Python SDK for astrology, Vedic kundli, tarot, numerology, horoscope, I Ching, biorhythm and more. One multi domain API key, sync and async. AI agent and MCP ready.
RoxyAPI/sdk-python erreicht einen Gesundheitsindex von 65 von 100 und liegt damit im Bereich Gut. Am stärksten schneidet es bei Vitality (80/100) ab, am schwächsten bei Community & Adoption (27/100). Zuletzt heute aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
Metriken werden auf einer standardisierten Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr gewichtetes Mittel, kalibriert auf die Verteilung des öffentlichen Registers, sodass die Stufen Perzentilbedeutung tragen; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze Gefährdet von 34.
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Der gewichtete Gesamtwert 60 wird auf der veröffentlichten Indexskala auf 65 kalibriert (Register-Kalibrierung 2026-08-02).
Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| PyPI | roxy-sdk | 0.1.45 | - | 45 | vor 0 Tagen | astrologyvedictarotnumerologyhoroscopekundlibirth-chartnatal-chartichingcrystalsangel-numbersdreamsbiorhythmspiritualapisdkasyncfastapiai-agentmcpllm |
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
| 36/36 | Push-Aktualität — letzter Push vor 0 Tagen |
| 10.4/36 | Commit-Rhythmus — 15/52 Wochen mit Commits |
| 17.4/18 | Commit-Volumen — 85 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 85 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 15 |
| 27/27 | Liefert Releases aus — 35 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 0 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 2,3 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 35 |
| latest_release_tag | v0.1.45 |
| releases_from_tags | nein |
| days_since_latest_release | 0 |
| mean_days_between_releases | 2,3 |
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
| 0/60 | Stars — 0 Stars |
| 0/25 | Forks — 1 Forks |
| 0/15 | Watcher — 0 Watcher |
| forks | 1 |
| stars | 0 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 0/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 6.3/6.3 | PR-Vorlage |
| has_readme | ja |
| has_license | ja |
| readme_badges | — |
| has_contributing | nein |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| readme_badge_services | — |
| has_pull_request_template | ja |
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 10.7/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 52 % der Commits |
| 4.1/13.5 | Breite der Beitragenden — 3 Beitragende |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0,523 |
| 0/42 | Issue-Lösungsquote — keine Issues oder keine Daten |
| 18.8/30 | PR-Annahme — 5/8 entschiedene PRs gemergt |
| 0/13 | Newcomer PR acceptance — kein PR eines Erstbeitragenden in 30 Tagen entschieden |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/26 approved changesets -- score normalized to 0 |
| merged_prs | 5 |
| open_issues | 0 |
| closed_issues | 0 |
| prs_merged_7d | — |
| prs_decided_7d | — |
| prs_merged_30d | — |
| prs_decided_30d | — |
| issue_closed_ratio | — |
| closed_unmerged_prs | 3 |
| first_time_authors_30d | — |
| first_time_prs_merged_30d | — |
| first_time_prs_decided_30d | — |
| 30/30 | Organisatorische Trägerschaft — im Besitz einer Organisation |
| 0/20 | Verifizierte Domain — Verifizierungsstatus der Domain für diese Organisation nicht ausgelesen |
| 6.5/25 | Reichweite des Inhabers — 7 Follower von RoxyAPI |
| 14.9/25 | Kontohistorie — 36 öffentliche Repos, Kontoalter ca. 1 Jahre |
| followers | 7 |
| owner_type | Organization |
| is_verified | — |
| owner_login | RoxyAPI |
| public_repos | 36 |
| account_age_days | 634 |
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf pypi |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 0 Tagen |
| 20/20 | Versionshistorie — 45 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
| packages | roxy-sdk |
| ecosystems | pypi |
| any_deprecated | nein |
| min_days_since_publish | 0 |
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
| 24/24 | CI-Workflows — 2 Workflow(s) |
| 24/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | nein |
| has_precommit_config | nein |
| 30/30 | README |
| 0/25 | Dokumentationsverzeichnis |
| 15/15 | Dokumentations-/Homepage-Site — https://pypi.org/project/roxy-sdk/ |
| 10/10 | Repository-Beschreibung |
| 10/10 | Topics — 20 Topics |
| 10/10 | Wiki |
| topics | angel-numbers, crystals, dream-interpretation, horoscope, iching, numerology, pypi, python-sdk, roxyapi, vedic-astrology, ai-agents, astrology-api, biorhythm-api, fastapi, kundli-api, mcp-server, model-context-protocol, openapi, spiritual-api, tarot-api |
| has_wiki | ja |
| homepage | https://pypi.org/project/roxy-sdk/ |
| docs_site | https://pypi.org/project/roxy-sdk/ |
| has_readme | ja |
| has_docs_dir | nein |
| has_description | ja |
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — keine Daten |
| 2.5/2.5 | CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/26 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 6.8/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 17 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 1 |
| scorecard_aggregate | 6,3 |
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Trägt ein bewusst kleines Gewicht (4 %): Agenten-Tooling ist ein echtes Pflegesignal, doch ein Repository ohne jedes Signal kann weiterhin 100/100 erreichen.
| 45/45 | Agentenanweisungen — AGENTS.md |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 0/40 | Lesbare Commit-Historie — keine Daten |
| has_llms_txt | nein |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | AGENTS.md |
| agent_instruction_max_bytes | 19.976 |
| 0/18 | Bootstrap mit einem Befehl |
| 22/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 11/11 | Statische Typprüfung — src/roxy_sdk/py.typed |
| 10/10 | Reproduzierbare Umgebung — lockfile |
| 0/10 | Belegte Agentenpraxis — keine Daten |
| 5/8 | Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | nein |
| has_tests | ja |
| lockfiles | uv.lock |
| has_dockerfile | nein |
| typed_language | nein |
| bootstrap_files | — |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | src/roxy_sdk/py.typed |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 27/45 | Typprüfbarer Code — Python mit Typprüfungs-Konfiguration (src/roxy_sdk/py.typed) |
| 48.9/55 | Handhabbare Dateigrößen — 1/9 Quelldateien über 60 KB |
| primary_language | Python |
| largest_source_bytes | 192.383 |
| source_files_sampled | 9 |
| oversized_source_files | 1 |
| 40/40 | API-Schema (OpenAPI/GraphQL/proto) — specs/openapi.json |
| 0/20 | MCP-Server — für diese Art von Software nicht anwendbar |
| 40/40 | Lauffähige Beispiele — examples |
| example_dirs | examples |
| has_mcp_signal | nein |
| api_schema_files | specs/openapi.json |
| interfaces_expected_of | — |
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 10 | Binary-Artifacts | no binaries found in the repo |
| k. A. | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 10 | CI-Tests | 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/26 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 9 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| PyPI | httpx | >=0.27.0 | pyproject.toml |
Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 1 direkte und 24 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.
| Registry | Paket | Version | Beziehung |
|---|---|---|---|
| PyPI | httpx | 0.28.1 | direkt |
| PyPI | anyio | 4.13.0 | indirekt |
| PyPI | ast-serialize | 0.6.0 | indirekt |
| PyPI | backports-asyncio-runner | 1.2.0 | indirekt |
| PyPI | certifi | 2026.4.22 | indirekt |
| PyPI | colorama | 0.4.6 | indirekt |
| PyPI | exceptiongroup | 1.3.1 | indirekt |
| PyPI | h11 | 0.16.0 | indirekt |
| PyPI | httpcore | 1.0.9 | indirekt |
| PyPI | idna | 3.15 | indirekt |
| PyPI | iniconfig | 2.3.0 | indirekt |
| PyPI | lefthook | 2.1.10 | indirekt |
| PyPI | librt | 0.13.0 | indirekt |
| PyPI | mypy | 2.3.0 | indirekt |
| PyPI | mypy-extensions | 1.1.0 | indirekt |
| PyPI | packaging | 26.1 | indirekt |
| PyPI | pathspec | 1.0.4 | indirekt |
| PyPI | pluggy | 1.6.0 | indirekt |
| PyPI | pygments | 2.20.0 | indirekt |
| PyPI | pytest | 9.1.1 | indirekt |
| PyPI | pytest-asyncio | 1.4.0 | indirekt |
| PyPI | roxy-sdk | 0.1.45 | indirekt |
| PyPI | ruff | 0.15.21 | indirekt |
| PyPI | tomli | 2.4.1 | indirekt |
| PyPI | typing-extensions | 4.15.0 | indirekt |
Stimmt etwas in diesem Bericht nicht, oder gibt es Gedanken dazu? Falsche Messungen, übersehene Tools, Ideen, Fragen — alles ist willkommen. Jede Nachricht wird gelesen und beantwortet.
Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v2.10.0, Schema v0.14.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — PyPI.