Registro público
Informe de salud del softwareesquema 0.26.0 · métricas 1.13.0 · 2026-07-22 16:30 UTC

inspect-js / node-supports-preserve-symlinks-flag

Determine if the current node version supports the `--preserve-symlinks` flag.

JavaScriptMIT★ 1 estrella⑂ 4 forksdesde ene 2022Ver en GitHub ↗

inspect-js/node-supports-preserve-symlinks-flag tiene un índice de salud de 43 sobre 100, lo que lo sitúa en la banda En riesgo. Su puntuación más alta es Engineering Quality (68/100) y la más baja, Vitality (13/100). Se actualizó por última vez hace 1358 días. Una sola persona concentra la mayor parte del trabajo reciente.

43
global / 100
En riesgo

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

43
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

Inspect JSOrganización
54 seguidores83 repositorios públicosdesde ago 2019

Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
npmsupports-preserve-symlinks-flag1.0.0486.692.3191hace 1661 díasnodeflagsymlinksymlinkspreserve-symlinks

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

13Crítico · 22% del índice global
Cómo se puntúa
0/36Recencia de push — último push hace 1358 días
0/36Cadencia de commits — 0/52 semanas con commits
0/18Volumen de commits — 0 commits en el último año
0/10OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
Datos de entrada utilizados
commits_last_year0
human_commit_share
days_since_last_push1358
active_weeks_last_year0
Cómo se puntúa
16.2/27Publica versiones — 1 etiquetas de versión (sin releases de GitHub)
0/36Recencia de las versiones — última versión hace 1661 días
12.6/27Cadencia de publicación — cadencia desconocida (una sola versión)
0/10OpenSSF Scorecard: Signed-Releases — sin datos
Datos de entrada utilizados
releases_count1
latest_release_tagv1.0.0
releases_from_tags
days_since_latest_release1661
mean_days_between_releases
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

56Moderado · 18% del índice global
Cómo se puntúa
0/60Estrellas — 1 estrellas
4/25Forks — 4 forks
0/15Observadores — 1 observadores
Datos de entrada utilizados
forks4
stars1
watchers1
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Cómo se puntúa
22.5/22.5README
22.5/22.5Licencia — licencia reconocida (MIT)
18/18Guía CONTRIBUTING
13.5/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributing
has_issue_templateno
has_code_of_conduct
has_pull_request_templateno
Cómo se puntúa
80/80Descargas mensuales — 486.692.319 descargas/mes en npm
0/20Dependientes en el registro — no lo informa este ecosistema
Datos de entrada utilizados
packagessupports-preserve-symlinks-flag
dependents
ecosystemsnpm
total_downloads
monthly_downloads486.692.319
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

34En riesgo · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
0/22.5Distribución de commits — el principal contribuyente firma el 100% de los commits
1.4/13.5Amplitud de contribuyentes — 1 contribuyentes
10/10OpenSSF Scorecard: Contributors — project has 31 contributing companies or organizations
Datos de entrada utilizados
bus_factor1
contributors_sampled1
top_contributor_share1
Cómo se puntúa
0/46.8Resolución de issues — 0% de issues cerradas
0/38.3Aceptación de PR — sin PR decididos o sin datos
0/15OpenSSF Scorecard: Code-Review — Found 0/17 approved changesets -- score normalized to 0
Datos de entrada utilizados
merged_prs0
open_issues1
closed_issues0
issue_closed_ratio0
closed_unmerged_prs0
Excluidos de la puntuación (sin datos o no aplicable): Aceptación de PR. Los pesos restantes se han renormalizado.
Cómo se puntúa
30/30Respaldo de la propiedad — propiedad de una organización
0/20Dominio verificado
12.5/25Alcance del propietario — 54 seguidores de inspect-js
25/25Trayectoria — 83 repos públicos, cuenta de ~6 años
Datos de entrada utilizados
followers54
owner_typeOrganization
is_verified
owner_logininspect-js
public_repos83
account_age_days2535
Cómo se puntúa
25/25Publicado y resoluble — 1 paquete(s) en npm
4/35Recencia de publicación — última publicación hace 1661 días
4/20Historial de versiones — 1 versiones en el registro
20/20No obsoleto — activo, ni obsoleto ni retirado
Datos de entrada utilizados
packagessupports-preserve-symlinks-flag
ecosystemsnpm
any_deprecatedno
min_days_since_publish1661

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

68Moderado · 20% del índice global
Cómo se puntúa
24/24Flujos de trabajo de CI — 5 flujo(s) de trabajo
24/24Pruebas presentes
16/16Configuración de linter — .eslintrc
0/9.6Hooks de pre-commit
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — sin datos
Datos de entrada utilizados
has_ci
has_tests
has_editorconfigno
has_linter_config
has_precommit_configno
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: CI-Tests. Los pesos restantes se han renormalizado.

Documentación

50Moderado
Cómo se puntúa
30/30README
0/25Directorio de documentación
0/15Sitio de documentación / página del proyecto
10/10Descripción del repositorio
10/10Topics — 5 topics
0/10Wiki
Datos de entrada utilizados
topicsnode, symlink, flag, symlinks, preserve-symlinks
has_wikino
homepage
has_readme
has_docs_dirno
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

52Moderado · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
0.8/7.5Branch-Protection — branch protection is not maximal on development and all release branches
0/2.5CI-Tests — sin datos
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/17 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 31 contributing companies or organizations
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Licencia — license file detected
0/7.5Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
0/5Packaging — sin datos
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — no SAST tool detected
5/5Security-Policy — security policy file detected
0/7.5Signed-Releases — sin datos
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated15
scorecard_versionv5.5.0
checks_inconclusive3
scorecard_aggregate4
Excluidos de la puntuación (sin datos o no aplicable): ci_tests, packaging, signed_releases. Los pesos restantes se han renormalizado.
Cómo se puntúa
35/35Dependencias directas libres de avisos conocidos — ninguna dependencia directa tiene un aviso conocido
0/25Dependencias indirectas libres de avisos conocidos — el conjunto transitivo no es separable de las dependencias de desarrollo y prueba en este alcance
0/40Sin avisos pendientes — ningún aviso tiene fecha de publicación
Datos de entrada utilizados
sourceosv
advisories0
affected_packages0
assessed_packages1
unassessed_packages9
affected_by_severitynone
direct_affected_packages0
Excluidos de la puntuación (sin datos o no aplicable): Dependencias indirectas libres de avisos conocidos, Sin avisos pendientes. Los pesos restantes se han renormalizado. Se cotejaron 1 dependencias resueltas con OSV. 9 no pudieron evaluarse: sin versión resuelta, ecosistema no admitido o fuera de la lista de paquetes informada. Este repositorio no publica ningún paquete que el índice resuelva, por lo que se evaluó en su lugar el grafo de dependencias del repositorio. Ese grafo mezcla fijaciones de desarrollo y prueba con las dependencias distribuidas, de modo que solo se puntúan las dependencias declaradas en tiempo de ejecución; los hallazgos transitivos se informan como contexto y quedan excluidos de la puntuación. No se analiza la alcanzabilidad.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

29Crítico · 0% del índice global
Cómo se puntúa
0/45Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor
0/15Documentación legible por máquinas (llms.txt)
0/40Historial de commits legible — sin datos
Datos de entrada utilizados
has_llms_txtno
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Excluidos de la puntuación (sin datos o no aplicable): Historial de commits legible. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/18Arranque con un solo comando
22/22Pruebas automatizadas
11/11Configuración de lint / formato — .eslintrc
0/11Verificación estática de tipos
0/10Entorno reproducible
0/10Práctica demostrada con agentes — sin datos
0/8Mantenimiento automatizado — sin datos
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Datos de entrada utilizados
has_nixno
has_tests
lockfiles
has_dockerfileno
typed_languageno
bootstrap_files
has_devcontainerno
has_linter_config
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Excluidos de la puntuación (sin datos o no aplicable): Práctica demostrada con agentes, Mantenimiento automatizado. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/45Código verificable por tipos — JavaScript sin configuración de verificación de tipos
55/55Tamaños de archivo manejables — 0/3 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languageJavaScript
largest_source_bytes737
source_files_sampled3
oversized_source_files0

Datos clave

1estrellas de GitHub
1contribuidores
0commits en los últimos 12 meses
1358días desde el último push
1versiones publicadas
1factor bus
1issues abiertas
npmecosistemas de paquetes

Advertencias de recopilación de datos

  • Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token

Más detalle

Historial de estrellas y forks 0 ★ / 4 ⇿
0Estrellas
4Forks

Cuándo se añadió cada estrella y fork, recopilado de GitHub y agrupado por día. El crecimiento acumulado se sitúa justo encima de las adiciones diarias que lo componen, de modo que ambos se leen en conjunto: la acumulación orgánica sostenida no se parece en nada a un pico abrupto y efímero. Cuando esa diferencia es medible, se informa como autenticidad del crecimiento.

1223344412022-042024-042026-05

Cada punto abarca 4 días.

OpenSSF Scorecard 4.0 / 10
4.0agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-22 16:30 UTC

10Binary-Artifactsno binaries found in the repo
1Branch-Protectionbranch protection is not maximal on development and all release branches
n/dCI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/17 approved changesets -- score normalized to 0
10Contributorsproject has 31 contributing companies or organizations
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintained0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
n/dPackagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTno SAST tool detected
10Security-Policysecurity policy file detected
n/dSigned-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Todas las dependencias 10

Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 0 paquetes directos y 10 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.

RegistroPaqueteVersiónRelación
npm@ljharb/eslint-config^21.0.0indirecta
npmaud^2.0.1indirecta
npmauto-changelog^2.4.0indirecta
npmeslint8.8.0indirecta
npmin-publish^2.0.1indirecta
npmnpmignore^0.3.0indirecta
npmnyc^10.3.2indirecta
npmsafe-publish-latest^2.0.0indirecta
npmsemver^6.3.0indirecta
npmtape^5.6.1indirecta
Avisos de dependencias 0

Este repositorio no publica ningún paquete que el índice resuelva, así que se evaluó su propio grafo de dependencias — 1 paquetes, que incluyen también fijaciones de desarrollo y prueba que nunca se distribuyen: 0 tienen avisos conocidos, de los cuales 0 son directas. 9 no pudieron evaluarse: sin versión resuelta, ecosistema no admitido, o fuera de la lista de paquetes informada.

Ningún aviso conocido afecta a las dependencias evaluadas.

Un aviso significa que la versión registrada en el grafo de dependencias cae dentro del rango afectado de un aviso. No se analiza la alcanzabilidad, y el grafo incluye fijaciones de desarrollo y prueba: un hallazgo puede referirse al utillaje y no al software distribuido.

Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [
        "node",
        "symlink",
        "flag",
        "symlinks",
        "preserve-symlinks"
      ],
      "is_fork": false,
      "size_kb": 24,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 1068
      },
      "pushed_at": "2022-11-02T16:24:38Z",
      "created_at": "2022-01-03T07:06:47Z",
      "owner_type": "Organization",
      "updated_at": "2023-12-25T03:55:36Z",
      "description": "Determine if the current node version supports the `--preserve-symlinks` flag.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript"
      ]
    },
    "owner": {
      "blog": null,
      "name": "Inspect JS",
      "type": "Organization",
      "login": "inspect-js",
      "company": null,
      "location": null,
      "followers": 54,
      "avatar_url": "https://avatars.githubusercontent.com/u/54056128?v=4",
      "created_at": "2019-08-13T06:36:36Z",
      "is_verified": null,
      "public_repos": 83,
      "account_age_days": 2535
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2022-01-03T07:21:44Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] use `npmignore` to autogenerate an npmignore file",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:22:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c406260b8be8a6d7a30a37f9f6da84ed4c0e132e",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@ljharb/eslint-config`, `aud`, `tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:21:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7188768d2a65934b104ffd77102c533dc038d7bf",
          "body": null,
          "is_bot": false,
          "headline": "[actions] update rebase action to use reusable workflow",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:19:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34761bea1f1ff0815e8b3515d1463357b03b9be2",
          "body": "…ngelog`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `eslint`, `@ljharb/eslint-config`, `aud`, `auto-cha…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T04:00:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "be98485fb667bbe3f2b36454cfa725f1e8f8cb8e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] fix FUNDING.yml",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T03:59:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f7cac19c0c298cf40b3f2f3c735477ad579ac61",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.0",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:21:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c9afa9fabc8eaf0814aaed6dd01e6df0931b76d",
          "body": null,
          "is_bot": false,
          "headline": "read me",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:10:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5ef77f7cb6946d16ee38672be9ec0f1bbdf63262",
          "body": null,
          "is_bot": false,
          "headline": "[meta] do not publish workflow files",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "600223ba24f30779f209d9097721eff35ed62741",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `sideEffects` flag",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c476ae1ed7ce68b0480344f090ac2844f35509d",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `auto-changelog`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:54:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2bb23b3ebab02dc4135c4cdf0217db82835b9fca",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `safe-publish-latest`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e2f59ad74e2ae0f5f4899fcde6a6f693ab7cc074",
          "body": null,
          "is_bot": false,
          "headline": "Tests",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2f9892546396d4ab0ad9f1ff83e76c3f01234ae8",
          "body": null,
          "is_bot": false,
          "headline": "Initial implementation",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:45:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d0fffc886d25fba119355520750a909d64da0087",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] add `eslint`, `@ljharb/eslint-config`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:41:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ab318ed7ae62f6c2c0e80a50398d40912afd8f69",
          "body": null,
          "is_bot": false,
          "headline": "Only apps should have lockfiles",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "992b068503a461f7e8676f40ca2aab255fd8d6ff",
          "body": null,
          "is_bot": false,
          "headline": "npm init",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dc222aad3c0b940d8d3af1ca9937d108bd2dc4b9",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:06:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 1,
      "commits_last_year": 0,
      "latest_release_at": "2022-01-03T07:21:44Z",
      "latest_release_tag": "v1.0.0",
      "releases_from_tags": true,
      "days_since_last_push": 1358,
      "active_weeks_last_year": 0,
      "days_since_latest_release": 1661,
      "mean_days_between_releases": null
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": true,
      "health_percentage": 75,
      "has_issue_template": false,
      "has_code_of_conduct": true,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "supports-preserve-symlinks-flag",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "node",
            "flag",
            "symlink",
            "symlinks",
            "preserve-symlinks"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/supports-preserve-symlinks-flag",
          "is_deprecated": false,
          "latest_version": "1.0.0",
          "repository_url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
          "versions_count": 1,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 486692319,
          "first_published_at": "2022-01-03T07:22:56.474000Z",
          "latest_published_at": "2022-01-03T07:22:56.640000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 1661
        }
      ]
    },
    "popularity": {
      "forks": 4,
      "stars": 1,
      "watchers": 1,
      "fork_history": {
        "days": [
          {
            "date": "2022-04-08",
            "count": 1
          },
          {
            "date": "2023-12-25",
            "count": 1
          },
          {
            "date": "2024-01-19",
            "count": 1
          },
          {
            "date": "2026-05-03",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 4,
        "total_forks": 4
      },
      "star_history": null,
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "toolchain_manifests": [],
      "largest_source_bytes": 737,
      "source_files_sampled": 3,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 1,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 9,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@ljharb/eslint-config",
            "direct": false,
            "version": "^21.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "aud",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "auto-changelog",
            "direct": false,
            "version": "^2.4.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint",
            "direct": false,
            "version": "8.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "in-publish",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "npmignore",
            "direct": false,
            "version": "^0.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "nyc",
            "direct": false,
            "version": "^10.3.2",
            "ecosystem": "npm"
          },
          {
            "name": "safe-publish-latest",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "semver",
            "direct": false,
            "version": "^6.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "tape",
            "direct": false,
            "version": "^5.6.1",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 10,
        "direct_count": 0,
        "indirect_count": 10
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 0,
        "open_issues": 1,
        "closed_ratio": 0,
        "closed_issues": 0,
        "closed_unmerged_prs": 0
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "ljharb",
          "commits": 17,
          "avatar_url": "https://avatars.githubusercontent.com/u/45469?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "node-aught.yml",
        "node-pretest.yml",
        "node-tens.yml",
        "rebase.yml",
        "require-allow-edits.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [
        ".eslintrc"
      ],
      "has_editorconfig": false,
      "has_linter_config": true,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 1,
            "reason": "branch protection is not maximal on development and all release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/17 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 31 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 10,
            "reason": "security policy file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
        "ran_at": "2026-07-22T16:30:20Z",
        "aggregate_score": 4,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-22T05:24:47Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": null,
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": [
        {
          "number": 1,
          "created_at": "2022-01-03T07:06:53Z",
          "last_comment_at": null,
          "last_comment_author": null
        }
      ]
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
    "host": "github.com",
    "name": "node-supports-preserve-symlinks-flag",
    "owner": "inspect-js"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 43,
      "inputs": {
        "security": 52,
        "vitality": 13,
        "community": 56,
        "governance": 34,
        "engineering": 68
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "critical",
        "name": "Vitality",
        "value": 13,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "critical",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "commits_last_year": 0,
              "human_commit_share": null,
              "days_since_last_push": 1358,
              "active_weeks_last_year": 0
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 1358 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 1358
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "0/52 weeks with commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "0 commits in the last year",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "at_risk",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 32,
            "inputs": {
              "releases_count": 1,
              "latest_release_tag": "v1.0.0",
              "releases_from_tags": true,
              "days_since_latest_release": 1661,
              "mean_days_between_releases": null
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "1 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 1661 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "cadence unknown (single release)",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence_unknown",
                    "params": {}
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "dormant",
              "guards": [
                "no_open_demand",
                "dependencies_clean"
              ],
              "signals": [
                "scorecard_unmaintained"
              ],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": 0,
              "unanswered_open_issues": 1,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 1358,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "no human commit for 1358 days, with nothing left unanswered; held at dormant by nothing open to answer, no affected dependency",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_quiet",
                    "params": {
                      "days": 1358
                    }
                  },
                  {
                    "code": "abandonment_guarded",
                    "params": {
                      "guards": "nothing open to answer, no affected dependency"
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 56,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 4,
            "inputs": {
              "forks": 4,
              "stars": 1,
              "watchers": 1,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "4 forks",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "1 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "excellent",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 85,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": true,
              "has_issue_template": false,
              "has_code_of_conduct": true,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 18,
                "status": "met",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 13.5,
                "status": "met",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "excellent",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 486692319
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "486,692,319 downloads/month across npm",
                "points": 80,
                "status": "met",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 486692319,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 34,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "pr_acceptance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 1,
              "closed_issues": 0,
              "issue_closed_ratio": 0,
              "closed_unmerged_prs": 0
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "0% of issues closed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 0
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "no decided pull requests or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_decided_prs_or_data",
                    "params": {}
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "followers": 54,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "inspect-js",
              "public_repos": 83,
              "account_age_days": 2535
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "54 followers of inspect-js",
                "points": 12.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 54,
                      "login": "inspect-js"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "83 public repos, account ~6 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 83
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 6
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "moderate",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 53,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 1661
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 1661 days ago",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "1 published versions",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "moderate",
        "name": "Engineering Quality",
        "value": 68,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "good",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 80,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": true,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "5 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": ".eslintrc",
                "points": 16,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "node",
                "symlink",
                "flag",
                "symlinks",
                "preserve-symlinks"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "5 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 52,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 15,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 3,
              "scorecard_aggregate": 4
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection is not maximal on development and all release branches",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 1 resolved dependencies against OSV; 9 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 1
                }
              },
              {
                "code": "advisories_unassessed",
                "params": {
                  "count": 9
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 1,
              "unassessed_packages": 9,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 1,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 10
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 29,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": true,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": ".eslintrc",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 737,
              "source_files_sampled": 3,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/3 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 3,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T16:30:25.610322Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/i/inspect-js/node-supports-preserve-symlinks-flag.svg",
  "full_name": "inspect-js/node-supports-preserve-symlinks-flag",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.26.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasnpm.