Public record
Software health reportschema 0.26.0 · metrics 1.13.0 · 2026-07-22 16:30 UTC

inspect-js / node-supports-preserve-symlinks-flag

Determine if the current node version supports the `--preserve-symlinks` flag.

JavaScriptMIT★ 1 star⑂ 4 forkssince Jan 2022View on GitHub ↗

inspect-js/node-supports-preserve-symlinks-flag holds a health index of 43 out of 100, placing it in the At risk band. It scores highest on Engineering Quality (68/100) and lowest on Vitality (13/100). It was last updated 1358 days ago. A single contributor accounts for most of its recent work.

43
overall / 100
At risk

Software health index

Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.

43
Excellent85-100Exemplary; meets essentially all checked criteria
Good70-84Healthy; minor gaps
Moderate50-69Acceptable with notable gaps; review recommended
At risk30-49Significant weaknesses; adoption warrants caution
Critical1-29Severe problems (abandoned, single-maintainer, no hygiene)
VitalityCommunity &AdoptionSustainability &GovernanceEngineeringQualitySecurityAI Readiness

Score profile

Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.

Ownership

Inspect JSOrganization
54 followers83 public repossince Aug 2019

This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.

Package ecosystems

RegistryPackageVersionDownloads / moVersionsLast publishTags
npmsupports-preserve-symlinks-flag1.0.0486,692,31911661 days agonodeflagsymlinksymlinkspreserve-symlinks

Metrics by category

Vitality

Is the project alive — is code being written and are releases shipping?

13Critical · 22% of overall
How it's scored
0/36Push recency — last push 1,358 days ago
0/36Commit cadence — 0/52 weeks with commits
0/18Commit volume — 0 commits in the last year
0/10OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
Inputs used
commits_last_year0
human_commit_share
days_since_last_push1,358
active_weeks_last_year0
How it's scored
16.2/27Ships releases — 1 version tags (no GitHub releases)
0/36Release recency — latest release 1,661 days ago
12.6/27Release cadence — cadence unknown (single release)
0/10OpenSSF Scorecard: Signed-Releases — no data
Inputs used
releases_count1
latest_release_tagv1.0.0
releases_from_tagsyes
days_since_latest_release1,661
mean_days_between_releases
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.

Community & Adoption

Does the project have users, downloads, attention, and a welcoming setup for contributors?

56Moderate · 18% of overall
How it's scored
0/60Stars — 1 stars
4/25Forks — 4 forks
0/15Watchers — 1 watchers
Inputs used
forks4
stars1
watchers1
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history

Community health

85Excellent
How it's scored
22.5/22.5README
22.5/22.5License — recognized license (MIT)
18/18CONTRIBUTING guide
13.5/13.5Code of conduct
0/7.2Issue template
0/6.3PR template
Inputs used
has_readmeyes
has_licenseyes
has_contributingyes
has_issue_templateno
has_code_of_conductyes
has_pull_request_templateno
How it's scored
80/80Monthly downloads — 486,692,319 downloads/month across npm
0/20Registry dependents — not reported by this ecosystem
Inputs used
packagessupports-preserve-symlinks-flag
dependents
ecosystemsnpm
total_downloads
monthly_downloads486,692,319
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.

Sustainability & Governance

Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?

34At risk · 24% of overall
How it's scored
9/54Bus factor — 1 contributor(s) cover half of all commits
0/22.5Commit distribution — top contributor authored 100% of commits
1.4/13.5Contributor breadth — 1 contributors
10/10OpenSSF Scorecard: Contributors — project has 31 contributing companies or organizations
Inputs used
bus_factor1
contributors_sampled1
top_contributor_share1
How it's scored
0/46.8Issue resolution — 0% of issues closed
0/38.3PR acceptance — no decided pull requests or no data
0/15OpenSSF Scorecard: Code-Review — Found 0/17 approved changesets -- score normalized to 0
Inputs used
merged_prs0
open_issues1
closed_issues0
issue_closed_ratio0
closed_unmerged_prs0
Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.
How it's scored
30/30Ownership backing — organization-owned
0/20Verified domain
12.5/25Owner reach — 54 followers of inspect-js
25/25Track record — 83 public repos, account ~6 yr old
Inputs used
followers54
owner_typeOrganization
is_verified
owner_logininspect-js
public_repos83
account_age_days2,535
How it's scored
25/25Published & resolvable — 1 package(s) on npm
4/35Publish recency — latest publish 1,661 days ago
4/20Version history — 1 published versions
20/20Not deprecated — active, not deprecated or yanked
Inputs used
packagessupports-preserve-symlinks-flag
ecosystemsnpm
any_deprecatedno
min_days_since_publish1,661

Engineering Quality

Are baseline engineering and documentation practices in place?

68Moderate · 20% of overall
How it's scored
24/24CI workflows — 5 workflow(s)
24/24Tests present
16/16Linter config — .eslintrc
0/9.6Pre-commit hooks
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — no data
Inputs used
has_ciyes
has_testsyes
has_editorconfigno
has_linter_configyes
has_precommit_configno
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.

Documentation

50Moderate
How it's scored
30/30README
0/25Documentation directory
0/15Documentation / homepage site
10/10Repository description
10/10Topics — 5 topics
0/10Wiki
Inputs used
topicsnode, symlink, flag, symlinks, preserve-symlinks
has_wikino
homepage
has_readmeyes
has_docs_dirno
has_descriptionyes

Security

Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?

52Moderate · 16% of overall
How it's scored
7.5/7.5Binary-Artifacts — no binaries found in the repo
0.8/7.5Branch-Protection — branch protection is not maximal on development and all release branches
0/2.5CI-Tests — no data
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/17 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 31 contributing companies or organizations
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5License — license file detected
0/7.5Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
0/5Packaging — no data
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — no SAST tool detected
5/5Security-Policy — security policy file detected
0/7.5Signed-Releases — no data
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Inputs used
sourceopenssf_scorecard
checks_evaluated15
scorecard_versionv5.5.0
checks_inconclusive3
scorecard_aggregate4
Excluded from scoring (no data or not applicable): ci_tests, packaging, signed_releases. Remaining weights renormalized.
How it's scored
35/35Direct dependencies free of known advisories — no direct dependency carries a known advisory
0/25Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope
0/40No advisories left outstanding — no advisory carries a publication date
Inputs used
sourceosv
advisories0
affected_packages0
assessed_packages1
unassessed_packages9
affected_by_severitynone
direct_affected_packages0
Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 1 resolved dependencies against OSV. 9 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.

AI Readiness

How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.

29Critical · 0% of overall
How it's scored
0/45Agent instructions — no CLAUDE.md / AGENTS.md / editor rules
0/15Machine-readable docs (llms.txt)
0/40Legible commit history — no data
Inputs used
has_llms_txtno
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.
How it's scored
0/18One-command bootstrap
22/22Automated tests
11/11Lint / format config — .eslintrc
0/11Static type checking
0/10Reproducible environment
0/10Demonstrated agent practice — no data
0/8Automated maintenance — no data
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Inputs used
has_nixno
has_testsyes
lockfiles
has_dockerfileno
typed_languageno
bootstrap_files
has_devcontainerno
has_linter_configyes
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.
How it's scored
0/45Type-checkable code — JavaScript without a type-check config
55/55Manageable file sizes — 0/3 source files over 60KB
Inputs used
primary_languageJavaScript
largest_source_bytes737
source_files_sampled3
oversized_source_files0

Key facts

1GitHub stars
1contributors
0commits, last 12 months
1,358days since last push
1releases
1bus factor
1open issues
npmpackage ecosystems

Data collection warnings

  • Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token

More detail

Star and fork history 0 ★ / 4 ⇿
0Stars
4Forks

When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.

1223344412022-042024-042026-05

Each point covers 4 days.

OpenSSF Scorecard 4.0 / 10
4.0aggregate

Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).Scorecard v5.5.0 · 2026-07-22 16:30 UTC

10Binary-Artifactsno binaries found in the repo
1Branch-Protectionbranch protection is not maximal on development and all release branches
n/aCI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/17 approved changesets -- score normalized to 0
10Contributorsproject has 31 contributing companies or organizations
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintained0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
n/aPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTno SAST tool detected
10Security-Policysecurity policy file detected
n/aSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
All dependencies 10

Full resolved dependency set from the GitHub dependency graph: 0 direct and 10 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.

RegistryPackageVersionRelation
npm@ljharb/eslint-config^21.0.0indirect
npmaud^2.0.1indirect
npmauto-changelog^2.4.0indirect
npmeslint8.8.0indirect
npmin-publish^2.0.1indirect
npmnpmignore^0.3.0indirect
npmnyc^10.3.2indirect
npmsafe-publish-latest^2.0.0indirect
npmsemver^6.3.0indirect
npmtape^5.6.1indirect
Dependency advisories 0

This repository publishes no package the index resolves, so its own dependency graph was assessed — 1 packages, which also include development and test pins that never ship: 0 carry known advisories, of which 0 are direct. 9 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list.

No known advisories affect the assessed dependencies.

An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.

Raw JSON report machine-readable
{
  "data": {
    "repo": {
      "topics": [
        "node",
        "symlink",
        "flag",
        "symlinks",
        "preserve-symlinks"
      ],
      "is_fork": false,
      "size_kb": 24,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 1068
      },
      "pushed_at": "2022-11-02T16:24:38Z",
      "created_at": "2022-01-03T07:06:47Z",
      "owner_type": "Organization",
      "updated_at": "2023-12-25T03:55:36Z",
      "description": "Determine if the current node version supports the `--preserve-symlinks` flag.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript"
      ]
    },
    "owner": {
      "blog": null,
      "name": "Inspect JS",
      "type": "Organization",
      "login": "inspect-js",
      "company": null,
      "location": null,
      "followers": 54,
      "avatar_url": "https://avatars.githubusercontent.com/u/54056128?v=4",
      "created_at": "2019-08-13T06:36:36Z",
      "is_verified": null,
      "public_repos": 83,
      "account_age_days": 2535
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2022-01-03T07:21:44Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] use `npmignore` to autogenerate an npmignore file",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:22:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c406260b8be8a6d7a30a37f9f6da84ed4c0e132e",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@ljharb/eslint-config`, `aud`, `tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:21:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7188768d2a65934b104ffd77102c533dc038d7bf",
          "body": null,
          "is_bot": false,
          "headline": "[actions] update rebase action to use reusable workflow",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:19:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34761bea1f1ff0815e8b3515d1463357b03b9be2",
          "body": "…ngelog`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `eslint`, `@ljharb/eslint-config`, `aud`, `auto-cha…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T04:00:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "be98485fb667bbe3f2b36454cfa725f1e8f8cb8e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] fix FUNDING.yml",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T03:59:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f7cac19c0c298cf40b3f2f3c735477ad579ac61",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.0",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:21:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c9afa9fabc8eaf0814aaed6dd01e6df0931b76d",
          "body": null,
          "is_bot": false,
          "headline": "read me",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:10:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5ef77f7cb6946d16ee38672be9ec0f1bbdf63262",
          "body": null,
          "is_bot": false,
          "headline": "[meta] do not publish workflow files",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "600223ba24f30779f209d9097721eff35ed62741",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `sideEffects` flag",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c476ae1ed7ce68b0480344f090ac2844f35509d",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `auto-changelog`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:54:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2bb23b3ebab02dc4135c4cdf0217db82835b9fca",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `safe-publish-latest`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e2f59ad74e2ae0f5f4899fcde6a6f693ab7cc074",
          "body": null,
          "is_bot": false,
          "headline": "Tests",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2f9892546396d4ab0ad9f1ff83e76c3f01234ae8",
          "body": null,
          "is_bot": false,
          "headline": "Initial implementation",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:45:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d0fffc886d25fba119355520750a909d64da0087",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] add `eslint`, `@ljharb/eslint-config`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:41:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ab318ed7ae62f6c2c0e80a50398d40912afd8f69",
          "body": null,
          "is_bot": false,
          "headline": "Only apps should have lockfiles",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "992b068503a461f7e8676f40ca2aab255fd8d6ff",
          "body": null,
          "is_bot": false,
          "headline": "npm init",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dc222aad3c0b940d8d3af1ca9937d108bd2dc4b9",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:06:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 1,
      "commits_last_year": 0,
      "latest_release_at": "2022-01-03T07:21:44Z",
      "latest_release_tag": "v1.0.0",
      "releases_from_tags": true,
      "days_since_last_push": 1358,
      "active_weeks_last_year": 0,
      "days_since_latest_release": 1661,
      "mean_days_between_releases": null
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": true,
      "health_percentage": 75,
      "has_issue_template": false,
      "has_code_of_conduct": true,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "supports-preserve-symlinks-flag",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "node",
            "flag",
            "symlink",
            "symlinks",
            "preserve-symlinks"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/supports-preserve-symlinks-flag",
          "is_deprecated": false,
          "latest_version": "1.0.0",
          "repository_url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
          "versions_count": 1,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 486692319,
          "first_published_at": "2022-01-03T07:22:56.474000Z",
          "latest_published_at": "2022-01-03T07:22:56.640000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 1661
        }
      ]
    },
    "popularity": {
      "forks": 4,
      "stars": 1,
      "watchers": 1,
      "fork_history": {
        "days": [
          {
            "date": "2022-04-08",
            "count": 1
          },
          {
            "date": "2023-12-25",
            "count": 1
          },
          {
            "date": "2024-01-19",
            "count": 1
          },
          {
            "date": "2026-05-03",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 4,
        "total_forks": 4
      },
      "star_history": null,
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "toolchain_manifests": [],
      "largest_source_bytes": 737,
      "source_files_sampled": 3,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 1,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 9,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@ljharb/eslint-config",
            "direct": false,
            "version": "^21.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "aud",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "auto-changelog",
            "direct": false,
            "version": "^2.4.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint",
            "direct": false,
            "version": "8.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "in-publish",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "npmignore",
            "direct": false,
            "version": "^0.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "nyc",
            "direct": false,
            "version": "^10.3.2",
            "ecosystem": "npm"
          },
          {
            "name": "safe-publish-latest",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "semver",
            "direct": false,
            "version": "^6.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "tape",
            "direct": false,
            "version": "^5.6.1",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 10,
        "direct_count": 0,
        "indirect_count": 10
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 0,
        "open_issues": 1,
        "closed_ratio": 0,
        "closed_issues": 0,
        "closed_unmerged_prs": 0
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "ljharb",
          "commits": 17,
          "avatar_url": "https://avatars.githubusercontent.com/u/45469?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "node-aught.yml",
        "node-pretest.yml",
        "node-tens.yml",
        "rebase.yml",
        "require-allow-edits.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [
        ".eslintrc"
      ],
      "has_editorconfig": false,
      "has_linter_config": true,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 1,
            "reason": "branch protection is not maximal on development and all release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/17 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 31 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 10,
            "reason": "security policy file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
        "ran_at": "2026-07-22T16:30:20Z",
        "aggregate_score": 4,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-22T05:24:47Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": null,
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": [
        {
          "number": 1,
          "created_at": "2022-01-03T07:06:53Z",
          "last_comment_at": null,
          "last_comment_author": null
        }
      ]
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
    "host": "github.com",
    "name": "node-supports-preserve-symlinks-flag",
    "owner": "inspect-js"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 43,
      "inputs": {
        "security": 52,
        "vitality": 13,
        "community": 56,
        "governance": 34,
        "engineering": 68
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "critical",
        "name": "Vitality",
        "value": 13,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "critical",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "commits_last_year": 0,
              "human_commit_share": null,
              "days_since_last_push": 1358,
              "active_weeks_last_year": 0
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 1358 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 1358
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "0/52 weeks with commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "0 commits in the last year",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "at_risk",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 32,
            "inputs": {
              "releases_count": 1,
              "latest_release_tag": "v1.0.0",
              "releases_from_tags": true,
              "days_since_latest_release": 1661,
              "mean_days_between_releases": null
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "1 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 1661 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "cadence unknown (single release)",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence_unknown",
                    "params": {}
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "dormant",
              "guards": [
                "no_open_demand",
                "dependencies_clean"
              ],
              "signals": [
                "scorecard_unmaintained"
              ],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": 0,
              "unanswered_open_issues": 1,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 1358,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "no human commit for 1358 days, with nothing left unanswered; held at dormant by nothing open to answer, no affected dependency",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_quiet",
                    "params": {
                      "days": 1358
                    }
                  },
                  {
                    "code": "abandonment_guarded",
                    "params": {
                      "guards": "nothing open to answer, no affected dependency"
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 56,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 4,
            "inputs": {
              "forks": 4,
              "stars": 1,
              "watchers": 1,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "4 forks",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "1 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "excellent",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 85,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": true,
              "has_issue_template": false,
              "has_code_of_conduct": true,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 18,
                "status": "met",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 13.5,
                "status": "met",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "excellent",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 486692319
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "486,692,319 downloads/month across npm",
                "points": 80,
                "status": "met",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 486692319,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 34,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "pr_acceptance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 1,
              "closed_issues": 0,
              "issue_closed_ratio": 0,
              "closed_unmerged_prs": 0
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "0% of issues closed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 0
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "no decided pull requests or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_decided_prs_or_data",
                    "params": {}
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "followers": 54,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "inspect-js",
              "public_repos": 83,
              "account_age_days": 2535
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "54 followers of inspect-js",
                "points": 12.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 54,
                      "login": "inspect-js"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "83 public repos, account ~6 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 83
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 6
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "moderate",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 53,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 1661
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 1661 days ago",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "1 published versions",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "moderate",
        "name": "Engineering Quality",
        "value": 68,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "good",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 80,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": true,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "5 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": ".eslintrc",
                "points": 16,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "node",
                "symlink",
                "flag",
                "symlinks",
                "preserve-symlinks"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "5 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 52,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 15,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 3,
              "scorecard_aggregate": 4
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection is not maximal on development and all release branches",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 1 resolved dependencies against OSV; 9 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 1
                }
              },
              {
                "code": "advisories_unassessed",
                "params": {
                  "count": 9
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 1,
              "unassessed_packages": 9,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 1,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 10
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 29,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": true,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": ".eslintrc",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 737,
              "source_files_sampled": 3,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/3 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 3,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T16:30:25.610322Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/i/inspect-js/node-supports-preserve-symlinks-flag.svg",
  "full_name": "inspect-js/node-supports-preserve-symlinks-flag",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.

Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.26.0 — full methodology · metrics wiki.

How one result sits in the wider record: aggregate statisticsnpm.