Öffentliches Register
Software-GesundheitsberichtSchema 0.26.0 · Metriken 1.13.0 · 2026-07-22 16:30 UTC

inspect-js / node-supports-preserve-symlinks-flag

Determine if the current node version supports the `--preserve-symlinks` flag.

JavaScriptMIT★ 1 Stern⑂ 4 Forksseit Jan. 2022Auf GitHub ansehen ↗

inspect-js/node-supports-preserve-symlinks-flag erreicht einen Gesundheitsindex von 43 von 100 und liegt damit im Bereich Gefährdet. Am stärksten schneidet es bei Engineering Quality (68/100) ab, am schwächsten bei Vitality (13/100). Zuletzt vor 1358 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.

43
gesamt / 100
Gefährdet

Software-Gesundheitsindex

Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.

43
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
VitalitätCommunity &VerbreitungNachhaltigkeit &GovernanceEngineering-QualitätSicherheitAI Readiness

Bewertungsprofil

Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.

Eigentümerschaft

Inspect JSOrganisation
54 Follower83 öffentliche Reposseit Aug. 2019

Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.

Paket-Ökosysteme

RegistryPaketVersionDownloads / MonatVersionenZuletzt veröffentlichtTags
npmsupports-preserve-symlinks-flag1.0.0486.692.3191vor 1661 Tagennodeflagsymlinksymlinkspreserve-symlinks

Metriken nach Kategorie

Vitalität

Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?

13Kritisch · 22 % des Gesamtindex
Wie die Bewertung erfolgt
0/36Push-Aktualität — letzter Push vor 1.358 Tagen
0/36Commit-Rhythmus — 0/52 Wochen mit Commits
0/18Commit-Volumen — 0 Commits im letzten Jahr
0/10OpenSSF Scorecard: Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
Verwendete Eingangsdaten
commits_last_year0
human_commit_share
days_since_last_push1.358
active_weeks_last_year0

Release-Disziplin

32Gefährdet
Wie die Bewertung erfolgt
16.2/27Liefert Releases aus — 1 Versions-Tags (keine GitHub-Releases)
0/36Release-Aktualität — letztes Release vor 1.661 Tagen
12.6/27Release-Rhythmus — Rhythmus unbekannt (nur ein Release)
0/10OpenSSF Scorecard: Signed-Releases — keine Daten
Verwendete Eingangsdaten
releases_count1
latest_release_tagv1.0.0
releases_from_tagsja
days_since_latest_release1.661
mean_days_between_releases
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.

Community & Verbreitung

Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?

56Mittel · 18 % des Gesamtindex
Wie die Bewertung erfolgt
0/60Stars — 1 Stars
4/25Forks — 4 Forks
0/15Watcher — 1 Watcher
Verwendete Eingangsdaten
forks4
stars1
watchers1
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Wie die Bewertung erfolgt
22.5/22.5README
22.5/22.5Lizenz — anerkannte Lizenz (MIT)
18/18CONTRIBUTING-Leitfaden
13.5/13.5Verhaltenskodex
0/7.2Issue-Vorlage
0/6.3PR-Vorlage
Verwendete Eingangsdaten
has_readmeja
has_licenseja
has_contributingja
has_issue_templatenein
has_code_of_conductja
has_pull_request_templatenein
Wie die Bewertung erfolgt
80/80Downloads pro Monat — 486.692.319 Downloads/Monat über npm
0/20Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen
Verwendete Eingangsdaten
packagessupports-preserve-symlinks-flag
dependents
ecosystemsnpm
total_downloads
monthly_downloads486.692.319
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.

Nachhaltigkeit & Governance

Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?

34Gefährdet · 24 % des Gesamtindex
Wie die Bewertung erfolgt
9/54Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab
0/22.5Commit-Verteilung — wichtigste beitragende Person verfasste 100 % der Commits
1.4/13.5Breite der Beitragenden — 1 Beitragende
10/10OpenSSF Scorecard: Contributors — project has 31 contributing companies or organizations
Verwendete Eingangsdaten
bus_factor1
contributors_sampled1
top_contributor_share1
Wie die Bewertung erfolgt
0/46.8Issue-Lösungsquote — 0 % der Issues geschlossen
0/38.3PR-Annahme — keine entschiedenen Pull Requests oder keine Daten
0/15OpenSSF Scorecard: Code-Review — Found 0/17 approved changesets -- score normalized to 0
Verwendete Eingangsdaten
merged_prs0
open_issues1
closed_issues0
issue_closed_ratio0
closed_unmerged_prs0
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): PR-Annahme. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
30/30Organisatorische Trägerschaft — im Besitz einer Organisation
0/20Verifizierte Domain
12.5/25Reichweite des Inhabers — 54 Follower von inspect-js
25/25Kontohistorie — 83 öffentliche Repos, Kontoalter ca. 6 Jahre
Verwendete Eingangsdaten
followers54
owner_typeOrganization
is_verified
owner_logininspect-js
public_repos83
account_age_days2.535

Paketpflege

53Mittel
Wie die Bewertung erfolgt
25/25Veröffentlicht & auflösbar — 1 Paket(e) auf npm
4/35Veröffentlichungsaktualität — letzte Veröffentlichung vor 1.661 Tagen
4/20Versionshistorie — 1 veröffentlichte Versionen
20/20Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen
Verwendete Eingangsdaten
packagessupports-preserve-symlinks-flag
ecosystemsnpm
any_deprecatednein
min_days_since_publish1.661

Engineering-Qualität

Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?

68Mittel · 20 % des Gesamtindex
Wie die Bewertung erfolgt
24/24CI-Workflows — 5 Workflow(s)
24/24Tests vorhanden
16/16Linter-Konfiguration — .eslintrc
0/9.6Pre-Commit-Hooks
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — keine Daten
Verwendete Eingangsdaten
has_cija
has_testsja
has_editorconfignein
has_linter_configja
has_precommit_confignein
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: CI-Tests. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
30/30README
0/25Dokumentationsverzeichnis
0/15Dokumentations-/Homepage-Site
10/10Repository-Beschreibung
10/10Topics — 5 Topics
0/10Wiki
Verwendete Eingangsdaten
topicsnode, symlink, flag, symlinks, preserve-symlinks
has_wikinein
homepage
has_readmeja
has_docs_dirnein
has_descriptionja

Sicherheit

Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?

52Mittel · 16 % des Gesamtindex

Sicherheitslage

40Gefährdet
Wie die Bewertung erfolgt
7.5/7.5Binary-Artifacts — no binaries found in the repo
0.8/7.5Branch-Protection — branch protection is not maximal on development and all release branches
0/2.5CI-Tests — keine Daten
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/17 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 31 contributing companies or organizations
10/10Dangerous-Workflow — no dangerous workflow patterns detected
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Lizenz — license file detected
0/7.5Maintained — 0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
0/5Packaging — keine Daten
0/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
0/5SAST — no SAST tool detected
5/5Security-Policy — security policy file detected
0/7.5Signed-Releases — keine Daten
0/7.5Token-Permissions — detected GitHub workflow tokens with excessive permissions
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Verwendete Eingangsdaten
sourceopenssf_scorecard
checks_evaluated15
scorecard_versionv5.5.0
checks_inconclusive3
scorecard_aggregate4
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): ci_tests, packaging, signed_releases. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
35/35Direkte Abhängigkeiten ohne bekannte Advisories — keine direkte Abhängigkeit trägt ein bekanntes Advisory
0/25Indirekte Abhängigkeiten ohne bekannte Advisories — transitive Menge in diesem Bereich nicht von Entwicklungs- und Test-Abhängigkeiten trennbar
0/40Keine offenen Advisories — kein Advisory trägt ein Veröffentlichungsdatum
Verwendete Eingangsdaten
sourceosv
advisories0
affected_packages0
assessed_packages1
unassessed_packages9
affected_by_severitynone
direct_affected_packages0
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Indirekte Abhängigkeiten ohne bekannte Advisories, Keine offenen Advisories. Die verbleibenden Gewichte wurden renormalisiert. 1 aufgelöste Abhängigkeiten wurden mit OSV abgeglichen. 9 konnten nicht bewertet werden — keine aufgelöste Version, ein nicht unterstütztes Ökosystem oder außerhalb der ausgewiesenen Paketliste. Dieses Repository veröffentlicht kein Paket, das der Index auflöst; bewertet wurde daher der Abhängigkeitsgraph des Repositorys. Dieser Graph vermischt Entwicklungs- und Test-Pins mit ausgelieferten Abhängigkeiten, daher werden nur die deklarierten Laufzeit-Abhängigkeiten bewertet; transitive Befunde werden als Kontext ausgewiesen und fließen nicht in die Bewertung ein. Erreichbarkeit wird nicht analysiert.

AI Readiness

Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.

29Kritisch · 0 % des Gesamtindex
Wie die Bewertung erfolgt
0/45Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln
0/15Maschinenlesbare Doku (llms.txt)
0/40Lesbare Commit-Historie — keine Daten
Verwendete Eingangsdaten
has_llms_txtnein
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Lesbare Commit-Historie. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
0/18Bootstrap mit einem Befehl
22/22Automatisierte Tests
11/11Lint-/Format-Konfiguration — .eslintrc
0/11Statische Typprüfung
0/10Reproduzierbare Umgebung
0/10Belegte Agentenpraxis — keine Daten
0/8Automatisierte Wartung — keine Daten
0/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 0
Verwendete Eingangsdaten
has_nixnein
has_testsja
lockfiles
has_dockerfilenein
typed_languagenein
bootstrap_files
has_devcontainernein
has_linter_configja
typecheck_configs
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Belegte Agentenpraxis, Automatisierte Wartung. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
0/45Typprüfbarer Code — JavaScript ohne Typprüfungs-Konfiguration
55/55Handhabbare Dateigrößen — 0/3 Quelldateien über 60 KB
Verwendete Eingangsdaten
primary_languageJavaScript
largest_source_bytes737
source_files_sampled3
oversized_source_files0

Eckdaten

1GitHub-Sterne
1Mitwirkende
0Commits, letzte 12 Monate
1.358Tage seit letztem Push
1Releases
1Bus-Faktor
1offene Issues
npmPaket-Ökosysteme

Warnungen zur Datenerhebung

  • Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token

Weitere Details

Stern- und Fork-Verlauf 0 ★ / 4 ⇿
0Sterne
4Forks

Wann jeder Stern und Fork hinzugefügt wurde, von GitHub erfasst und nach Tagen gruppiert. Das kumulierte Wachstum steht direkt über den täglichen Zugängen, aus denen es besteht, sodass beide gegeneinander lesbar sind: stetiger organischer Zuwachs sieht ganz anders aus als ein abrupter, kurzlebiger Ausschlag. Wo dieser Unterschied messbar ist, wird er als Wachstumsauthentizität ausgewiesen.

1223344412022-042024-042026-05

Jeder Punkt umfasst 4 Tage.

OpenSSF Scorecard 4.0 / 10
4.0Gesamtwert

Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).Scorecard v5.5.0 · 2026-07-22 16:30 UTC

10Binary-Artifactsno binaries found in the repo
1Branch-Protectionbranch protection is not maximal on development and all release branches
k. A.CI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/17 approved changesets -- score normalized to 0
10Contributorsproject has 31 contributing companies or organizations
10Dangerous-Workflowno dangerous workflow patterns detected
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintained0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0
k. A.Packagingpackaging workflow not detected
0Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 0
0SASTno SAST tool detected
10Security-Policysecurity policy file detected
k. A.Signed-Releasesno releases found
0Token-Permissionsdetected GitHub workflow tokens with excessive permissions
10Vulnerabilities0 existing vulnerabilities detected
Alle Abhängigkeiten 10

Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 0 direkte und 10 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.

RegistryPaketVersionBeziehung
npm@ljharb/eslint-config^21.0.0indirekt
npmaud^2.0.1indirekt
npmauto-changelog^2.4.0indirekt
npmeslint8.8.0indirekt
npmin-publish^2.0.1indirekt
npmnpmignore^0.3.0indirekt
npmnyc^10.3.2indirekt
npmsafe-publish-latest^2.0.0indirekt
npmsemver^6.3.0indirekt
npmtape^5.6.1indirekt
Abhängigkeits-Advisories 0

Dieses Repository veröffentlicht kein vom Index auflösbares Paket, daher wurde sein eigener Abhängigkeitsgraph bewertet – 1 Pakete, darunter auch Entwicklungs- und Test-Pins, die nie ausgeliefert werden: 0 tragen bekannte Advisories, davon 0 direkte. 9 konnten nicht bewertet werden – keine aufgelöste Version, ein nicht unterstütztes Ökosystem, oder außerhalb der ausgewiesenen Paketliste.

Keine bekannten Advisories betreffen die bewerteten Abhängigkeiten.

Ein Advisory bedeutet, dass die im Abhängigkeitsgraphen erfasste Version in den betroffenen Bereich eines Advisories fällt. Erreichbarkeit wird nicht analysiert, und der Graph enthält Entwicklungs- und Test-Pins — ein Fund kann das Werkzeug betreffen und nicht die ausgelieferte Software.

JSON-Rohbericht maschinenlesbar
{
  "data": {
    "repo": {
      "topics": [
        "node",
        "symlink",
        "flag",
        "symlinks",
        "preserve-symlinks"
      ],
      "is_fork": false,
      "size_kb": 24,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 1068
      },
      "pushed_at": "2022-11-02T16:24:38Z",
      "created_at": "2022-01-03T07:06:47Z",
      "owner_type": "Organization",
      "updated_at": "2023-12-25T03:55:36Z",
      "description": "Determine if the current node version supports the `--preserve-symlinks` flag.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript"
      ]
    },
    "owner": {
      "blog": null,
      "name": "Inspect JS",
      "type": "Organization",
      "login": "inspect-js",
      "company": null,
      "location": null,
      "followers": 54,
      "avatar_url": "https://avatars.githubusercontent.com/u/54056128?v=4",
      "created_at": "2019-08-13T06:36:36Z",
      "is_verified": null,
      "public_repos": 83,
      "account_age_days": 2535
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2022-01-03T07:21:44Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] use `npmignore` to autogenerate an npmignore file",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:22:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c406260b8be8a6d7a30a37f9f6da84ed4c0e132e",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] update `@ljharb/eslint-config`, `aud`, `tape`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:21:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7188768d2a65934b104ffd77102c533dc038d7bf",
          "body": null,
          "is_bot": false,
          "headline": "[actions] update rebase action to use reusable workflow",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-11-02T16:19:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34761bea1f1ff0815e8b3515d1463357b03b9be2",
          "body": "…ngelog`, `tape`",
          "is_bot": false,
          "headline": "[Dev Deps] update `eslint`, `@ljharb/eslint-config`, `aud`, `auto-cha…",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T04:00:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "be98485fb667bbe3f2b36454cfa725f1e8f8cb8e",
          "body": null,
          "is_bot": false,
          "headline": "[meta] fix FUNDING.yml",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-03-25T03:59:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f7cac19c0c298cf40b3f2f3c735477ad579ac61",
          "body": null,
          "is_bot": false,
          "headline": "v1.0.0",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:21:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c9afa9fabc8eaf0814aaed6dd01e6df0931b76d",
          "body": null,
          "is_bot": false,
          "headline": "read me",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:10:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5ef77f7cb6946d16ee38672be9ec0f1bbdf63262",
          "body": null,
          "is_bot": false,
          "headline": "[meta] do not publish workflow files",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "600223ba24f30779f209d9097721eff35ed62741",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `sideEffects` flag",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:00:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6c476ae1ed7ce68b0480344f090ac2844f35509d",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `auto-changelog`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:54:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2bb23b3ebab02dc4135c4cdf0217db82835b9fca",
          "body": null,
          "is_bot": false,
          "headline": "[meta] add `safe-publish-latest`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e2f59ad74e2ae0f5f4899fcde6a6f693ab7cc074",
          "body": null,
          "is_bot": false,
          "headline": "Tests",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:53:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2f9892546396d4ab0ad9f1ff83e76c3f01234ae8",
          "body": null,
          "is_bot": false,
          "headline": "Initial implementation",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:45:28Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d0fffc886d25fba119355520750a909d64da0087",
          "body": null,
          "is_bot": false,
          "headline": "[Dev Deps] add `eslint`, `@ljharb/eslint-config`",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:41:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ab318ed7ae62f6c2c0e80a50398d40912afd8f69",
          "body": null,
          "is_bot": false,
          "headline": "Only apps should have lockfiles",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "992b068503a461f7e8676f40ca2aab255fd8d6ff",
          "body": null,
          "is_bot": false,
          "headline": "npm init",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T06:40:10Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dc222aad3c0b940d8d3af1ca9937d108bd2dc4b9",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jordan Harband",
          "author_login": "ljharb",
          "committed_at": "2022-01-03T07:06:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 1,
      "commits_last_year": 0,
      "latest_release_at": "2022-01-03T07:21:44Z",
      "latest_release_tag": "v1.0.0",
      "releases_from_tags": true,
      "days_since_last_push": 1358,
      "active_weeks_last_year": 0,
      "days_since_latest_release": 1661,
      "mean_days_between_releases": null
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": true,
      "health_percentage": 75,
      "has_issue_template": false,
      "has_code_of_conduct": true,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "supports-preserve-symlinks-flag",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "node",
            "flag",
            "symlink",
            "symlinks",
            "preserve-symlinks"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/supports-preserve-symlinks-flag",
          "is_deprecated": false,
          "latest_version": "1.0.0",
          "repository_url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
          "versions_count": 1,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 486692319,
          "first_published_at": "2022-01-03T07:22:56.474000Z",
          "latest_published_at": "2022-01-03T07:22:56.640000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 1661
        }
      ]
    },
    "popularity": {
      "forks": 4,
      "stars": 1,
      "watchers": 1,
      "fork_history": {
        "days": [
          {
            "date": "2022-04-08",
            "count": 1
          },
          {
            "date": "2023-12-25",
            "count": 1
          },
          {
            "date": "2024-01-19",
            "count": 1
          },
          {
            "date": "2026-05-03",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 4,
        "total_forks": 4
      },
      "star_history": null,
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "toolchain_manifests": [],
      "largest_source_bytes": 737,
      "source_files_sampled": 3,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 1,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 9,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@ljharb/eslint-config",
            "direct": false,
            "version": "^21.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "aud",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "auto-changelog",
            "direct": false,
            "version": "^2.4.0",
            "ecosystem": "npm"
          },
          {
            "name": "eslint",
            "direct": false,
            "version": "8.8.0",
            "ecosystem": "npm"
          },
          {
            "name": "in-publish",
            "direct": false,
            "version": "^2.0.1",
            "ecosystem": "npm"
          },
          {
            "name": "npmignore",
            "direct": false,
            "version": "^0.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "nyc",
            "direct": false,
            "version": "^10.3.2",
            "ecosystem": "npm"
          },
          {
            "name": "safe-publish-latest",
            "direct": false,
            "version": "^2.0.0",
            "ecosystem": "npm"
          },
          {
            "name": "semver",
            "direct": false,
            "version": "^6.3.0",
            "ecosystem": "npm"
          },
          {
            "name": "tape",
            "direct": false,
            "version": "^5.6.1",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 10,
        "direct_count": 0,
        "indirect_count": 10
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 0,
        "open_issues": 1,
        "closed_ratio": 0,
        "closed_issues": 0,
        "closed_unmerged_prs": 0
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "ljharb",
          "commits": 17,
          "avatar_url": "https://avatars.githubusercontent.com/u/45469?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": true,
      "ci_workflows": [
        "node-aught.yml",
        "node-pretest.yml",
        "node-tens.yml",
        "rebase.yml",
        "require-allow-edits.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [
        ".eslintrc"
      ],
      "has_editorconfig": false,
      "has_linter_config": true,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 1,
            "reason": "branch protection is not maximal on development and all release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/17 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 31 contributing companies or organizations",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 0,
            "reason": "dependency not pinned by hash detected -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 10,
            "reason": "security policy file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 0,
            "reason": "detected GitHub workflow tokens with excessive permissions",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "9ece58cb2db2c78043a2b36ac98e265d1ec53a6e",
        "ran_at": "2026-07-22T16:30:20Z",
        "aggregate_score": 4,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-22T05:24:47Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": null,
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": [
        {
          "number": 1,
          "created_at": "2022-01-03T07:06:53Z",
          "last_comment_at": null,
          "last_comment_author": null
        }
      ]
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/inspect-js/node-supports-preserve-symlinks-flag",
    "host": "github.com",
    "name": "node-supports-preserve-symlinks-flag",
    "owner": "inspect-js"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 43,
      "inputs": {
        "security": 52,
        "vitality": 13,
        "community": 56,
        "governance": 34,
        "engineering": 68
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "critical",
        "name": "Vitality",
        "value": 13,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "critical",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "commits_last_year": 0,
              "human_commit_share": null,
              "days_since_last_push": 1358,
              "active_weeks_last_year": 0
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 1358 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 1358
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "0/52 weeks with commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 0
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "0 commits in the last year",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "at_risk",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 32,
            "inputs": {
              "releases_count": 1,
              "latest_release_tag": "v1.0.0",
              "releases_from_tags": true,
              "days_since_latest_release": 1661,
              "mean_days_between_releases": null
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "1 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 1661 days ago",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "cadence unknown (single release)",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence_unknown",
                    "params": {}
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "dormant",
              "guards": [
                "no_open_demand",
                "dependencies_clean"
              ],
              "signals": [
                "scorecard_unmaintained"
              ],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": 0,
              "unanswered_open_issues": 1,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 1358,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "no human commit for 1358 days, with nothing left unanswered; held at dormant by nothing open to answer, no affected dependency",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_quiet",
                    "params": {
                      "days": 1358
                    }
                  },
                  {
                    "code": "abandonment_guarded",
                    "params": {
                      "guards": "nothing open to answer, no affected dependency"
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 56,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 4,
            "inputs": {
              "forks": 4,
              "stars": 1,
              "watchers": 1,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "4 forks",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 4
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "1 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "excellent",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 85,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": true,
              "has_issue_template": false,
              "has_code_of_conduct": true,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 18,
                "status": "met",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 13.5,
                "status": "met",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "excellent",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 486692319
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "486,692,319 downloads/month across npm",
                "points": 80,
                "status": "met",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 486692319,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 34,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 20,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): PR acceptance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "pr_acceptance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 1,
              "closed_issues": 0,
              "issue_closed_ratio": 0,
              "closed_unmerged_prs": 0
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "0% of issues closed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "issues_closed_share",
                    "params": {
                      "share": 0
                    }
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "no decided pull requests or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_decided_prs_or_data",
                    "params": {}
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "moderate",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 68,
            "inputs": {
              "followers": 54,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "inspect-js",
              "public_repos": 83,
              "account_age_days": 2535
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "54 followers of inspect-js",
                "points": 12.5,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 54,
                      "login": "inspect-js"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "83 public repos, account ~6 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 83
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 6
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "moderate",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 53,
            "inputs": {
              "packages": [
                "supports-preserve-symlinks-flag"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 1661
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 1661 days ago",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 1661
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "1 published versions",
                "points": 4,
                "status": "partial",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "moderate",
        "name": "Engineering Quality",
        "value": 68,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "good",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 80,
            "inputs": {
              "has_ci": true,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": true,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "5 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": ".eslintrc",
                "points": 16,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "node",
                "symlink",
                "flag",
                "symlinks",
                "preserve-symlinks"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "5 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 5
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 52,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 15,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 3,
              "scorecard_aggregate": 4
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection is not maximal on development and all release branches",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/17 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 31 contributing companies or organizations",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "0 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file detected",
                "points": 5,
                "status": "met",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "detected GitHub workflow tokens with excessive permissions",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 1 resolved dependencies against OSV; 9 could not be assessed (no resolved version, an unsupported ecosystem, or beyond the reported package list). This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 1
                }
              },
              {
                "code": "advisories_unassessed",
                "params": {
                  "count": 9
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 1,
              "unassessed_packages": 9,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 1,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 10
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 29,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 40,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": true,
              "typecheck_configs": [],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": ".eslintrc",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": ".eslintrc"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 55,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 737,
              "source_files_sampled": 3,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/3 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 3,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T16:30:25.610322Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/i/inspect-js/node-supports-preserve-symlinks-flag.svg",
  "full_name": "inspect-js/node-supports-preserve-symlinks-flag",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.

Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.26.0 — vollständige Methodik · Metriken-Wiki.

Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistikennpm.