Python SDK for astrology, Vedic kundli, tarot, numerology, horoscope, I Ching, biorhythm and more. One multi domain API key, sync and async. AI agent and MCP ready.
RoxyAPI/sdk-python tiene un índice de salud de 59 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (80/100) y la más baja, Community & Adoption (27/100). Se actualizó por última vez hoy. Una sola persona concentra la mayor parte del trabajo reciente.
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| PyPI | roxy-sdk | 0.1.45 | - | 45 | hace 0 días | astrologyvedictarotnumerologyhoroscopekundlibirth-chartnatal-chartichingcrystalsangel-numbersdreamsbiorhythmspiritualapisdkasyncfastapiai-agentmcpllm |
¿Está vivo el proyecto: se escribe código y se publican versiones?
| 36/36 | Recencia de push — último push hace 0 días |
| 10.4/36 | Cadencia de commits — 15/52 semanas con commits |
| 17.4/18 | Volumen de commits — 85 commits en el último año |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 85 |
| human_commit_share | — |
| days_since_last_push | 0 |
| active_weeks_last_year | 15 |
| 27/27 | Publica versiones — 35 versiones publicadas |
| 36/36 | Recencia de las versiones — última versión hace 0 días |
| 27/27 | Cadencia de publicación — una versión cada ~2,3 días |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 35 |
| latest_release_tag | v0.1.45 |
| releases_from_tags | no |
| days_since_latest_release | 0 |
| mean_days_between_releases | 2,3 |
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
| 0/60 | Estrellas — 0 estrellas |
| 0/25 | Forks — 1 forks |
| 0/15 | Observadores — 0 observadores |
| forks | 1 |
| stars | 0 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | Licencia — licencia reconocida (MIT) |
| 0/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 6.3/6.3 | Plantilla de PR |
| has_readme | sí |
| has_license | sí |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | sí |
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 10.7/22.5 | Distribución de commits — el principal contribuyente firma el 52% de los commits |
| 4.1/13.5 | Amplitud de contribuyentes — 3 contribuyentes |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0,523 |
| 0/46.8 | Resolución de issues — sin issues o sin datos |
| 23.9/38.3 | Aceptación de PR — 5/8 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/26 approved changesets -- score normalized to 0 |
| merged_prs | 5 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 3 |
| 30/30 | Respaldo de la propiedad — propiedad de una organización |
| 0/20 | Dominio verificado |
| 6.5/25 | Alcance del propietario — 7 seguidores de RoxyAPI |
| 14.9/25 | Trayectoria — 36 repos públicos, cuenta de ~1 años |
| followers | 7 |
| owner_type | Organization |
| is_verified | — |
| owner_login | RoxyAPI |
| public_repos | 36 |
| account_age_days | 634 |
| 25/25 | Publicado y resoluble — 1 paquete(s) en pypi |
| 35/35 | Recencia de publicación — última publicación hace 0 días |
| 20/20 | Historial de versiones — 45 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
| packages | roxy-sdk |
| ecosystems | pypi |
| any_deprecated | no |
| min_days_since_publish | 0 |
¿Existen unas prácticas mínimas de ingeniería y documentación?
| 24/24 | Flujos de trabajo de CI — 2 flujo(s) de trabajo |
| 24/24 | Pruebas presentes |
| 0/16 | Configuración de linter |
| 0/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| has_ci | sí |
| has_tests | sí |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Directorio de documentación |
| 15/15 | Sitio de documentación / página del proyecto — https://pypi.org/project/roxy-sdk/ |
| 10/10 | Descripción del repositorio |
| 10/10 | Topics — 20 topics |
| 10/10 | Wiki |
| topics | angel-numbers, crystals, dream-interpretation, horoscope, iching, numerology, pypi, python-sdk, roxyapi, vedic-astrology, ai-agents, astrology-api, biorhythm-api, fastapi, kundli-api, mcp-server, model-context-protocol, openapi, spiritual-api, tarot-api |
| has_wiki | sí |
| homepage | https://pypi.org/project/roxy-sdk/ |
| has_readme | sí |
| has_docs_dir | no |
| has_description | sí |
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — sin datos |
| 2.5/2.5 | CI-Tests — 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/26 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Licencia — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 5/5 | Packaging — packaging workflow detected |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 6.8/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 17 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 1 |
| scorecard_aggregate | 6,3 |
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
| 45/45 | Instrucciones para agentes — AGENTS.md |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 0/40 | Historial de commits legible — sin datos |
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | AGENTS.md |
| agent_instruction_max_bytes | 19.976 |
| 0/18 | Arranque con un solo comando |
| 22/22 | Pruebas automatizadas |
| 0/11 | Configuración de lint / formato |
| 11/11 | Verificación estática de tipos — src/roxy_sdk/py.typed |
| 10/10 | Entorno reproducible — lockfile |
| 0/10 | Práctica demostrada con agentes — sin datos |
| 5/8 | Mantenimiento automatizado — automatización de dependencias configurada, no observada en los commits muestreados |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | no |
| has_tests | sí |
| lockfiles | uv.lock |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | src/roxy_sdk/py.typed |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
| 27/45 | Código verificable por tipos — Python con configuración de verificación de tipos (src/roxy_sdk/py.typed) |
| 48.9/55 | Tamaños de archivo manejables — 1/9 archivos fuente de más de 60 KB |
| primary_language | Python |
| largest_source_bytes | 192.383 |
| source_files_sampled | 9 |
| oversized_source_files | 1 |
| 40/40 | Esquema de API (OpenAPI/GraphQL/proto) — specs/openapi.json |
| 0/20 | Servidor MCP |
| 40/40 | Ejemplos ejecutables — examples |
| example_dirs | examples |
| has_mcp_signal | no |
| api_schema_files | specs/openapi.json |
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/d | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| 10 | CI-Tests | 4 out of 4 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/26 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 10 | Packaging | packaging workflow detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 10 | Security-Policy | security policy file detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 9 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
| Registro | Paquete | Restricción de versión | Manifiesto |
|---|---|---|---|
| PyPI | httpx | >=0.27.0 | pyproject.toml |
Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 1 paquetes directos y 24 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.
| Registro | Paquete | Versión | Relación |
|---|---|---|---|
| PyPI | httpx | 0.28.1 | directa |
| PyPI | anyio | 4.13.0 | indirecta |
| PyPI | ast-serialize | 0.6.0 | indirecta |
| PyPI | backports-asyncio-runner | 1.2.0 | indirecta |
| PyPI | certifi | 2026.4.22 | indirecta |
| PyPI | colorama | 0.4.6 | indirecta |
| PyPI | exceptiongroup | 1.3.1 | indirecta |
| PyPI | h11 | 0.16.0 | indirecta |
| PyPI | httpcore | 1.0.9 | indirecta |
| PyPI | idna | 3.15 | indirecta |
| PyPI | iniconfig | 2.3.0 | indirecta |
| PyPI | lefthook | 2.1.10 | indirecta |
| PyPI | librt | 0.13.0 | indirecta |
| PyPI | mypy | 2.3.0 | indirecta |
| PyPI | mypy-extensions | 1.1.0 | indirecta |
| PyPI | packaging | 26.1 | indirecta |
| PyPI | pathspec | 1.0.4 | indirecta |
| PyPI | pluggy | 1.6.0 | indirecta |
| PyPI | pygments | 2.20.0 | indirecta |
| PyPI | pytest | 9.1.1 | indirecta |
| PyPI | pytest-asyncio | 1.4.0 | indirecta |
| PyPI | roxy-sdk | 0.1.45 | indirecta |
| PyPI | ruff | 0.15.21 | indirecta |
| PyPI | tomli | 2.4.1 | indirecta |
| PyPI | typing-extensions | 4.15.0 | indirecta |
{
"data": {
"repo": {
"topics": [
"angel-numbers",
"crystals",
"dream-interpretation",
"horoscope",
"iching",
"numerology",
"pypi",
"python-sdk",
"roxyapi",
"vedic-astrology",
"ai-agents",
"astrology-api",
"biorhythm-api",
"fastapi",
"kundli-api",
"mcp-server",
"model-context-protocol",
"openapi",
"spiritual-api",
"tarot-api"
],
"is_fork": false,
"size_kb": 4205,
"has_wiki": true,
"homepage": "https://pypi.org/project/roxy-sdk/",
"languages": {
"Python": 223891
},
"pushed_at": "2026-07-19T07:55:10Z",
"created_at": "2026-04-01T12:46:56Z",
"owner_type": "Organization",
"updated_at": "2026-07-19T07:55:12Z",
"description": "Python SDK for astrology, Vedic kundli, tarot, numerology, horoscope, I Ching, biorhythm and more. One multi domain API key, sync and async. AI agent and MCP ready.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Python",
"significant_languages": [
"Python"
]
},
"owner": {
"blog": "https://roxyapi.com",
"name": "RoxyAPI",
"type": "Organization",
"login": "RoxyAPI",
"company": null,
"location": null,
"followers": 7,
"avatar_url": "https://avatars.githubusercontent.com/u/185915295?v=4",
"created_at": "2024-10-22T11:04:00Z",
"is_verified": null,
"public_repos": 36,
"account_age_days": 634
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases_count": 35,
"commits_last_year": 85,
"latest_release_at": "2026-07-19T07:55:11Z",
"latest_release_tag": "v0.1.45",
"releases_from_tags": false,
"days_since_last_push": 0,
"active_weeks_last_year": 15,
"days_since_latest_release": 0,
"mean_days_between_releases": 2.3
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 75,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"ecosystem": {
"packages": [
{
"name": "roxy-sdk",
"exists": true,
"license": "MIT",
"keywords": [
"astrology",
"vedic",
"tarot",
"numerology",
"horoscope",
"kundli",
"birth-chart",
"natal-chart",
"iching",
"crystals",
"angel-numbers",
"dreams",
"biorhythm",
"spiritual",
"api",
"sdk",
"async",
"fastapi",
"ai-agent",
"mcp",
"llm",
"Development Status :: 4 - Beta",
"Intended Audience :: Developers",
"Programming Language :: Python :: 3",
"Programming Language :: Python :: 3.10",
"Programming Language :: Python :: 3.11",
"Programming Language :: Python :: 3.12",
"Programming Language :: Python :: 3.13",
"Typing :: Typed"
],
"ecosystem": "pypi",
"matches_repo": true,
"registry_url": "https://pypi.org/project/roxy-sdk/",
"is_deprecated": false,
"latest_version": "0.1.45",
"repository_url": "https://github.com/RoxyAPI/sdk-python",
"versions_count": 45,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": null,
"first_published_at": "2026-04-22T12:03:15.927063Z",
"latest_published_at": "2026-07-19T07:55:00.143610Z",
"latest_version_yanked": null,
"days_since_latest_publish": 0
}
]
},
"popularity": {
"forks": 1,
"stars": 0,
"watchers": 0,
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples"
],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [
"specs/openapi.json"
],
"has_devcontainer": false,
"typecheck_configs": [
"src/roxy_sdk/py.typed"
],
"largest_source_bytes": 192383,
"source_files_sampled": 9,
"oversized_source_files": 1,
"agent_instruction_files": [
"AGENTS.md"
],
"agent_instruction_max_bytes": 19976
},
"dependencies": {
"manifests": [
"pyproject.toml"
],
"ecosystems": [
"pypi"
],
"dependencies": [
{
"name": "httpx",
"manifest": "pyproject.toml",
"ecosystem": "pypi",
"version_constraint": ">=0.27.0"
}
],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "httpx",
"direct": true,
"version": "0.28.1",
"ecosystem": "pypi"
},
{
"name": "anyio",
"direct": false,
"version": "4.13.0",
"ecosystem": "pypi"
},
{
"name": "ast-serialize",
"direct": false,
"version": "0.6.0",
"ecosystem": "pypi"
},
{
"name": "backports-asyncio-runner",
"direct": false,
"version": "1.2.0",
"ecosystem": "pypi"
},
{
"name": "certifi",
"direct": false,
"version": "2026.4.22",
"ecosystem": "pypi"
},
{
"name": "colorama",
"direct": false,
"version": "0.4.6",
"ecosystem": "pypi"
},
{
"name": "exceptiongroup",
"direct": false,
"version": "1.3.1",
"ecosystem": "pypi"
},
{
"name": "h11",
"direct": false,
"version": "0.16.0",
"ecosystem": "pypi"
},
{
"name": "httpcore",
"direct": false,
"version": "1.0.9",
"ecosystem": "pypi"
},
{
"name": "idna",
"direct": false,
"version": "3.15",
"ecosystem": "pypi"
},
{
"name": "iniconfig",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "lefthook",
"direct": false,
"version": "2.1.10",
"ecosystem": "pypi"
},
{
"name": "librt",
"direct": false,
"version": "0.13.0",
"ecosystem": "pypi"
},
{
"name": "mypy",
"direct": false,
"version": "2.3.0",
"ecosystem": "pypi"
},
{
"name": "mypy-extensions",
"direct": false,
"version": "1.1.0",
"ecosystem": "pypi"
},
{
"name": "packaging",
"direct": false,
"version": "26.1",
"ecosystem": "pypi"
},
{
"name": "pathspec",
"direct": false,
"version": "1.0.4",
"ecosystem": "pypi"
},
{
"name": "pluggy",
"direct": false,
"version": "1.6.0",
"ecosystem": "pypi"
},
{
"name": "pygments",
"direct": false,
"version": "2.20.0",
"ecosystem": "pypi"
},
{
"name": "pytest",
"direct": false,
"version": "9.1.1",
"ecosystem": "pypi"
},
{
"name": "pytest-asyncio",
"direct": false,
"version": "1.4.0",
"ecosystem": "pypi"
},
{
"name": "roxy-sdk",
"direct": false,
"version": "0.1.45",
"ecosystem": "pypi"
},
{
"name": "ruff",
"direct": false,
"version": "0.15.21",
"ecosystem": "pypi"
},
{
"name": "tomli",
"direct": false,
"version": "2.4.1",
"ecosystem": "pypi"
},
{
"name": "typing-extensions",
"direct": false,
"version": "4.15.0",
"ecosystem": "pypi"
}
],
"collected": true,
"truncated": false,
"total_count": 25,
"direct_count": 1,
"indirect_count": 24
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 5,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 3
},
"bus_factor": 1,
"top_contributors": [
{
"type": "Bot",
"login": "github-actions[bot]",
"commits": 45,
"avatar_url": "https://avatars.githubusercontent.com/in/15368?v=4"
},
{
"type": "User",
"login": "ph33nx",
"commits": 36,
"avatar_url": "https://avatars.githubusercontent.com/u/19635345?v=4"
},
{
"type": "Bot",
"login": "dependabot[bot]",
"commits": 5,
"avatar_url": "https://avatars.githubusercontent.com/in/29110?v=4"
}
],
"contributors_sampled": 3,
"top_contributor_share": 0.523
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"ci.yml",
"release.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"uv.lock"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": null,
"reason": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 10,
"reason": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/26 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": 10,
"reason": "packaging workflow detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 0,
"reason": "dependency not pinned by hash detected -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 10,
"reason": "security policy file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 9,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "2a06ea886ff2470862aefda99d2761c55ff37ac1",
"ran_at": "2026-07-19T07:59:58Z",
"aggregate_score": 6.3,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": true
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/RoxyAPI/sdk-python",
"host": "github.com",
"name": "sdk-python",
"owner": "RoxyAPI"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 59,
"inputs": {
"security": 63,
"vitality": 80,
"community": 27,
"governance": 51,
"engineering": 71
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 80,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "good",
"name": "Development activity",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"commits_last_year": 85,
"human_commit_share": null,
"days_since_last_push": 0,
"active_weeks_last_year": 15
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "15/52 weeks with commits",
"points": 10.4,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 15
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "85 commits in the last year",
"points": 17.4,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 85
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 35,
"latest_release_tag": "v0.1.45",
"releases_from_tags": false,
"days_since_latest_release": 0,
"mean_days_between_releases": 2.3
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "35 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 35
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 0 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 0
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~2.3 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 2.3
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "repository_too_young",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "critical",
"name": "Community & Adoption",
"value": 27,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 1,
"stars": 0,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "0 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 0
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "1 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 1
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 57,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 6.3,
"status": "met",
"details": [],
"max_points": 6.3
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 51,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 24,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 3,
"top_contributor_share": 0.523
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 52% of commits",
"points": 10.7,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 52
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "3 contributors",
"points": 4.1,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 3
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "at_risk",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"merged_prs": 5,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 3
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "5/8 decided PRs merged",
"points": 23.9,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 5,
"decided": 8
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/26 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "moderate",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 51,
"inputs": {
"followers": 7,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "RoxyAPI",
"public_repos": 36,
"account_age_days": 634
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "7 followers of RoxyAPI",
"points": 6.5,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 7,
"login": "RoxyAPI"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "36 public repos, account ~1 yr old",
"points": 14.9,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 36
}
},
{
"code": "account_age_years",
"params": {
"years": 1
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"roxy-sdk"
],
"ecosystems": "pypi",
"any_deprecated": false,
"min_days_since_publish": 0
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on pypi",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "pypi"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 0 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 0
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "45 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 45
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "good",
"name": "Engineering Quality",
"value": 71,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 68,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "2 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 2
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
"points": 20,
"status": "met",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [
"angel-numbers",
"crystals",
"dream-interpretation",
"horoscope",
"iching",
"numerology",
"pypi",
"python-sdk",
"roxyapi",
"vedic-astrology",
"ai-agents",
"astrology-api",
"biorhythm-api",
"fastapi",
"kundli-api",
"mcp-server",
"model-context-protocol",
"openapi",
"spiritual-api",
"tarot-api"
],
"has_wiki": true,
"homepage": "https://pypi.org/project/roxy-sdk/",
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": "https://pypi.org/project/roxy-sdk/",
"points": 15,
"status": "met",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "20 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 20
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 63,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Branch-Protection. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"branch_protection"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 63,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 17,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 1,
"scorecard_aggregate": 6.3
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "4 out of 4 merged PRs checked by a CI test -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/26 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file detected",
"points": 5,
"status": "met",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 6.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 67,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "good",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 75,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [
"AGENTS.md"
],
"agent_instruction_max_bytes": 19976
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "AGENTS.md",
"points": 45,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "AGENTS.md"
}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "moderate",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 53,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"uv.lock"
],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"src/roxy_sdk/py.typed"
],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "src/roxy_sdk/py.typed",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "src/roxy_sdk/py.typed"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "good",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 76,
"inputs": {
"primary_language": "Python",
"largest_source_bytes": 192383,
"source_files_sampled": 9,
"oversized_source_files": 1
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Python with type-check config (src/roxy_sdk/py.typed)",
"points": 27,
"status": "partial",
"details": [
{
"code": "typecheck_config_language",
"params": {
"files": "src/roxy_sdk/py.typed",
"language": "Python"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "1/9 source files over 60KB",
"points": 48.9,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 9,
"oversized": 1
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "good",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 80,
"inputs": {
"example_dirs": [
"examples"
],
"has_mcp_signal": false,
"api_schema_files": [
"specs/openapi.json"
]
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": "specs/openapi.json",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "specs/openapi.json"
}
}
],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [],
"report_type": "repository",
"generated_at": "2026-07-19T08:00:06.569438Z",
"schema_version": "0.14.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/r/RoxyAPI/sdk-python.svg",
"full_name": "RoxyAPI/sdk-python",
"license_state": "standard",
"license_spdx": "MIT"
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.14.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — PyPI.