/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://pypi.org/project/roxy-sdk/ |
| 10/10 | Repository description |
| 10/10 | Topics — 20 topics |
| 10/10 | Wiki |
| topics | angel-numbers, crystals, dream-interpretation, horoscope, iching, numerology, pypi, python-sdk, roxyapi, vedic-astrology, ai-agents, astrology-api, biorhythm-api, fastapi, kundli-api, mcp-server, model-context-protocol, openapi, spiritual-api, tarot-api |
| has_wiki | yes |
| homepage | https://pypi.org/project/roxy-sdk/ |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — no data |
| 2.5/2.5 | CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/26 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 6.8/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 17 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 1 |
| scorecard_aggregate | 6.3 |
How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.
| 45/45 | Agent instructions — AGENTS.md |
| 0/15 | Machine-readable docs (llms.txt) |
| 0/40 | Legible commit history — no data |
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | AGENTS.md |
| agent_instruction_max_bytes | 19,976 |
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 0/11 | Lint / format config |
| 11/11 | Static type checking — src/roxy_sdk/py.typed |
| 10/10 | Reproducible environment — lockfile |
| 0/10 | Demonstrated agent practice — no data |
| 5/8 | Automated maintenance — dependency automation configured, none observed in the sampled commits |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | no |
| has_tests | yes |
| lockfiles | uv.lock |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | src/roxy_sdk/py.typed |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 27/45 | Type-checkable code — Python with type-check config (src/roxy_sdk/py.typed) |
| 48.9/55 | Manageable file sizes — 1/9 source files over 60KB |
| primary_language | Python |
| largest_source_bytes | 192,383 |
| source_files_sampled | 9 |
| oversized_source_files | 1 |
| 40/40 | API schema (OpenAPI/GraphQL/proto) — specs/openapi.json |
| 0/20 | MCP server |
| 40/40 | Runnable examples — examples |
| example_dirs | examples |
| has_mcp_signal | no |
| api_schema_files | specs/openapi.json |
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/a | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 10 | CI-Tests | 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/26 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 9 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| PyPI | httpx | >=0.27.0 | pyproject.toml |
Full resolved dependency set from the GitHub dependency graph: 1 direct and 24 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| PyPI | httpx | 0.28.1 | direct |
| PyPI | anyio | 4.13.0 | indirect |
| PyPI | ast-serialize | 0.6.0 | indirect |
| PyPI | backports-asyncio-runner | 1.2.0 | indirect |
| PyPI | certifi | 2026.4.22 | indirect |
| PyPI | colorama | 0.4.6 | indirect |
| PyPI | exceptiongroup | 1.3.1 | indirect |
| PyPI | h11 | 0.16.0 | indirect |
| PyPI | httpcore | 1.0.9 | indirect |
| PyPI | idna | 3.15 | indirect |
| PyPI | iniconfig | 2.3.0 | indirect |
| PyPI | lefthook | 2.1.10 | indirect |
| PyPI | librt | 0.13.0 | indirect |
| PyPI | mypy | 2.3.0 | indirect |
| PyPI | mypy-extensions | 1.1.0 | indirect |
| PyPI | packaging | 26.1 | indirect |
| PyPI | pathspec | 1.0.4 | indirect |
| PyPI | pluggy | 1.6.0 | indirect |
| PyPI | pygments | 2.20.0 | indirect |
| PyPI | pytest | 9.1.1 | indirect |
| PyPI | pytest-asyncio | 1.4.0 | indirect |
| PyPI | roxy-sdk | 0.1.45 | indirect |
| PyPI | ruff | 0.15.21 | indirect |
| PyPI | tomli | 2.4.1 | indirect |
| PyPI | typing-extensions | 4.15.0 | indirect |
{
"data": {
"repo": {
"topics": [
"angel-numbers",
"crystals",
"dream-interpretation",
"horoscope",
"iching",
"numerology",
"pypi",
"python-sdk",
"roxyapi",
"vedic-astrology",
"ai-agents",
"astrology-api",
"biorhythm-api",
"fastapi",
"kundli-api",
"mcp-server",
"model-context-protocol",
"openapi",
"spiritual-api",
"tarot-api"
],
"is_fork": false,
"size_kb": 4205,
"has_wiki": true,
"homepage": "https://pypi.org/project/roxy-sdk/",
"languages": {
"Python": 223891
},
"pushed_at": "2026-07-19T07:55:10Z",
"created_at": "2026-04-01T12:46:56Z",
"owner_type": "Organization",
"updated_at": "2026-07-19T07:55:12Z",
"description": "Python SDK for astrology, Vedic kundli, tarot, numerology, horoscope, I Ching, biorhythm and more. One multi domain API key, sync and async. AI agent and MCP ready.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://roxyapi.com",
"name": "RoxyAPI",
"type": "Organization",
"login": "RoxyAPI",
"company": null,
"location": null,
"followers": 7,
"avatar_url": "https://avatars.githubusercontent.com/u/185915295?v=4",
"created_at": "2024-10-22T11:04:00Z",
"is_verified": null,
"public_repos": 36,
"account_age_days": 634
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 35,
"commits_last_year": 85,
"latest_release_at": "2026-07-19T07:55:11Z",
"latest_release_tag": "v0.1.45",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 15,
"days_since_latest_release": 0,
"mean_days_between_releases": 2.3
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 75,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "roxy-sdk",
"exists": true,
"license": "MIT",
"keywords": [
"astrology",
"vedic",
"tarot",
"numerology",
"horoscope",
"kundli",
"birth-chart",
"natal-chart",
"iching",
"crystals",
"angel-numbers",
"dreams",
"biorhythm",
"spiritual",
"api",
"sdk",
"async",
"fastapi",
"ai-agent",
"mcp",
"llm",
"Development Status :: 4 - Beta",
"Intended Audience :: Developers",
"Programming Language :: Python :: 3",
"Programming Language :: Python :: 3.10",
"Programming Language :: Python :: 3.11",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Typing :: Typed"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/roxy-sdk/",
"is_deprecated": false,
"latest_version": "0.1.45",
"repository_url": "https://github.com/RoxyAPI/sdk-python",
"versions_count": 45,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": null,
"first_published_at": "2026-04-22T12:03:15.927063Z",
"latest_published_at": "2026-07-19T07:55:00.143610Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 1,
"stars": 0,
"watchers": 0,
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples"
],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [
"specs/openapi.json"
],
"has_devcontainer": false,
"typecheck_configs": [
"src/roxy_sdk/py.typed"
],
"largest_source_bytes": 192383,
"source_files_sampled": 9,
"oversized_source_files": 1,
"agent_instruction_files": [
"AGENTS.md"
],
"agent_instruction_max_bytes": 19976
},
"dependencies": {
"manifests": [
"pyproject.toml"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "httpx",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">=0.27.0"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "httpx",
"direct": true,
"version": "0.28.1",
"ecosystem": "pypi"
},
{
"name": "anyio",
"direct": false,
"version": "4.13.0",
"ecosystem": "pypi"
},
{
"name": "ast-serialize",
"direct": false,
"version": "0.6.0",
"ecosystem": "pypi"
},
{
"name": "backports-asyncio-runner",
"direct": false,
"version": "1.2.0",
"ecosystem": "pypi"
},
{
"name": "certifi",
"direct": false,
"version": "2026.4.22",
"ecosystem": "pypi"
},
{
"name": "colorama",
"direct": false,
"version": "0.4.6",
"ecosystem": "pypi"
},
{
"name": "exceptiongroup",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "h11",
"direct": false,
"version": "0.16.0",
"ecosystem": "pypi"
},
{
"name": "httpcore",
"direct": false,
"version": "1.0.9",
"ecosystem": "pypi"
},
{
"name": "idna",
"direct": false,
"version": "3.15",
"ecosystem": "pypi"
},
{
"name": "iniconfig",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "lefthook",
"direct": false,
"version": "2.1.10",
"ecosystem": "pypi"
},
{
"name": "librt",
"direct": false,
"version": "0.13.0",
"ecosystem": "pypi"
},
{
"name": "mypy",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "mypy-extensions",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "packaging",
"direct": false,
"version": "26.1",
"ecosystem": "pypi"
},
{
"name": "pathspec",
"direct": false,
"version": "1.0.4",
"ecosystem": "pypi"
},
{
"name": "pluggy",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "pygments",
"direct": false,
"version": "2.20.0",
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": "9.1.1",
"ecosystem": "pypi"
},
{
"name": "pytest-asyncio",
"direct": false,
"version": "1.4.0",
"ecosystem": "pypi"
},
{
"name": "roxy-sdk",
"direct": false,
"version": "0.1.45",
"ecosystem": "pypi"
},
{
"name": "ruff",
"direct": false,
"version": "0.15.21",
"ecosystem": "pypi"
},
{
"name": "tomli",
"direct": false,
"version": "2.4.1",
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": false,
"version": "4.15.0",
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 25,
"direct_count": 1,
"indirect_count": 24
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 5,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 3
},
"bus_factor": 1,
"top_contributors": [
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 45,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
},
{
"type": "User",
"login": "ph33nx",
"commits": 36,
"avatar_url": "https://avatars.githubusercontent.com/u/19635345?v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
}
],
"contributors_sampled": 3,
"top_contributor_share": 0.523
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"ci.yml",
"release.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"uv.lock"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 10,
"reason": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/26 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 9,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "2a06ea886ff2470862aefda99d2761c55ff37ac1",
"ran_at": "2026-07-19T07:59:58Z",
"aggregate_score": 6.3,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/RoxyAPI/sdk-python",
"host": "github.com",
"name": "sdk-python",
"owner": "RoxyAPI"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 59,
"inputs": {
"security": 63,
"vitality": 80,
"community": 27,
"governance": 51,
"engineering": 71
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 80,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "good",
"name": "Development activity",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"commits_last_year": 85,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 15
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "15/52 weeks with commits",
"points": 10.4,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 15
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "85 commits in the last year",
"points": 17.4,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 85
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 35,
"latest_release_tag": "v0.1.45",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 2.3
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "35 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 35
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~2.3 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 2.3
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "repository_too_young",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "critical",
"name": "Community & Adoption",
"value": 27,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 1,
"stars": 0,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "0 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 0
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "1 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 1
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 57,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 51,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 24,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 3,
"top_contributor_share": 0.523
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 52% of commits",
"points": 10.7,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 52
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "3 contributors",
"points": 4.1,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 3
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "at_risk",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"merged_prs": 5,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 3
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "5/8 decided PRs merged",
"points": 23.9,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 5,
"decided": 8
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/26 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 51,
"inputs": {
"followers": 7,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "RoxyAPI",
"public_repos": 36,
"account_age_days": 634
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "7 followers of RoxyAPI",
"points": 6.5,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 7,
"login": "RoxyAPI"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "36 public repos, account ~1 yr old",
"points": 14.9,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 36
}
},
{
"code": "account_age_years",
"params": {
"years": 1
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"roxy-sdk"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "45 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 45
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "good",
"name": "Engineering Quality",
"value": 71,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 68,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "2 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 2
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
"points": 20,
"status": "met",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [
"angel-numbers",
"crystals",
"dream-interpretation",
"horoscope",
"iching",
"numerology",
"pypi",
"python-sdk",
"roxyapi",
"vedic-astrology",
"ai-agents",
"astrology-api",
"biorhythm-api",
"fastapi",
"kundli-api",
"mcp-server",
"model-context-protocol",
"openapi",
"spiritual-api",
"tarot-api"
],
"has_wiki": true,
"homepage": "https://pypi.org/project/roxy-sdk/",
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://pypi.org/project/roxy-sdk/",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "20 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 20
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 63,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 63,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 17,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 1,
"scorecard_aggregate": 6.3
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/26 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 6.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 67,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "good",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 75,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [
"AGENTS.md"
],
"agent_instruction_max_bytes": 19976
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "AGENTS.md",
"points": 45,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "AGENTS.md"
}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "moderate",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 53,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"uv.lock"
],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"src/roxy_sdk/py.typed"
],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "src/roxy_sdk/py.typed",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "src/roxy_sdk/py.typed"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "good",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 76,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 192383,
"source_files_sampled": 9,
"oversized_source_files": 1
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python with type-check config (src/roxy_sdk/py.typed)",
"points": 27,
"status": "partial",
"details": [
{
"code": "typecheck_config_language",
"params": {
"files": "src/roxy_sdk/py.typed",
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "1/9 source files over 60KB",
"points": 48.9,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 9,
"oversized": 1
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "good",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 80,
"inputs": {
"example_dirs": [
"examples"
],
"has_mcp_signal": false,
"api_schema_files": [
"specs/openapi.json"
]
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": "specs/openapi.json",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "specs/openapi.json"
}
}
],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-19T08:00:06.569438Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/RoxyAPI/sdk-python.svg",
"full_name": "RoxyAPI/sdk-python",
"license_state": "standard",
"license_spdx": "MIT"
}Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.14.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — PyPI.