Публічний реєстр
Звіт про здоров'я програмного забезпеченнясхема 0.14.0 · метрики 1.13.0 · 2026-07-19 08:00 UTC

RoxyAPI / sdk-python

Python SDK for astrology, Vedic kundli, tarot, numerology, horoscope, I Ching, biorhythm and more. One multi domain API key, sync and async. AI agent and MCP ready.

PythonMIT★ 0 зірок⑂ 1 форкз квіт. 2026 р.Переглянути на GitHub ↗

RoxyAPI/sdk-python має індекс здоров’я 59 зі 100, що відповідає смузі «Помірний». Найвищий показник — Vitality (80/100), найнижчий — Community & Adoption (27/100). Останнє оновлення — сьогодні. Більшість нещодавньої роботи виконує один учасник.

59
загалом / 100
Помірний

Індекс здоров'я програмного забезпечення

Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.

59
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
ЖиттєздатністьСпільнота тавпровадженняСталість таврядуванняІнженернаякістьБезпекаГотовність доШІ

Профіль оцінок

Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.

Власність

RoxyAPIОрганізація
7 підписників36 публічних репозиторіївз жовт. 2024 р.

За цим репозиторієм стоїть організація — спільна, підзвітна опіка, здатна пережити будь-якого окремого мейнтейнера.

Пакетні екосистеми

РеєстрПакетВерсіяЗавантажень / місВерсіїОстання публікаціяТеги
PyPIroxy-sdk0.1.45-450 днів томуastrologyvedictarotnumerologyhoroscopekundlibirth-chartnatal-chartichingcrystalsangel-numbersdreamsbiorhythmspiritualapisdkasyncfastapiai-agentmcpllm

Метрики за категоріями

Життєздатність

Чи живий проєкт — чи пишеться код і чи виходять релізи?

80Добрий · 22% загального індексу
Як обчислюється оцінка
36/36Свіжість push — останній push 0 дн. тому
10.4/36Ритм комітів — 15/52 тижнів із комітами
17.4/18Обсяг комітів — 85 комітів за останній рік
10/10OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
Використані вхідні дані
commits_last_year85
human_commit_share
days_since_last_push0
active_weeks_last_year15
Як обчислюється оцінка
27/27Випускає релізи — опубліковано 35 релізів
36/36Свіжість релізів — останній реліз 0 дн. тому
27/27Ритм релізів — реліз кожні ~2,3 дн.
0/10OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases.
Використані вхідні дані
releases_count35
latest_release_tagv0.1.45
releases_from_tagsні
days_since_latest_release0
mean_days_between_releases2,3

Спільнота та впровадження

Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?

27Критичний · 18% загального індексу
Як обчислюється оцінка
0/60Зірки — 0 зірок
0/25Форки — 1 форків
0/15Спостерігачі — 0 спостерігачів
Використані вхідні дані
forks1
stars0
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Як обчислюється оцінка
22.5/22.5README
22.5/22.5Ліцензія — визнана ліцензія (MIT)
0/18Настанови CONTRIBUTING
0/13.5Кодекс поведінки
0/7.2Шаблон issue
6.3/6.3Шаблон PR
Використані вхідні дані
has_readmeтак
has_licenseтак
has_contributingні
has_issue_templateні
has_code_of_conductні
has_pull_request_templateтак

Сталість та врядування

Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?

51Помірний · 24% загального індексу
Як обчислюється оцінка
9/54Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів
10.7/22.5Розподіл комітів — головний контриб’ютор — автор 52% комітів
4.1/13.5Широта контриб’юторів — 3 контриб’юторів
0/10OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0
Використані вхідні дані
bus_factor1
contributors_sampled3
top_contributor_share0,523
Як обчислюється оцінка
0/46.8Вирішення issue — немає issue або даних
23.9/38.3Прийняття PR — злито 5/8 вирішених PR
0/15OpenSSF Scorecard: Code-Review — Found 0/26 approved changesets -- score normalized to 0
Використані вхідні дані
merged_prs5
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs3
Виключено з оцінювання (немає даних або не застосовно): Вирішення issue. Залишкові ваги перенормовано.
Як обчислюється оцінка
30/30Підтримка власника — у власності організації
0/20Верифікований домен
6.5/25Охоплення власника — 7 підписників у RoxyAPI
14.9/25Послужний список — 36 публічних репозиторіїв, вік облікового запису ~1 р.
Використані вхідні дані
followers7
owner_typeOrganization
is_verified
owner_loginRoxyAPI
public_repos36
account_age_days634

Супровід пакетів

100Відмінний
Як обчислюється оцінка
25/25Опубліковано й доступно — 1 пакет(ів) у pypi
35/35Свіжість публікацій — остання публікація 0 дн. тому
20/20Історія версій — 45 опублікованих версій
20/20Не застарілий — активний, не deprecated і не yanked
Використані вхідні дані
packagesroxy-sdk
ecosystemspypi
any_deprecatedні
min_days_since_publish0

Інженерна якість

Чи наявні базові інженерні практики та документація?

71Добрий · 20% загального індексу
Як обчислюється оцінка
24/24Процеси CI — 2 процес(ів) CI
24/24Наявні тести
0/16Конфігурація лінтера
0/9.6Pre-commit-хуки
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10
Використані вхідні дані
has_ciтак
has_testsтак
has_editorconfigні
has_linter_configні
has_precommit_configні
Як обчислюється оцінка
30/30README
0/25Каталог документації
15/15Сайт документації / домашня сторінка — https://pypi.org/project/roxy-sdk/
10/10Опис репозиторію
10/10Теми — 20 тем
10/10Wiki
Використані вхідні дані
topicsangel-numbers, crystals, dream-interpretation, horoscope, iching, numerology, pypi, python-sdk, roxyapi, vedic-astrology, ai-agents, astrology-api, biorhythm-api, fastapi, kundli-api, mcp-server, model-context-protocol, openapi, spiritual-api, tarot-api
has_wikiтак
homepagehttps://pypi.org/project/roxy-sdk/
has_readmeтак
has_docs_dirні
has_descriptionтак

Безпека

Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?

63Помірний · 16% загального індексу

Стан безпеки

63Помірний
Як обчислюється оцінка
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — немає даних
2.5/2.5CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/26 approved changesets -- score normalized to 0
0/2.5Contributors — project has 0 contributing companies or organizations -- score normalized to 0
10/10Dangerous-Workflow — no dangerous workflow patterns detected
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Ліцензія — license file detected
7.5/7.5Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
5/5Packaging — packaging workflow detected
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
5/5Security-Policy — security policy file detected
0/7.5Signed-Releases — Project has not signed or included provenance with any releases.
6.8/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Використані вхідні дані
sourceopenssf_scorecard
checks_evaluated17
scorecard_versionv5.5.0
checks_inconclusive1
scorecard_aggregate6,3
Виключено з оцінювання (немає даних або не застосовно): branch_protection. Залишкові ваги перенормовано.

Готовність до ШІ

Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.

67Помірний · 0% загального індексу
Як обчислюється оцінка
45/45Інструкції для агентів — AGENTS.md
0/15Машиночитана документація (llms.txt)
0/40Читабельна історія комітів — немає даних
Використані вхідні дані
has_llms_txtні
legible_history_share
agent_instruction_filesAGENTS.md
agent_instruction_max_bytes19 976
Виключено з оцінювання (немає даних або не застосовно): Читабельна історія комітів. Залишкові ваги перенормовано.
Як обчислюється оцінка
0/18Розгортання однією командою
22/22Автоматизовані тести
0/11Конфігурація лінтера / форматера
11/11Статична перевірка типів — src/roxy_sdk/py.typed
10/10Відтворюване середовище — lockfile
0/10Підтверджена практика роботи з агентами — немає даних
5/8Автоматизоване супроводження — автоматизацію залежностей налаштовано, але у вибірці комітів її не видно
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Використані вхідні дані
has_nixні
has_testsтак
lockfilesuv.lock
has_dockerfileні
typed_languageні
bootstrap_files
has_devcontainerні
has_linter_configні
typecheck_configssrc/roxy_sdk/py.typed
agent_commit_share
toolchain_manifests
dependency_bot_commit_share0
Виключено з оцінювання (немає даних або не застосовно): Підтверджена практика роботи з агентами. Залишкові ваги перенормовано.
Як обчислюється оцінка
27/45Типізований код — Python з конфігурацією перевірки типів (src/roxy_sdk/py.typed)
48.9/55Керовані розміри файлів — 1/9 файлів вихідного коду понад 60 КБ
Використані вхідні дані
primary_languagePython
largest_source_bytes192 383
source_files_sampled9
oversized_source_files1
Як обчислюється оцінка
40/40Схема API (OpenAPI/GraphQL/proto) — specs/openapi.json
0/20Сервер MCP
40/40Придатні до запуску приклади — examples
Використані вхідні дані
example_dirsexamples
has_mcp_signalні
api_schema_filesspecs/openapi.json

Ключові факти

0зірок GitHub
3контриб'юторів
85комітів за останні 12 місяців
0днів від останнього пушу
35релізів
1бас-фактор
0відкритих issue
PyPIпакетних екосистем

Докладніше

OpenSSF Scorecard 6.3 / 10
6.3сукупно

Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).Scorecard v5.5.0 · 2026-07-19 07:59 UTC

10Binary-Artifactsno binaries found in the repo
н/дBranch-Protectioninternal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md
10CI-Tests4 out of 4 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/26 approved changesets -- score normalized to 0
0Contributorsproject has 0 contributing companies or organizations -- score normalized to 0
10Dangerous-Workflowno dangerous workflow patterns detected
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
10Maintained30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10
10Packagingpackaging workflow detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTSAST tool is not run on all commits -- score normalized to 0
10Security-Policysecurity policy file detected
0Signed-ReleasesProject has not signed or included provenance with any releases.
9Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Прямі залежності 1
РеєстрПакетОбмеження версіїМаніфест
PyPIhttpx>=0.27.0pyproject.toml
Усі залежності 25

Повний розв'язаний набір залежностей із графа залежностей GitHub: 1 прямих і 24 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.

РеєстрПакетВерсіяЗв'язок
PyPIhttpx0.28.1пряма
PyPIanyio4.13.0непряма
PyPIast-serialize0.6.0непряма
PyPIbackports-asyncio-runner1.2.0непряма
PyPIcertifi2026.4.22непряма
PyPIcolorama0.4.6непряма
PyPIexceptiongroup1.3.1непряма
PyPIh110.16.0непряма
PyPIhttpcore1.0.9непряма
PyPIidna3.15непряма
PyPIiniconfig2.3.0непряма
PyPIlefthook2.1.10непряма
PyPIlibrt0.13.0непряма
PyPImypy2.3.0непряма
PyPImypy-extensions1.1.0непряма
PyPIpackaging26.1непряма
PyPIpathspec1.0.4непряма
PyPIpluggy1.6.0непряма
PyPIpygments2.20.0непряма
PyPIpytest9.1.1непряма
PyPIpytest-asyncio1.4.0непряма
PyPIroxy-sdk0.1.45непряма
PyPIruff0.15.21непряма
PyPItomli2.4.1непряма
PyPItyping-extensions4.15.0непряма
Звіт у форматі JSON машиночитний
{
  "data": {
    "repo": {
      "topics": [
        "angel-numbers",
        "crystals",
        "dream-interpretation",
        "horoscope",
        "iching",
        "numerology",
        "pypi",
        "python-sdk",
        "roxyapi",
        "vedic-astrology",
        "ai-agents",
        "astrology-api",
        "biorhythm-api",
        "fastapi",
        "kundli-api",
        "mcp-server",
        "model-context-protocol",
        "openapi",
        "spiritual-api",
        "tarot-api"
      ],
      "is_fork": false,
      "size_kb": 4205,
      "has_wiki": true,
      "homepage": "https://pypi.org/project/roxy-sdk/",
      "languages": {
        "Python": 223891
      },
      "pushed_at": "2026-07-19T07:55:10Z",
      "created_at": "2026-04-01T12:46:56Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-19T07:55:12Z",
      "description": "Python SDK for astrology, Vedic kundli, tarot, numerology, horoscope, I Ching, biorhythm and more. One multi domain API key, sync and async. AI agent and MCP ready.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "Python",
      "significant_languages": [
        "Python"
      ]
    },
    "owner": {
      "blog": "https://roxyapi.com",
      "name": "RoxyAPI",
      "type": "Organization",
      "login": "RoxyAPI",
      "company": null,
      "location": null,
      "followers": 7,
      "avatar_url": "https://avatars.githubusercontent.com/u/185915295?v=4",
      "created_at": "2024-10-22T11:04:00Z",
      "is_verified": null,
      "public_repos": 36,
      "account_age_days": 634
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases_count": 35,
      "commits_last_year": 85,
      "latest_release_at": "2026-07-19T07:55:11Z",
      "latest_release_tag": "v0.1.45",
      "releases_from_tags": false,
      "days_since_last_push": 0,
      "active_weeks_last_year": 15,
      "days_since_latest_release": 0,
      "mean_days_between_releases": 2.3
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 75,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": true
    },
    "ecosystem": {
      "packages": [
        {
          "name": "roxy-sdk",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "astrology",
            "vedic",
            "tarot",
            "numerology",
            "horoscope",
            "kundli",
            "birth-chart",
            "natal-chart",
            "iching",
            "crystals",
            "angel-numbers",
            "dreams",
            "biorhythm",
            "spiritual",
            "api",
            "sdk",
            "async",
            "fastapi",
            "ai-agent",
            "mcp",
            "llm",
            "Development Status :: 4 - Beta",
            "Intended Audience :: Developers",
            "Programming Language :: Python :: 3",
            "Programming Language :: Python :: 3.10",
            "Programming Language :: Python :: 3.11",
            "Programming Language :: Python :: 3.12",
            "Programming Language :: Python :: 3.13",
            "Typing :: Typed"
          ],
          "ecosystem": "pypi",
          "matches_repo": true,
          "registry_url": "https://pypi.org/project/roxy-sdk/",
          "is_deprecated": false,
          "latest_version": "0.1.45",
          "repository_url": "https://github.com/RoxyAPI/sdk-python",
          "versions_count": 45,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": null,
          "first_published_at": "2026-04-22T12:03:15.927063Z",
          "latest_published_at": "2026-07-19T07:55:00.143610Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 0
        }
      ]
    },
    "popularity": {
      "forks": 1,
      "stars": 0,
      "watchers": 0,
      "open_issues_and_prs": 0
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [
        "examples"
      ],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [
        "specs/openapi.json"
      ],
      "has_devcontainer": false,
      "typecheck_configs": [
        "src/roxy_sdk/py.typed"
      ],
      "largest_source_bytes": 192383,
      "source_files_sampled": 9,
      "oversized_source_files": 1,
      "agent_instruction_files": [
        "AGENTS.md"
      ],
      "agent_instruction_max_bytes": 19976
    },
    "dependencies": {
      "manifests": [
        "pyproject.toml"
      ],
      "ecosystems": [
        "pypi"
      ],
      "dependencies": [
        {
          "name": "httpx",
          "manifest": "pyproject.toml",
          "ecosystem": "pypi",
          "version_constraint": ">=0.27.0"
        }
      ],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "httpx",
            "direct": true,
            "version": "0.28.1",
            "ecosystem": "pypi"
          },
          {
            "name": "anyio",
            "direct": false,
            "version": "4.13.0",
            "ecosystem": "pypi"
          },
          {
            "name": "ast-serialize",
            "direct": false,
            "version": "0.6.0",
            "ecosystem": "pypi"
          },
          {
            "name": "backports-asyncio-runner",
            "direct": false,
            "version": "1.2.0",
            "ecosystem": "pypi"
          },
          {
            "name": "certifi",
            "direct": false,
            "version": "2026.4.22",
            "ecosystem": "pypi"
          },
          {
            "name": "colorama",
            "direct": false,
            "version": "0.4.6",
            "ecosystem": "pypi"
          },
          {
            "name": "exceptiongroup",
            "direct": false,
            "version": "1.3.1",
            "ecosystem": "pypi"
          },
          {
            "name": "h11",
            "direct": false,
            "version": "0.16.0",
            "ecosystem": "pypi"
          },
          {
            "name": "httpcore",
            "direct": false,
            "version": "1.0.9",
            "ecosystem": "pypi"
          },
          {
            "name": "idna",
            "direct": false,
            "version": "3.15",
            "ecosystem": "pypi"
          },
          {
            "name": "iniconfig",
            "direct": false,
            "version": "2.3.0",
            "ecosystem": "pypi"
          },
          {
            "name": "lefthook",
            "direct": false,
            "version": "2.1.10",
            "ecosystem": "pypi"
          },
          {
            "name": "librt",
            "direct": false,
            "version": "0.13.0",
            "ecosystem": "pypi"
          },
          {
            "name": "mypy",
            "direct": false,
            "version": "2.3.0",
            "ecosystem": "pypi"
          },
          {
            "name": "mypy-extensions",
            "direct": false,
            "version": "1.1.0",
            "ecosystem": "pypi"
          },
          {
            "name": "packaging",
            "direct": false,
            "version": "26.1",
            "ecosystem": "pypi"
          },
          {
            "name": "pathspec",
            "direct": false,
            "version": "1.0.4",
            "ecosystem": "pypi"
          },
          {
            "name": "pluggy",
            "direct": false,
            "version": "1.6.0",
            "ecosystem": "pypi"
          },
          {
            "name": "pygments",
            "direct": false,
            "version": "2.20.0",
            "ecosystem": "pypi"
          },
          {
            "name": "pytest",
            "direct": false,
            "version": "9.1.1",
            "ecosystem": "pypi"
          },
          {
            "name": "pytest-asyncio",
            "direct": false,
            "version": "1.4.0",
            "ecosystem": "pypi"
          },
          {
            "name": "roxy-sdk",
            "direct": false,
            "version": "0.1.45",
            "ecosystem": "pypi"
          },
          {
            "name": "ruff",
            "direct": false,
            "version": "0.15.21",
            "ecosystem": "pypi"
          },
          {
            "name": "tomli",
            "direct": false,
            "version": "2.4.1",
            "ecosystem": "pypi"
          },
          {
            "name": "typing-extensions",
            "direct": false,
            "version": "4.15.0",
            "ecosystem": "pypi"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 25,
        "direct_count": 1,
        "indirect_count": 24
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 5,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 3
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "Bot",
          "login": "github-actions[bot]",
          "commits": 45,
          "avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
        },
        {
          "type": "User",
          "login": "ph33nx",
          "commits": 36,
          "avatar_url": "https://avatars.githubusercontent.com/u/19635345?v=4"
        },
        {
          "type": "Bot",
          "login": "dependabot[bot]",
          "commits": 5,
          "avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
        }
      ],
      "contributors_sampled": 3,
      "top_contributor_share": 0.523
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "ci.yml",
        "release.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "uv.lock"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": null,
            "reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/26 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 0,
            "reason": "project has 0 contributing companies or organizations -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 10,
            "reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": 10,
            "reason": "packaging workflow detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 10,
            "reason": "security policy file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": 0,
            "reason": "Project has not signed or included provenance with any releases.",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 9,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "2a06ea886ff2470862aefda99d2761c55ff37ac1",
        "ran_at": "2026-07-19T07:59:58Z",
        "aggregate_score": 6.3,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": true
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/RoxyAPI/sdk-python",
    "host": "github.com",
    "name": "sdk-python",
    "owner": "RoxyAPI"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 59,
      "inputs": {
        "security": 63,
        "vitality": 80,
        "community": 27,
        "governance": 51,
        "engineering": 71
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 80,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "good",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 74,
            "inputs": {
              "commits_last_year": 85,
              "human_commit_share": null,
              "days_since_last_push": 0,
              "active_weeks_last_year": 15
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "15/52 weeks with commits",
                "points": 10.4,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 15
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "85 commits in the last year",
                "points": 17.4,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 85
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": null,
            "notes": [],
            "value": 90,
            "inputs": {
              "releases_count": 35,
              "latest_release_tag": "v0.1.45",
              "releases_from_tags": false,
              "days_since_latest_release": 0,
              "mean_days_between_releases": 2.3
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "35 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 35
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 0 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~2.3 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 2.3
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "Project has not signed or included provenance with any releases.",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "critical",
        "name": "Community & Adoption",
        "value": 27,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 1,
              "stars": 0,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "0 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "1 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 57,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 6.3,
                "status": "met",
                "details": [],
                "max_points": 6.3
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 51,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 24,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 3,
              "top_contributor_share": 0.523
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 52% of commits",
                "points": 10.7,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 52
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "3 contributors",
                "points": 4.1,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "at_risk",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 45,
            "inputs": {
              "merged_prs": 5,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 3
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "5/8 decided PRs merged",
                "points": 23.9,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 5,
                      "decided": 8
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/26 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 51,
            "inputs": {
              "followers": 7,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "RoxyAPI",
              "public_repos": 36,
              "account_age_days": 634
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "7 followers of RoxyAPI",
                "points": 6.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 7,
                      "login": "RoxyAPI"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "36 public repos, account ~1 yr old",
                "points": 14.9,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 36
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 1
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "roxy-sdk"
              ],
              "ecosystems": "pypi",
              "any_deprecated": false,
              "min_days_since_publish": 0
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on pypi",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "pypi"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 0 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 0
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "45 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 45
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "good",
        "name": "Engineering Quality",
        "value": 71,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "moderate",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "2 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "good",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 75,
            "inputs": {
              "topics": [
                "angel-numbers",
                "crystals",
                "dream-interpretation",
                "horoscope",
                "iching",
                "numerology",
                "pypi",
                "python-sdk",
                "roxyapi",
                "vedic-astrology",
                "ai-agents",
                "astrology-api",
                "biorhythm-api",
                "fastapi",
                "kundli-api",
                "mcp-server",
                "model-context-protocol",
                "openapi",
                "spiritual-api",
                "tarot-api"
              ],
              "has_wiki": true,
              "homepage": "https://pypi.org/project/roxy-sdk/",
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": "https://pypi.org/project/roxy-sdk/",
                "points": 15,
                "status": "met",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "20 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 20
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 63,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "moderate",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Branch-Protection. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "branch_protection"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 63,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 17,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 1,
              "scorecard_aggregate": 6.3
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/26 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "Project has not signed or included provenance with any releases.",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 6.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 67,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "good",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 75,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [
                "AGENTS.md"
              ],
              "agent_instruction_max_bytes": 19976
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "AGENTS.md",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "AGENTS.md"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "moderate",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 53,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [
                "uv.lock"
              ],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [
                "src/roxy_sdk/py.typed"
              ],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "src/roxy_sdk/py.typed",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "src/roxy_sdk/py.typed"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "dependency automation configured, none observed in the sampled commits",
                "points": 5,
                "status": "partial",
                "details": [
                  {
                    "code": "dependency_bot_config_only",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "good",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 76,
            "inputs": {
              "primary_language": "Python",
              "largest_source_bytes": 192383,
              "source_files_sampled": 9,
              "oversized_source_files": 1
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "Python with type-check config (src/roxy_sdk/py.typed)",
                "points": 27,
                "status": "partial",
                "details": [
                  {
                    "code": "typecheck_config_language",
                    "params": {
                      "files": "src/roxy_sdk/py.typed",
                      "language": "Python"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "1/9 source files over 60KB",
                "points": 48.9,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 9,
                      "oversized": 1
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          },
          {
            "key": "ai_interfaces",
            "band": "good",
            "name": "Machine-readable interfaces",
            "note": null,
            "notes": [],
            "value": 80,
            "inputs": {
              "example_dirs": [
                "examples"
              ],
              "has_mcp_signal": false,
              "api_schema_files": [
                "specs/openapi.json"
              ]
            },
            "components": [
              {
                "key": "api_schema_openapi_graphql_proto",
                "name": "API schema (OpenAPI/GraphQL/proto)",
                "detail": "specs/openapi.json",
                "points": 40,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "specs/openapi.json"
                    }
                  }
                ],
                "max_points": 40
              },
              {
                "key": "mcp_server",
                "name": "MCP server",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "runnable_examples",
                "name": "Runnable examples",
                "detail": "examples",
                "points": 40,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "examples"
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [],
  "report_type": "repository",
  "generated_at": "2026-07-19T08:00:06.569438Z",
  "schema_version": "0.14.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/RoxyAPI/sdk-python.svg",
  "full_name": "RoxyAPI/sdk-python",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.

Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.14.0 — повна методологія · вікі метрик.

Як окремий результат виглядає на тлі всього реєстру: сукупна статистикаPyPI.