Determine if the current node version supports the `--preserve-symlinks` flag.
inspect-js/node-supports-preserve-symlinks-flag holds a health index of 41 out of 100, placing it in the Weak band. It scores highest on Engineering Quality (68/100) and lowest on Vitality (13/100). It was last updated 1371 days ago. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 44 is calibrated to 41 on the published index scale (record calibration 2026-08-02).
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | supports-preserve-symlinks-flag | 1.0.0 | 485,744,498 | 1 | 1674 days ago | nodeflagsymlinksymlinkspreserve-symlinks |
Is the project alive — is code being written and are releases shipping?
| 0/36 | Push recency — last push 1,371 days ago |
| 0/36 | Commit cadence — 0/52 weeks with commits |
| 0/18 | Commit volume — 0 commits in the last year |
| 0/10 | OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0 |
| commits_last_year | 0 |
| human_commit_share | — |
| days_since_last_push | 1,371 |
| active_weeks_last_year | 0 |
| 16.2/27 | Ships releases — 1 version tags (no GitHub releases) |
| 0/36 | Release recency — latest release 1,674 days ago |
| 12.6/27 | Release cadence — cadence unknown (single release) |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
| releases_count | 1 |
| latest_release_tag | v1.0.0 |
| releases_from_tags | yes |
| days_since_latest_release | 1,674 |
| mean_days_between_releases | — |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 0/60 | Stars — 1 stars |
| 4/25 | Forks — 4 forks |
| 0/15 | Watchers — 1 watchers |
| forks | 4 |
| stars | 1 |
| watchers | 1 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 18/18 | CONTRIBUTING guide |
| 13.5/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | 0 |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | yes |
| readme_badge_services | — |
| has_pull_request_template | no |
| 80/80 | Monthly downloads — 485,744,498 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | supports-preserve-symlinks-flag |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 485,744,498 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0/22.5 | Commit distribution — top contributor authored 100% of commits |
| 1.4/13.5 | Contributor breadth — 1 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 31 contributing companies or organizations |
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
| 0/42 | Issue resolution — 0% of issues closed |
| 0/30 | PR acceptance — no decided pull requests or no data |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/17 approved changesets -- score normalized to 0 |
| merged_prs | 0 |
| open_issues | 1 |
| closed_issues | 0 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 0 |
| prs_decided_30d | 0 |
| issue_closed_ratio | 0 |
| closed_unmerged_prs | 0 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
| 30/30 | Ownership backing — organization-owned |
| 0/20 | Verified domain — verified-domain status not read for this organization |
| 12.5/25 | Owner reach — 54 followers of inspect-js |
| 25/25 | Track record — 83 public repos, account ~6 yr old |
| followers | 54 |
| owner_type | Organization |
| is_verified | — |
| owner_login | inspect-js |
| public_repos | 83 |
| account_age_days | 2,548 |
| 25/25 | Published & resolvable — 1 package(s) on npm |
| 4/35 | Publish recency — latest publish 1,674 days ago |
| 4/20 | Version history — 1 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | supports-preserve-symlinks-flag |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 1,674 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 5 workflow(s) |
| 24/24 | Tests present |
| 16/16 | Linter config — .eslintrc |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | yes |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 10/10 | Topics — 5 topics |
| 0/10 | Wiki |
| topics | node, symlink, flag, symlinks, preserve-symlinks |
| has_wiki | no |
| homepage | — |
| docs_site | — |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — no data |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/17 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 31 contributing companies or organizations |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 0/7.5 | Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| 0/5 | SAST — no SAST tool detected |
| 5/5 | Security-Policy — security policy file detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 14 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 4 |
| scorecard_aggregate | 4.2 |
| 35/35 | Direct dependencies free of known advisories — no direct dependency carries a known advisory |
| 0/25 | Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope |
| 0/40 | No advisories left outstanding — no advisory carries a publication date |
| source | osv |
| advisories | 0 |
| affected_packages | 0 |
| assessed_packages | 1 |
| unassessed_packages | 9 |
| affected_by_severity | none |
| direct_affected_packages | 0 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 0/40 | Legible commit history — no data |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | One-command bootstrap |
| 22/22 | Automated tests |
| 11/11 | Lint / format config — .eslintrc |
| 0/11 | Static type checking |
| 0/10 | Reproducible environment |
| 0/10 | Demonstrated agent practice — no data |
| 0/8 | Automated maintenance — no data |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0 |
| has_nix | no |
| has_tests | yes |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | yes |
| typecheck_configs | — |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 0/45 | Type-checkable code — JavaScript without a type-check config |
| 55/55 | Manageable file sizes — 0/3 source files over 60KB |
| primary_language | JavaScript |
| largest_source_bytes | 737 |
| source_files_sampled | 3 |
| oversized_source_files | 0 |
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Each point covers 4 days.
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| n/a | Branch-Protection | internal error: error during branchesHandler.setup: internal error: some github tokens can't read classic branch protection rules: https://github.com/ossf/scorecard-action/blob/main/docs/authentication/fine-grained-auth-token.md |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/17 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 31 contributing companies or organizations |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 0 | Maintained | 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0 |
| n/a | Packaging | packaging workflow not detected |
| 0 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 0 |
| 0 | SAST | no SAST tool detected |
| 10 | Security-Policy | security policy file detected |
| n/a | Signed-Releases | no releases found |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Full resolved dependency set from the GitHub dependency graph: 0 direct and 10 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|---|---|---|
| npm | @ljharb/eslint-config | ^21.0.0 | indirect |
| npm | aud | ^2.0.1 | indirect |
| npm | auto-changelog | ^2.4.0 | indirect |
| npm | eslint | 8.8.0 | indirect |
| npm | in-publish | ^2.0.1 | indirect |
| npm | npmignore | ^0.3.0 | indirect |
| npm | nyc | ^10.3.2 | indirect |
| npm | safe-publish-latest | ^2.0.0 | indirect |
| npm | semver | ^6.3.0 | indirect |
| npm | tape | ^5.6.1 | indirect |
This repository publishes no package the index resolves, so its own dependency graph was assessed — 1 packages, which also include development and test pins that never ship: 0 carry known advisories, of which 0 are direct. 9 could not be assessed — no resolved version, an unsupported ecosystem, or beyond the reported package list.
No known advisories affect the assessed dependencies.
An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.31.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm.