Публічний реєстр
Звіт про здоров'я програмного забезпеченнясхема 0.26.0 · метрики 1.13.0 · 2026-07-22 16:30 UTC

inspect-js / node-supports-preserve-symlinks-flag

Determine if the current node version supports the `--preserve-symlinks` flag.

JavaScriptMIT★ 1 зірка⑂ 4 форкиз січ. 2022 р.Переглянути на GitHub ↗

inspect-js/node-supports-preserve-symlinks-flag має індекс здоров’я 43 зі 100, що відповідає смузі «У зоні ризику». Найвищий показник — Engineering Quality (68/100), найнижчий — Vitality (13/100). Останнє оновлення було 1358 днів тому. Більшість нещодавньої роботи виконує один учасник.

43
загалом / 100
У зоні ризику

Індекс здоров'я програмного забезпечення

Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.

43
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
ЖиттєздатністьСпільнота тавпровадженняСталість таврядуванняІнженернаякістьБезпекаГотовність доШІ

Профіль оцінок

Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.

Власність

Inspect JSОрганізація
54 підписники83 публічні репозиторіїз серп. 2019 р.

За цим репозиторієм стоїть організація — спільна, підзвітна опіка, здатна пережити будь-якого окремого мейнтейнера.

Пакетні екосистеми

РеєстрПакетВерсіяЗавантажень / місВерсіїОстання публікаціяТеги
npmsupports-preserve-symlinks-flag1.0.0486 692 31911661 день томуnodeflagsymlinksymlinkspreserve-symlinks

Метрики за категоріями

Життєздатність

Чи живий проєкт — чи пишеться код і чи виходять релізи?

13Критичний · 22% загального індексу
Як обчислюється оцінка
0/36Свіжість push — останній push 1 358 дн. тому
0/36Ритм комітів — 0/52 тижнів із комітами
0/18Обсяг комітів — 0 комітів за останній рік
0/10OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
Використані вхідні дані
commits_last_year0
human_commit_share
days_since_last_push1 358
active_weeks_last_year0

Дисципліна релізів

32У зоні ризику
Як обчислюється оцінка
16.2/27Випускає релізи — 1 тегів версій (без релізів GitHub)
0/36Свіжість релізів — останній реліз 1 661 дн. тому
12.6/27Ритм релізів — ритм невідомий (єдиний реліз)
0/10OpenSSF Scorecard: Signed-Releases — немає даних
Використані вхідні дані
releases_count1
latest_release_tagv1.0.0
releases_from_tagsтак
days_since_latest_release1 661
mean_days_between_releases
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Signed-Releases. Залишкові ваги перенормовано.

Спільнота та впровадження

Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?

56Помірний · 18% загального індексу
Як обчислюється оцінка
0/60Зірки — 1 зірок
4/25Форки — 4 форків
0/15Спостерігачі — 1 спостерігачів
Використані вхідні дані
forks4
stars1
watchers1
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Як обчислюється оцінка
22.5/22.5README
22.5/22.5Ліцензія — визнана ліцензія (MIT)
18/18Настанови CONTRIBUTING
13.5/13.5Кодекс поведінки
0/7.2Шаблон issue
0/6.3Шаблон PR
Використані вхідні дані
has_readmeтак
has_licenseтак
has_contributingтак
has_issue_templateні
has_code_of_conductтак
has_pull_request_templateні
Як обчислюється оцінка
80/80Щомісячні завантаження — 486 692 319 завантажень/місяць у npm
0/20Залежні пакети в реєстрі — ця екосистема цього не повідомляє
Використані вхідні дані
packagessupports-preserve-symlinks-flag
dependents
ecosystemsnpm
total_downloads
monthly_downloads486 692 319
Виключено з оцінювання (немає даних або не застосовно): Залежні пакети в реєстрі. Залишкові ваги перенормовано.

Сталість та врядування

Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?

34У зоні ризику · 24% загального індексу
Як обчислюється оцінка
9/54Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів
0/22.5Розподіл комітів — головний контриб’ютор — автор 100% комітів
1.4/13.5Широта контриб’юторів — 1 контриб’юторів
10/10OpenSSF Scorecard: Contributors — project has 31 contributing companies or organizations
Використані вхідні дані
bus_factor1
contributors_sampled1
top_contributor_share1
Як обчислюється оцінка
0/46.8Вирішення issue — закрито 0% issue
0/38.3Прийняття PR — немає вирішених pull request-ів або даних
0/15OpenSSF Scorecard: Code-Review — Found 0/17 approved changesets -- score normalized to 0
Використані вхідні дані
merged_prs0
open_issues1
closed_issues0
issue_closed_ratio0
closed_unmerged_prs0
Виключено з оцінювання (немає даних або не застосовно): Прийняття PR. Залишкові ваги перенормовано.
Як обчислюється оцінка
30/30Підтримка власника — у власності організації
0/20Верифікований домен
12.5/25Охоплення власника — 54 підписників у inspect-js
25/25Послужний список — 83 публічних репозиторіїв, вік облікового запису ~6 р.
Використані вхідні дані
followers54
owner_typeOrganization
is_verified
owner_logininspect-js
public_repos83
account_age_days2 535
Як обчислюється оцінка
25/25Опубліковано й доступно — 1 пакет(ів) у npm
4/35Свіжість публікацій — остання публікація 1 661 дн. тому
4/20Історія версій — 1 опублікованих версій
20/20Не застарілий — активний, не deprecated і не yanked
Використані вхідні дані
packagessupports-preserve-symlinks-flag
ecosystemsnpm
any_deprecatedні
min_days_since_publish1 661

Інженерна якість

Чи наявні базові інженерні практики та документація?

68Помірний · 20% загального індексу
Як обчислюється оцінка
24/24Процеси CI — 5 процес(ів) CI
24/24Наявні тести
16/16Конфігурація лінтера — .eslintrc
0/9.6Pre-commit-хуки
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — немає даних
Використані вхідні дані
has_ciтак
has_testsтак
has_editorconfigні
has_linter_configтак
has_precommit_configні
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: CI-Tests. Залишкові ваги перенормовано.

Документація

50Помірний
Як обчислюється оцінка
30/30README
0/25Каталог документації
0/15Сайт документації / домашня сторінка
10/10Опис репозиторію
10/10Теми — 5 тем
0/10Wiki
Використані вхідні дані
topicsnode, symlink, flag, symlinks, preserve-symlinks
has_wikiні
homepage
has_readmeтак
has_docs_dirні
has_descriptionтак

Безпека

Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?

52Помірний · 16% загального індексу

Стан безпеки

40У зоні ризику
Як обчислюється оцінка
7.5/7.5Binary-Artifacts — no binaries found in the repo
0.8/7.5Branch-Protection — branch protection is not maximal on development and all release branches
0/2.5CI-Tests — немає даних
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/17 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 31 contributing companies or organizations
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Ліцензія — license file detected
0/7.5Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
0/5Packaging — немає даних
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — no SAST tool detected
5/5Security-Policy — security policy file detected
0/7.5Signed-Releases — немає даних
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Використані вхідні дані
sourceopenssf_scorecard
checks_evaluated15
scorecard_versionv5.5.0
checks_inconclusive3
scorecard_aggregate4
Виключено з оцінювання (немає даних або не застосовно): ci_tests, packaging, signed_releases. Залишкові ваги перенормовано.
Як обчислюється оцінка
35/35Прямі залежності без відомих сповіщень — жодна пряма залежність не має відомих сповіщень
0/25Непрямі залежності без відомих сповіщень — транзитивний набір не відокремлюється від залежностей розробки й тестування в цьому обсязі
0/40Немає задавнених сповіщень — жодне сповіщення не має дати публікації
Використані вхідні дані
sourceosv
advisories0
affected_packages0
assessed_packages1
unassessed_packages9
affected_by_severitynone
direct_affected_packages0
Виключено з оцінювання (немає даних або не застосовно): Непрямі залежності без відомих сповіщень, Немає задавнених сповіщень. Залишкові ваги перенормовано. Звірено 1 резолвлених залежностей із OSV. 9 не вдалося оцінити — немає резолвленої версії, непідтримувана екосистема або поза межами звітованого переліку пакетів. Цей репозиторій не публікує пакета, який резолвить індекс, тож натомість оцінено граф залежностей репозиторію. Цей граф змішує закріплені версії для розробки й тестування зі справді постачаними залежностями, тож оцінюються лише задекларовані runtime-залежності; транзитивні знахідки подаються як контекст і в оцінку не входять. Досяжність не аналізується.

Готовність до ШІ

Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.

29Критичний · 0% загального індексу
Як обчислюється оцінка
0/45Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора
0/15Машиночитана документація (llms.txt)
0/40Читабельна історія комітів — немає даних
Використані вхідні дані
has_llms_txtні
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Виключено з оцінювання (немає даних або не застосовно): Читабельна історія комітів. Залишкові ваги перенормовано.
Як обчислюється оцінка
0/18Розгортання однією командою
22/22Автоматизовані тести
11/11Конфігурація лінтера / форматера — .eslintrc
0/11Статична перевірка типів
0/10Відтворюване середовище
0/10Підтверджена практика роботи з агентами — немає даних
0/8Автоматизоване супроводження — немає даних
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Використані вхідні дані
has_nixні
has_testsтак
lockfiles
has_dockerfileні
typed_languageні
bootstrap_files
has_devcontainerні
has_linter_configтак
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Виключено з оцінювання (немає даних або не застосовно): Підтверджена практика роботи з агентами, Автоматизоване супроводження. Залишкові ваги перенормовано.
Як обчислюється оцінка
0/45Типізований код — JavaScript без конфігурації перевірки типів
55/55Керовані розміри файлів — 0/3 файлів вихідного коду понад 60 КБ
Використані вхідні дані
primary_languageJavaScript
largest_source_bytes737
source_files_sampled3
oversized_source_files0

Ключові факти

1зірок GitHub
1контриб'юторів
0комітів за останні 12 місяців
1 358днів від останнього пушу
1релізів
1бас-фактор
1відкритих issue
npmпакетних екосистем

Попередження щодо збору даних

  • Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token

Докладніше

Історія зірок і форків 0 ★ / 4 ⇿
0Зірки
4Форки

Коли додано кожну зірку й форк — зібрано з GitHub і згруповано за днями. Кумулятивне зростання розміщено просто над денними додаваннями, з яких воно складається, тож їх видно одне проти одного: рівномірне органічне накопичення виглядає зовсім інакше, ніж різкий короткочасний сплеск. Там, де цю різницю можна виміряти, її подано як автентичність росту.

1223344412022-042024-042026-05

Кожна точка охоплює 4 днів.

OpenSSF Scorecard 4.0 / 10
4.0сукупно

Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).Scorecard v5.5.0 · 2026-07-22 16:30 UTC

10Binary-Artifactsno binaries found in the repo
1Branch-Protectionbranch protection is not maximal on development and all release branches
н/дCI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/17 approved changesets -- score normalized to 0
10Contributorsproject has 31 contributing companies or organizations
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintained0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
н/дPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTno SAST tool detected
10Security-Policysecurity policy file detected
н/дSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Усі залежності 10

Повний розв'язаний набір залежностей із графа залежностей GitHub: 0 прямих і 10 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.

РеєстрПакетВерсіяЗв'язок
npm@ljharb/eslint-config^21.0.0непряма
npmaud^2.0.1непряма
npmauto-changelog^2.4.0непряма
npmeslint8.8.0непряма
npmin-publish^2.0.1непряма
npmnpmignore^0.3.0непряма
npmnyc^10.3.2непряма
npmsafe-publish-latest^2.0.0непряма
npmsemver^6.3.0непряма
npmtape^5.6.1непряма
Сповіщення про залежності 0

Цей репозиторій не публікує пакета, який розпізнає індекс, тож оцінено його власний граф залежностей — 1 пакетів, серед яких є й піниї розробки та тестування, що ніколи не постачаються: 0 мають відомі сповіщення, з них 0 прямі. 9 не вдалося оцінити — немає резолвленої версії, непідтримувана екосистема або поза наведеним переліком пакетів.

Жодне відоме сповіщення не стосується оцінених залежностей.

Сповіщення означає, що версія, записана в графі залежностей, потрапляє в уражений діапазон. Досяжність не аналізується, а граф містить піниї розробки й тестування — знахідка може стосуватися інструментів, а не поставленого коду.

Звіт у форматі JSON машиночитний
{
  "data": {
    "repo": {
      "topics": [
        "node",
        "symlink",
        "flag",
        "symlinks",
        "preserve-symlinks"
      ],
      "is_fork": false,
      "size_kb": 24,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 1068
      },
      "pushed_at": "2022-11-02T16:24:38Z",
      "created_at": "2022-01-03T07:06:47Z",
      "owner_type": "Organization",
      "updated_at": "2023-12-25T03:55:36Z",
      "description": "Determine if the current node version supports the `--preserve-symlinks` flag.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript"
      ]
    },
    "owner": {
      "blog": null,
      "name": "Inspect JS",
      "type": "Organization",
      "login": "inspect-js",
      "company": null,
      "location": null,
      "followers": 54,
      "avatar_url": "https://avatars.githubusercontent.com/u/54056128?v=4",
      "created_at": "2019-08-13T06:36:36Z",
      "is_verified": null,
      "public_repos": 83,
      "account_age_days": 2535
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2022-01-03T07:21:44Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] use `npmignore` to autogenerate an npmignore file",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:22:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c406260b8be8a6d7a30a37f9f6da84ed4c0e132e",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@ljharb/eslint-config`, `aud`, `tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:21:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7188768d2a65934b104ffd77102c533dc038d7bf",
          "body": null,
          "is_bot": false,
          "headline": "[actions] update rebase action to use reusable workflow",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:19:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34761bea1f1ff0815e8b3515d1463357b03b9be2",
          "body": "…ngelog`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `eslint`, `@ljharb/eslint-config`, `aud`, `auto-cha…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T04:00:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "be98485fb667bbe3f2b36454cfa725f1e8f8cb8e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] fix FUNDING.yml",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T03:59:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f7cac19c0c298cf40b3f2f3c735477ad579ac61",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.0",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:21:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c9afa9fabc8eaf0814aaed6dd01e6df0931b76d",
          "body": null,
          "is_bot": false,
          "headline": "read me",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:10:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5ef77f7cb6946d16ee38672be9ec0f1bbdf63262",
          "body": null,
          "is_bot": false,
          "headline": "[meta] do not publish workflow files",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "600223ba24f30779f209d9097721eff35ed62741",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `sideEffects` flag",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c476ae1ed7ce68b0480344f090ac2844f35509d",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `auto-changelog`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:54:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2bb23b3ebab02dc4135c4cdf0217db82835b9fca",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `safe-publish-latest`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e2f59ad74e2ae0f5f4899fcde6a6f693ab7cc074",
          "body": null,
          "is_bot": false,
          "headline": "Tests",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2f9892546396d4ab0ad9f1ff83e76c3f01234ae8",
          "body": null,
          "is_bot": false,
          "headline": "Initial implementation",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:45:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d0fffc886d25fba119355520750a909d64da0087",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] add `eslint`, `@ljharb/eslint-config`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:41:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ab318ed7ae62f6c2c0e80a50398d40912afd8f69",
          "body": null,
          "is_bot": false,
          "headline": "Only apps should have lockfiles",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "992b068503a461f7e8676f40ca2aab255fd8d6ff",
          "body": null,
          "is_bot": false,
          "headline": "npm init",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dc222aad3c0b940d8d3af1ca9937d108bd2dc4b9",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:06:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 1,
      "commits_last_year": 0,
      "latest_release_at": "2022-01-03T07:21:44Z",
      "latest_release_tag": "v1.0.0",
      "releases_from_tags": true,
      "days_since_last_push": 1358,
      "active_weeks_last_year": 0,
      "days_since_latest_release": 1661,
      "mean_days_between_releases": null
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": true,
      "health_percentage": 75,
      "has_issue_template": false,
      "has_code_of_conduct": true,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "supports-preserve-symlinks-flag",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "node",
            "flag",
            "symlink",
            "symlinks",
            "preserve-symlinks"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/supports-preserve-symlinks-flag",
          "is_deprecated": false,
          "latest_version": "1.0.0",
          "repository_url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
          "versions_count": 1,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 486692319,
          "first_published_at": "2022-01-03T07:22:56.474000Z",
          "latest_published_at": "2022-01-03T07:22:56.640000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 1661
        }
      ]
    },
    "popularity": {
      "forks": 4,
      "stars": 1,
      "watchers": 1,
      "fork_history": {
        "days": [
          {
            "date": "2022-04-08",
            "count": 1
          },
          {
            "date": "2023-12-25",
            "count": 1
          },
          {
            "date": "2024-01-19",
            "count": 1
          },
          {
            "date": "2026-05-03",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 4,
        "total_forks": 4
      },
      "star_history": null,
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "toolchain_manifests": [],
      "largest_source_bytes": 737,
      "source_files_sampled": 3,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 1,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 9,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@ljharb/eslint-config",
            "direct": false,
            "version": "^21.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "aud",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "auto-changelog",
            "direct": false,
            "version": "^2.4.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint",
            "direct": false,
            "version": "8.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "in-publish",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "npmignore",
            "direct": false,
            "version": "^0.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "nyc",
            "direct": false,
            "version": "^10.3.2",
            "ecosystem": "npm"
          },
          {
            "name": "safe-publish-latest",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "semver",
            "direct": false,
            "version": "^6.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "tape",
            "direct": false,
            "version": "^5.6.1",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 10,
        "direct_count": 0,
        "indirect_count": 10
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 0,
        "open_issues": 1,
        "closed_ratio": 0,
        "closed_issues": 0,
        "closed_unmerged_prs": 0
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "ljharb",
          "commits": 17,
          "avatar_url": "https://avatars.githubusercontent.com/u/45469?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "node-aught.yml",
        "node-pretest.yml",
        "node-tens.yml",
        "rebase.yml",
        "require-allow-edits.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [
        ".eslintrc"
      ],
      "has_editorconfig": false,
      "has_linter_config": true,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 1,
            "reason": "branch protection is not maximal on development and all release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/17 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 31 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 10,
            "reason": "security policy file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
        "ran_at": "2026-07-22T16:30:20Z",
        "aggregate_score": 4,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-22T05:24:47Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": null,
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": [
        {
          "number": 1,
          "created_at": "2022-01-03T07:06:53Z",
          "last_comment_at": null,
          "last_comment_author": null
        }
      ]
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
    "host": "github.com",
    "name": "node-supports-preserve-symlinks-flag",
    "owner": "inspect-js"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 43,
      "inputs": {
        "security": 52,
        "vitality": 13,
        "community": 56,
        "governance": 34,
        "engineering": 68
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "critical",
        "name": "Vitality",
        "value": 13,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "critical",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "commits_last_year": 0,
              "human_commit_share": null,
              "days_since_last_push": 1358,
              "active_weeks_last_year": 0
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 1358 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 1358
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "0/52 weeks with commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "0 commits in the last year",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "at_risk",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 32,
            "inputs": {
              "releases_count": 1,
              "latest_release_tag": "v1.0.0",
              "releases_from_tags": true,
              "days_since_latest_release": 1661,
              "mean_days_between_releases": null
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "1 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 1661 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "cadence unknown (single release)",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence_unknown",
                    "params": {}
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "dormant",
              "guards": [
                "no_open_demand",
                "dependencies_clean"
              ],
              "signals": [
                "scorecard_unmaintained"
              ],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": 0,
              "unanswered_open_issues": 1,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 1358,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "no human commit for 1358 days, with nothing left unanswered; held at dormant by nothing open to answer, no affected dependency",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_quiet",
                    "params": {
                      "days": 1358
                    }
                  },
                  {
                    "code": "abandonment_guarded",
                    "params": {
                      "guards": "nothing open to answer, no affected dependency"
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 56,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 4,
            "inputs": {
              "forks": 4,
              "stars": 1,
              "watchers": 1,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "4 forks",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "1 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "excellent",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 85,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": true,
              "has_issue_template": false,
              "has_code_of_conduct": true,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 18,
                "status": "met",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 13.5,
                "status": "met",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "excellent",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 486692319
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "486,692,319 downloads/month across npm",
                "points": 80,
                "status": "met",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 486692319,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 34,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "pr_acceptance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 1,
              "closed_issues": 0,
              "issue_closed_ratio": 0,
              "closed_unmerged_prs": 0
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "0% of issues closed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 0
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "no decided pull requests or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_decided_prs_or_data",
                    "params": {}
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "followers": 54,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "inspect-js",
              "public_repos": 83,
              "account_age_days": 2535
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "54 followers of inspect-js",
                "points": 12.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 54,
                      "login": "inspect-js"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "83 public repos, account ~6 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 83
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 6
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "moderate",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 53,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 1661
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 1661 days ago",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "1 published versions",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "moderate",
        "name": "Engineering Quality",
        "value": 68,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "good",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 80,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": true,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "5 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": ".eslintrc",
                "points": 16,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "node",
                "symlink",
                "flag",
                "symlinks",
                "preserve-symlinks"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "5 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 52,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 15,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 3,
              "scorecard_aggregate": 4
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection is not maximal on development and all release branches",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 1 resolved dependencies against OSV; 9 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 1
                }
              },
              {
                "code": "advisories_unassessed",
                "params": {
                  "count": 9
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 1,
              "unassessed_packages": 9,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 1,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 10
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 29,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": true,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": ".eslintrc",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 737,
              "source_files_sampled": 3,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/3 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 3,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T16:30:25.610322Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/i/inspect-js/node-supports-preserve-symlinks-flag.svg",
  "full_name": "inspect-js/node-supports-preserve-symlinks-flag",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.

Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.26.0 — повна методологія · вікі метрик.

Як окремий результат виглядає на тлі всього реєстру: сукупна статистикаnpm.