Public record
Software health reportschema 0.26.0 · metrics 1.13.0 · 2026-07-22 09:24 UTC

peltmonger / create-stardrive

Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.

TypeScriptMIT★ 1 star⑂ 1 forksince May 2026View on GitHub ↗

peltmonger/create-stardrive holds a health index of 52 out of 100, placing it in the Moderate band. It scores highest on Vitality (74/100) and lowest on Community & Adoption (32/100). It was last updated 4 days ago. A single contributor accounts for most of its recent work.

52
overall / 100
Moderate

Software health index

Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.

52
Excellent85-100Exemplary; meets essentially all checked criteria
Good70-84Healthy; minor gaps
Moderate50-69Acceptable with notable gaps; review recommended
At risk30-49Significant weaknesses; adoption warrants caution
Critical1-29Severe problems (abandoned, single-maintainer, no hygiene)
VitalityCommunity &AdoptionSustainability &GovernanceEngineeringQualitySecurityAI Readiness

Score profile

Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.

Ownership

PeltmongerOrganization
1 follower2 public repossince Jun 2022

This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.

Package ecosystems

RegistryPackageVersionDownloads / moVersionsLast publishTags
npmcreate-stardrive1.4.12,190164 days agoastrostardrivejavascripttypescripthtmltailwindweblandingpagestartertemplateframeworkboilerplate

Metrics by category

Vitality

Is the project alive — is code being written and are releases shipping?

74Good · 22% of overall
How it's scored
36/36Push recency — last push 4 days ago
5.5/36Commit cadence — 8/52 weeks with commits
15/18Commit volume — 46 commits in the last year
0/10OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully
Inputs used
commits_last_year46
human_commit_share1
days_since_last_push4
active_weeks_last_year8

Release discipline

100Excellent
How it's scored
27/27Ships releases — 16 releases published
36/36Release recency — latest release 4 days ago
27/27Release cadence — a release every ~2.3 days
0/10OpenSSF Scorecard: Signed-Releases — no data
Inputs used
releases_count16
latest_release_tagv1.4.1
releases_from_tagsno
days_since_latest_release4
mean_days_between_releases2.3
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.

Community & Adoption

Does the project have users, downloads, attention, and a welcoming setup for contributors?

32At risk · 18% of overall
How it's scored
0/60Stars — 1 stars
0/25Forks — 1 forks
0/15Watchers — 0 watchers
Inputs used
forks1
stars1
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonbelow_threshold
How it's scored
22.5/22.5README
22.5/22.5License — recognized license (MIT)
0/18CONTRIBUTING guide
0/13.5Code of conduct
0/7.2Issue template
0/6.3PR template
Inputs used
has_readmeyes
has_licenseyes
has_contributingno
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno
How it's scored
44.5/80Monthly downloads — 2,190 downloads/month across npm
0/20Registry dependents — not reported by this ecosystem
Inputs used
packagescreate-stardrive
dependents
ecosystemsnpm
total_downloads
monthly_downloads2,190
Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.

Sustainability & Governance

Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?

46At risk · 24% of overall
How it's scored
9/54Bus factor — 1 contributor(s) cover half of all commits
0/22.5Commit distribution — top contributor authored 100% of commits
1.4/13.5Contributor breadth — 1 contributors
0/10OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0
Inputs used
bus_factor1
contributors_sampled1
top_contributor_share1
How it's scored
0/46.8Issue resolution — no issues or no data
25.5/38.3PR acceptance — 2/3 decided PRs merged
0/15OpenSSF Scorecard: Code-Review — Found 0/29 approved changesets -- score normalized to 0
Inputs used
merged_prs2
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs1
Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.
How it's scored
30/30Ownership backing — organization-owned
0/20Verified domain
2.2/25Owner reach — 1 followers of peltmonger
11.6/25Track record — 2 public repos, account ~4 yr old
Inputs used
followers1
owner_typeOrganization
is_verified
owner_loginpeltmonger
public_repos2
account_age_days1,483
How it's scored
25/25Published & resolvable — 1 package(s) on npm
35/35Publish recency — latest publish 4 days ago
20/20Version history — 16 published versions
20/20Not deprecated — active, not deprecated or yanked
Inputs used
packagescreate-stardrive
ecosystemsnpm
any_deprecatedno
min_days_since_publish4

Engineering Quality

Are baseline engineering and documentation practices in place?

46At risk · 20% of overall
How it's scored
24/24CI workflows — 1 workflow(s)
0/24Tests present
0/16Linter config
0/9.6Pre-commit hooks
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10
Inputs used
has_ciyes
has_testsno
has_editorconfigno
has_linter_configno
has_precommit_configno

Documentation

50Moderate
How it's scored
30/30README
0/25Documentation directory
0/15Documentation / homepage site
10/10Repository description
10/10Topics — 7 topics
0/10Wiki
Inputs used
topicsastro, astro-boilerplate, astro-starter, astro-template, astrojs, boilerplate, starter
has_wikino
homepage
has_readmeyes
has_docs_dirno
has_descriptionyes

Security

Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?

60Moderate · 16% of overall
How it's scored
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
2.5/2.5CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/29 approved changesets -- score normalized to 0
0/2.5Contributors — project has 0 contributing companies or organizations -- score normalized to 0
10/10Dangerous-Workflow — no dangerous workflow patterns detected
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5License — license file detected
0/7.5Maintained — project was created within the last 90 days. Please review its contents carefully
0/5Packaging — no data
1/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — no data
7.5/7.5Token-Permissions — GitHub workflow tokens follow principle of least privilege
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Inputs used
sourceopenssf_scorecard
checks_evaluated16
scorecard_versionv5.5.0
checks_inconclusive2
scorecard_aggregate5
Excluded from scoring (no data or not applicable): packaging, signed_releases. Remaining weights renormalized.
How it's scored
35/35Direct dependencies free of known advisories — no direct dependency carries a known advisory
0/25Indirect dependencies free of known advisories — transitive set not separable from development and test dependencies in this scope
0/40No advisories left outstanding — no advisory carries a publication date
Inputs used
sourceosv
advisories0
affected_packages0
assessed_packages30
unassessed_packages0
affected_by_severitynone
direct_affected_packages0
Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 30 resolved dependencies against OSV. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.

AI Readiness

How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.

50Moderate · 0% of overall
How it's scored
45/45Agent instructions — AGENTS.md, CLAUDE.md
0/15Machine-readable docs (llms.txt)
4.6/40Legible commit history — 4 of 46 human commits state their intent (structured subject or explanatory body)
Inputs used
has_llms_txtno
legible_history_share0.087
agent_instruction_filesAGENTS.md, CLAUDE.md
agent_instruction_max_bytes4,765
How it's scored
0/18One-command bootstrap
0/22Automated tests
0/11Lint / format config
11/11Static type checking — tsconfig.json
10/10Reproducible environment — lockfile
4.3/10Demonstrated agent practice — 1 of the last 46 commits agent-authored or agent-credited
5/8Automated maintenance — dependency automation configured, none observed in the sampled commits
2/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
Inputs used
has_nixno
has_testsno
lockfilespackage-lock.json
has_dockerfileno
typed_languageyes
bootstrap_files
has_devcontainerno
has_linter_configno
typecheck_configstsconfig.json
agent_commit_share0.022
toolchain_manifests
dependency_bot_commit_share0
How it's scored
45/45Type-checkable code — TypeScript (statically typed)
55/55Manageable file sizes — 0/10 source files over 60KB
Inputs used
primary_languageTypeScript
largest_source_bytes13,237
source_files_sampled10
oversized_source_files0

Key facts

1GitHub stars
1contributors
46commits, last 12 months
4days since last push
16releases
1bus factor
0open issues
npmpackage ecosystems

Data collection warnings

  • deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead

More detail

OpenSSF Scorecard 5.0 / 10
5.0aggregate

Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).Scorecard v5.5.0 · 2026-07-22 09:23 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
10CI-Tests1 out of 1 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/29 approved changesets -- score normalized to 0
0Contributorsproject has 0 contributing companies or organizations -- score normalized to 0
10Dangerous-Workflowno dangerous workflow patterns detected
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintainedproject was created within the last 90 days. Please review its contents carefully
n/aPackagingpackaging workflow not detected
2Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 2
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
n/aSigned-Releasesno releases found
10Token-PermissionsGitHub workflow tokens follow principle of least privilege
10Vulnerabilities0 existing vulnerabilities detected
All dependencies 30

Full resolved dependency set from the GitHub dependency graph: 0 direct and 30 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.

RegistryPackageVersionRelation
npm@esbuild/aix-ppc640.28.1indirect
npm@esbuild/android-arm0.28.1indirect
npm@esbuild/android-arm640.28.1indirect
npm@esbuild/android-x640.28.1indirect
npm@esbuild/darwin-arm640.28.1indirect
npm@esbuild/darwin-x640.28.1indirect
npm@esbuild/freebsd-arm640.28.1indirect
npm@esbuild/freebsd-x640.28.1indirect
npm@esbuild/linux-arm0.28.1indirect
npm@esbuild/linux-arm640.28.1indirect
npm@esbuild/linux-ia320.28.1indirect
npm@esbuild/linux-loong640.28.1indirect
npm@esbuild/linux-mips64el0.28.1indirect
npm@esbuild/linux-ppc640.28.1indirect
npm@esbuild/linux-riscv640.28.1indirect
npm@esbuild/linux-s390x0.28.1indirect
npm@esbuild/linux-x640.28.1indirect
npm@esbuild/netbsd-arm640.28.1indirect
npm@esbuild/netbsd-x640.28.1indirect
npm@esbuild/openbsd-arm640.28.1indirect
npm@esbuild/openbsd-x640.28.1indirect
npm@esbuild/openharmony-arm640.28.1indirect
npm@esbuild/sunos-x640.28.1indirect
npm@esbuild/win32-arm640.28.1indirect
npm@esbuild/win32-ia320.28.1indirect
npm@esbuild/win32-x640.28.1indirect
npm@types/node26.1.1indirect
npmesbuild0.28.1indirect
npmtypescript6.0.3indirect
npmundici-types8.3.0indirect
Dependency advisories 0

This repository publishes no package the index resolves, so its own dependency graph was assessed — 30 packages, which also include development and test pins that never ship: 0 carry known advisories, of which 0 are direct.

No known advisories affect the assessed dependencies.

An advisory means the version recorded in the dependency graph falls inside an advisory’s affected range. Reachability is not analysed, and the graph includes development and test pins — a finding may concern tooling rather than shipped software.

Raw JSON report machine-readable
{
  "data": {
    "repo": {
      "topics": [
        "astro",
        "astro-boilerplate",
        "astro-starter",
        "astro-template",
        "astrojs",
        "boilerplate",
        "starter"
      ],
      "is_fork": false,
      "size_kb": 178,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 350,
        "TypeScript": 25579
      },
      "pushed_at": "2026-07-17T10:39:54Z",
      "created_at": "2026-05-12T09:12:35Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-17T10:39:58Z",
      "description": "Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "TypeScript",
      "significant_languages": [
        "TypeScript"
      ]
    },
    "owner": {
      "blog": "https://peltmonger.com",
      "name": "Peltmonger",
      "type": "Organization",
      "login": "peltmonger",
      "company": null,
      "location": "Germany",
      "followers": 1,
      "avatar_url": "https://avatars.githubusercontent.com/u/108459341?v=4",
      "created_at": "2022-06-30T09:05:48Z",
      "is_verified": null,
      "public_repos": 2,
      "account_age_days": 1483
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.4.1",
          "kind": "patch",
          "published_at": "2026-07-17T10:30:31Z"
        },
        {
          "tag": "v1.4.0",
          "kind": "minor",
          "published_at": "2026-07-17T09:36:36Z"
        },
        {
          "tag": "v1.3.8",
          "kind": "patch",
          "published_at": "2026-07-15T08:25:51Z"
        },
        {
          "tag": "v1.3.7",
          "kind": "patch",
          "published_at": "2026-07-09T17:38:28Z"
        },
        {
          "tag": "v1.3.6",
          "kind": "patch",
          "published_at": "2026-07-09T09:56:20Z"
        },
        {
          "tag": "v1.3.5",
          "kind": "patch",
          "published_at": "2026-07-07T19:08:50Z"
        },
        {
          "tag": "v1.3.4",
          "kind": "patch",
          "published_at": "2026-07-07T18:48:32Z"
        },
        {
          "tag": "v1.3.3",
          "kind": "patch",
          "published_at": "2026-07-06T20:44:35Z"
        },
        {
          "tag": "v1.2.3",
          "kind": "patch",
          "published_at": "2026-06-26T23:35:42Z"
        },
        {
          "tag": "v1.2.2",
          "kind": "patch",
          "published_at": "2026-06-26T10:22:06Z"
        },
        {
          "tag": "v1.2.1",
          "kind": "patch",
          "published_at": "2026-06-24T11:39:43Z"
        },
        {
          "tag": "v1.2.0",
          "kind": "minor",
          "published_at": "2026-06-23T23:34:09Z"
        },
        {
          "tag": "v1.1.0",
          "kind": "minor",
          "published_at": "2026-06-12T11:57:44Z"
        },
        {
          "tag": "v1.0.2",
          "kind": "patch",
          "published_at": "2026-06-04T20:00:16Z"
        },
        {
          "tag": "v1.0.1",
          "kind": "patch",
          "published_at": "2026-06-04T19:45:35Z"
        },
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2026-06-04T19:30:28Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
          "body": null,
          "is_bot": false,
          "headline": "one more line",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T10:39:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b2748dfe662bab9da021dd96e032b4058905b361",
          "body": null,
          "is_bot": false,
          "headline": "better blank line after removal handling; fixing droppedFeatures line",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T10:30:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7830e01e4be3b69777afd7a29f68401ed8ec40fa",
          "body": null,
          "is_bot": false,
          "headline": "droppedFeatures and better block removal",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T09:36:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "848be30079e4a5f47e844059ed7768cb434a4b28",
          "body": null,
          "is_bot": false,
          "headline": "optimizing gitignore and publish script",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:25:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "64a8f1526ff4cb512c8c712886cd4c78e35bbf3c",
          "body": null,
          "is_bot": false,
          "headline": "silencing install output",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:08:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ebef7c5e529c448fe2c380aa0bdb872ebaf58bdb",
          "body": null,
          "is_bot": false,
          "headline": "lower case optimization",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:05:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "642061bdaace3cad263d5a0ebebc142255a426a7",
          "body": null,
          "is_bot": false,
          "headline": "improving win compat",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-09T17:37:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f5b7a1598be628c78d112b74925cf833fa5db48",
          "body": null,
          "is_bot": false,
          "headline": "Fixing compatibility issues with Windows",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-09T09:41:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a508063fe088bae6bc34974b307df99c99d5c51",
          "body": null,
          "is_bot": false,
          "headline": "sponsoring option",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T19:56:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "277c0616fd04493c1a87dfc18f3bbfeece0016f3",
          "body": null,
          "is_bot": false,
          "headline": "Cloudflare fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T19:08:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7bcef54fc78a55e581622972859511289b3bc266",
          "body": null,
          "is_bot": false,
          "headline": "better cleanup with no features selected",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T18:47:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e75ed490c1a3fdf06b755578bdb17589e4853481",
          "body": null,
          "is_bot": false,
          "headline": "STARDRIVE_AGENT_MODE file fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-06T23:06:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "294b75cb2c89bd1c05ba0c4eea52cbd6eb41bb84",
          "body": null,
          "is_bot": false,
          "headline": "calibrating gitignore",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-06T20:43:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e3388f5384cb88ff58165032ae0b741d6f3710da",
          "body": null,
          "is_bot": false,
          "headline": "adjust to new component structure",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-02T18:45:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18b56ccaacae766b90db3316456906fc0ae56816",
          "body": null,
          "is_bot": false,
          "headline": "removing custom event sitemap",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T22:38:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "84c9ad3de31566b99e199fcae0d9041099e82475",
          "body": null,
          "is_bot": false,
          "headline": "adding event-bridge to be dropped in the event case",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T20:46:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "422f461d1fc3107c4fe47f229a45ba3d4e30415f",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T18:56:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9f4e29cc28b47debbc96f27bdcc737d665a71a9b",
          "body": null,
          "is_bot": false,
          "headline": "setAgentMode",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T08:00:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4e61ad459070858f7fce43d74e5238ce31704b40",
          "body": null,
          "is_bot": false,
          "headline": "faq fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T00:23:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "93ed13a55c65dc3814a312ecc76c28bb4afca52c",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T18:42:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f026327c9cf5377350501a890cb88ac4edcd4d3",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T12:47:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7abc3f632918c8cfd002de04264aa91fed7ecb12",
          "body": null,
          "is_bot": false,
          "headline": "clean-up for events feature",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T11:39:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3a21c8335bff0bc547f07d626900c3cb4de37666",
          "body": null,
          "is_bot": false,
          "headline": "typo",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-28T13:59:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "58843603314626d27acfc987df23368a0eb18227",
          "body": null,
          "is_bot": false,
          "headline": "agents.md fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-28T13:55:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "51e837fc376dbec6f09186925f5541f8763459cf",
          "body": null,
          "is_bot": false,
          "headline": "minor fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-26T23:09:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f3a0f6e9961b8036993d67b52a7f8b2984c0bab5",
          "body": null,
          "is_bot": false,
          "headline": "also drop _redirects on CF disable",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-26T10:21:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ce22427d5c7534a95e776a34e7037ff55de62480",
          "body": null,
          "is_bot": false,
          "headline": "minor scaffold fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-24T11:24:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0301d2cb71c65530295059205638dcd8741b9d5e",
          "body": null,
          "is_bot": false,
          "headline": "feature trim guide",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-23T23:33:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f7e478534bfe982a7ea6cff0ea7326bc9d07dae",
          "body": "minor updates",
          "is_bot": false,
          "headline": "Merge pull request #3 from Peltmonger/docs/publishing-flow",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-21T21:28:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3341e6bb962283fd10286659e758f79362d19e1f",
          "body": null,
          "is_bot": false,
          "headline": "minor updates",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-21T21:27:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bce6973004317ae860b95bacbe80a24593adf398",
          "body": null,
          "is_bot": false,
          "headline": "better llm docs",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T12:06:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "37a92b4859e46e0eb1295ed2818213b4baf805ac",
          "body": null,
          "is_bot": false,
          "headline": "claude.md",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T12:04:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "338c28f8b4f63a5b323b9b9e3fbef6c3194fd818",
          "body": "Making it a TS project",
          "is_bot": false,
          "headline": "Bump version from 1.0.2 to 1.1.0",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:57:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a0647ad74677cf60ad6af9672c2dbace79eb96a4",
          "body": "Convert CLI to TypeScript with esbuild build step",
          "is_bot": false,
          "headline": "Merge pull request #1 from Peltmonger/worktree-ts-rewrite",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:56:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0dec6b93eada11d0c97e1f491d47c9c735ac8b38",
          "body": null,
          "is_bot": false,
          "headline": "Fix script formatting in package.json",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:55:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d549fce98bb52190707d708ab2bc1378cd1372a6",
          "body": "Splits the single bin/index.js into typed modules under src/ and bundles\nback to bin/index.js via esbuild. The published artifact is unchanged\nbehaviorally; bin/index.js is now generated and gitignored.\n\n- src/{index,logger,args,package-manager,project-name,release,scaffold,types}.ts\n- build.mjs: es\n[…]\njs\"]), engines >=18,\n  scripts: build, typecheck, prepublishOnly\n- npm-publish workflow: npm ci + npm run build before npm publish\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "typescript rewrite with esbuild build",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:41:03Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "76ce4bc0dfe657459f93abbf63cd58d96df5eec1",
          "body": null,
          "is_bot": false,
          "headline": "readme fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T20:00:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fb3355b797bf5393402d5adffdc74343160f3aa3",
          "body": null,
          "is_bot": false,
          "headline": "v up",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:59:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b17f824dc49f82215b7285e4f48e76c82a1b573f",
          "body": null,
          "is_bot": false,
          "headline": "no detached warning",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:58:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "eafcd678b45c58a4c2880f0c10d6c6b50f06840d",
          "body": null,
          "is_bot": false,
          "headline": "slimer publish",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:43:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "cfdc04a868ae7de18d8874ced9797b092e919af2",
          "body": null,
          "is_bot": false,
          "headline": "smoother cli flow",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:41:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5c9673aa8b0e3af43c1d3e7903b81f695091a0b5",
          "body": null,
          "is_bot": false,
          "headline": "fix script",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:29:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6447a5abff0c93312248b2548c5c004116481636",
          "body": null,
          "is_bot": false,
          "headline": "readme fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:27:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6866c7e3cdc0151a36669b7d53fafe2587e67570",
          "body": null,
          "is_bot": false,
          "headline": "initial version",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:23:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fb60441afd50dcf93a73da9e182a9a383ff613b7",
          "body": "Updated Dependabot configuration to enable npm updates and changed schedule to monthly.",
          "is_bot": false,
          "headline": "Enable npm updates and change schedule to monthly",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-05-12T09:18:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b11a061c02b2c1d6f68ce8885179b4e797faeda6",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-05-12T09:12:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 16,
      "commits_last_year": 46,
      "latest_release_at": "2026-07-17T10:30:31Z",
      "latest_release_tag": "v1.4.1",
      "releases_from_tags": false,
      "days_since_last_push": 4,
      "active_weeks_last_year": 8,
      "days_since_latest_release": 4,
      "mean_days_between_releases": 2.3
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "create-stardrive",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "astro",
            "stardrive",
            "javascript",
            "typescript",
            "html",
            "tailwind",
            "web",
            "landingpage",
            "starter",
            "template",
            "framework",
            "boilerplate"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/create-stardrive",
          "is_deprecated": false,
          "latest_version": "1.4.1",
          "repository_url": "https://github.com/peltmonger/create-stardrive",
          "versions_count": 16,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 2190,
          "first_published_at": "2026-06-04T19:33:13.337000Z",
          "latest_published_at": "2026-07-17T10:30:43.470000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 4
        }
      ]
    },
    "popularity": {
      "forks": 1,
      "stars": 1,
      "watchers": 0,
      "fork_history": {
        "days": [
          {
            "date": "2026-07-10",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_forks": 1
      },
      "star_history": {
        "days": [
          {
            "date": "2026-07-10",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_stars": 1
      },
      "open_issues_and_prs": 0
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "toolchain_manifests": [],
      "largest_source_bytes": 13237,
      "source_files_sampled": 10,
      "oversized_source_files": 0,
      "agent_instruction_files": [
        "AGENTS.md",
        "CLAUDE.md"
      ],
      "agent_instruction_max_bytes": 4765
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 30,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@esbuild/aix-ppc64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-arm",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/darwin-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/darwin-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/freebsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/freebsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-arm",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-ia32",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-loong64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-mips64el",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-ppc64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-riscv64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-s390x",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/netbsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/netbsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openbsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openbsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openharmony-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/sunos-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-ia32",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@types/node",
            "direct": false,
            "version": "26.1.1",
            "ecosystem": "npm"
          },
          {
            "name": "esbuild",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "typescript",
            "direct": false,
            "version": "6.0.3",
            "ecosystem": "npm"
          },
          {
            "name": "undici-types",
            "direct": false,
            "version": "8.3.0",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 30,
        "direct_count": 0,
        "indirect_count": 30
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 2,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 1
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "jekuer",
          "commits": 46,
          "avatar_url": "https://avatars.githubusercontent.com/u/8572883?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": false,
      "ci_workflows": [
        "npm-publish.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "package-lock.json"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/29 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 0,
            "reason": "project has 0 contributing companies or organizations -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "project was created within the last 90 days. Please review its contents carefully",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 2,
            "reason": "dependency not pinned by hash detected -- score normalized to 2",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 10,
            "reason": "GitHub workflow tokens follow principle of least privilege",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
        "ran_at": "2026-07-22T09:23:54Z",
        "aggregate_score": 5,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": true
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-17T10:41:07Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": "2026-06-21T21:28:08Z",
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": []
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/peltmonger/create-stardrive",
    "host": "github.com",
    "name": "create-stardrive",
    "owner": "peltmonger"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 52,
      "inputs": {
        "security": 60,
        "vitality": 74,
        "community": 32,
        "governance": 46,
        "engineering": 46
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 74,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 56,
            "inputs": {
              "commits_last_year": 46,
              "human_commit_share": 1,
              "days_since_last_push": 4,
              "active_weeks_last_year": 8
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "8/52 weeks with commits",
                "points": 5.5,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 8
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "46 commits in the last year",
                "points": 15,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 46
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "project was created within the last 90 days. Please review its contents carefully",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "releases_count": 16,
              "latest_release_tag": "v1.4.1",
              "releases_from_tags": false,
              "days_since_latest_release": 4,
              "mean_days_between_releases": 2.3
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "16 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 16
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~2.3 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 2.3
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 32,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 1,
              "stars": 1,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "below_threshold"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "1 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 56,
            "inputs": {
              "packages": [
                "create-stardrive"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 2190
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "2,190 downloads/month across npm",
                "points": 44.5,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 2190,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 46,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 10,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "at_risk",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 48,
            "inputs": {
              "merged_prs": 2,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 1
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "2/3 decided PRs merged",
                "points": 25.5,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 2,
                      "decided": 3
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/29 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "at_risk",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "followers": 1,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "peltmonger",
              "public_repos": 2,
              "account_age_days": 1483
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "1 followers of peltmonger",
                "points": 2.2,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 1,
                      "login": "peltmonger"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "2 public repos, account ~4 yr old",
                "points": 11.6,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 2
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 4
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "create-stardrive"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 4
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 4 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "16 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 16
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "at_risk",
        "name": "Engineering Quality",
        "value": 46,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "at_risk",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_ci": true,
              "has_tests": false,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "1 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "astro",
                "astro-boilerplate",
                "astro-starter",
                "astro-template",
                "astrojs",
                "boilerplate",
                "starter"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "7 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 7
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 60,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "moderate",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 50,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 16,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 2,
              "scorecard_aggregate": 5
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/29 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "project was created within the last 90 days. Please review its contents carefully",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 1,
                "status": "partial",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "GitHub workflow tokens follow principle of least privilege",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 30 resolved dependencies against OSV. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 30
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 30,
              "unassessed_packages": 0,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 30,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 2
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 50,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "moderate",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0.087,
              "agent_instruction_files": [
                "AGENTS.md",
                "CLAUDE.md"
              ],
              "agent_instruction_max_bytes": 4765
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "AGENTS.md, CLAUDE.md",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "AGENTS.md, CLAUDE.md"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "4 of 46 human commits state their intent (structured subject or explanatory body)",
                "points": 4.6,
                "status": "partial",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 4,
                      "sampled": 46
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": null,
            "notes": [],
            "value": 32,
            "inputs": {
              "has_nix": false,
              "has_tests": false,
              "lockfiles": [
                "package-lock.json"
              ],
              "has_dockerfile": false,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": 0.022,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "1 of the last 46 commits agent-authored or agent-credited",
                "points": 4.3,
                "status": "partial",
                "details": [
                  {
                    "code": "agent_authored_commits",
                    "params": {
                      "count": 1,
                      "sampled": 46
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "dependency automation configured, none observed in the sampled commits",
                "points": 5,
                "status": "partial",
                "details": [
                  {
                    "code": "dependency_bot_config_only",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 2,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "primary_language": "TypeScript",
              "largest_source_bytes": 13237,
              "source_files_sampled": 10,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "TypeScript (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "TypeScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/10 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 10,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T09:24:00.880826Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/p/peltmonger/create-stardrive.svg",
  "full_name": "peltmonger/create-stardrive",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.

Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.26.0 — full methodology · metrics wiki.

How one result sits in the wider record: aggregate statisticsnpm.